RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254780954|ref|YP_003065367.1| hypothetical protein
CLIBASIA_04265 [Candidatus Liberibacter asiaticus str. psy62]
         (380 letters)



>2q3l_A Uncharacterized protein; YP_001095227.1, structural
           genomics, joint center for structural genomics, JCSG,
           protein structure initiative; HET: MSE; 2.25A
           {Shewanella loihica pv-4} (A:)
          Length = 126

 Score = 30.5 bits (69), Expect = 0.37
 Identities = 18/119 (15%), Positives = 36/119 (30%), Gaps = 27/119 (22%)

Query: 1   MLRRVLIGLGFLFSVVLVGAFTVPLFIDWTDFREDFERQATLIVGKKIAVKGGIKIHIL- 59
            +        F  +   VG  T           ED+E+   L+    +A     +I  L 
Sbjct: 10  AIGIERSQDDFYLAFKAVGKLT----------HEDYEQXTPLLE-SALAGIKTPEIVALI 58

Query: 60  -------PFPSVFFKDIRIDQKEDGSFE-------SKIEGLSMRAEFLPLLSGEIRVFD 104
                        + D+++  K    F+        +++  + R        GE + F+
Sbjct: 59  DITELDGLSLHAAWDDLKLGLKHGKEFKRVAIIGQGELQEWATRV-ANWFTPGEFKFFE 116


>2ook_A Hypothetical protein; structural genomics, joint center for
           structural genomics, JCSG, protein structure initiative,
           PSI-2; HET: MSE; 1.80A {Shewanella frigidimarina ncimb
           400} (A:)
          Length = 127

 Score = 29.8 bits (67), Expect = 0.64
 Identities = 16/120 (13%), Positives = 36/120 (30%), Gaps = 25/120 (20%)

Query: 1   MLRRVLIGLGFLFSVVLVGAFTVPLFIDWTDFREDFERQATLIVGKKIAVKGGIKIHILP 60
            +    I   F  ++  +G  T           ED+      +    ++     K+ +  
Sbjct: 10  SIGINRIESVFFVTLKAIGTLT----------HEDYLVITPXLE-GALSQVDQPKVSLFL 58

Query: 61  F--------PSVFFKDIRIDQKEDGSFE-----SKIEGLSMRAEFL-PLLSGEIRVFDMY 106
                        + D+++  K    FE        +     A+     ++GEI+ F+  
Sbjct: 59  DATELDGWDLRAAWDDLKLGLKHKSEFERVAILGNKDWQEWAAKIGSWFIAGEIKYFEDE 118


>3fho_A ATP-dependent RNA helicase DBP5; mRNA export, ATPase,
           translation termination, ATP-binding, cytoplasm,
           hydrolase, membrane; 2.80A {Schizosaccharomyces pombe}
           (A:1-326)
          Length = 326

 Score = 25.9 bits (56), Expect = 8.9
 Identities = 10/88 (11%), Positives = 20/88 (22%), Gaps = 35/88 (39%)

Query: 8   GLGFLFSVVLVGAFTVPLFIDWTDFREDFE---------RQ-----ATL---IVGKKIAV 50
                  + +         +D     +             Q     AT    +  +K A 
Sbjct: 253 RQLDARDIKVFVLDEADNMLDQQGLGDQSMRIKHLLPRNTQIVLFSATFSERV--EKYAE 310

Query: 51  KGGIKIHILPFPSVFFKD---IRIDQKE 75
           +             F  +   IR+  +E
Sbjct: 311 R-------------FAPNANEIRLKTEE 325


>1q7z_A 5-methyltetrahydrofolate S-homocysteine methyltransferase;
           methionine, cobalamin, vitamin B12; 1.70A {Thermotoga
           maritima} (A:295-566)
          Length = 272

 Score = 25.8 bits (56), Expect = 9.6
 Identities = 17/105 (16%), Positives = 28/105 (26%), Gaps = 20/105 (19%)

Query: 109 QPHLNFYLSSKGVSNWFQRKSTMDMIHNVILEKIHVKGGRI----KIIDQESDQVYF--- 161
           +    F +SS      F     +    N    K      +      +I +   QV     
Sbjct: 2   KKKRIFAVSSPSKLVTFDHFVVIGERINPAGRKKLWAEMQKGNEEIVIKEAKTQVEKGAE 61

Query: 162 LSDLNLQIS-----ARFLNIIS--------PLSIDSIKGSVIAEG 193
           + D+N  I           I+         PLS+D     +    
Sbjct: 62  VLDVNFGIESQIDVRYVEKIVQTLPYVSNVPLSLDIQNVDLTERA 106


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.318    0.137    0.387 

Gapped
Lambda     K      H
   0.267   0.0681    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 2,736,127
Number of extensions: 122788
Number of successful extensions: 284
Number of sequences better than 10.0: 1
Number of HSP's gapped: 284
Number of HSP's successfully gapped: 11
Length of query: 380
Length of database: 4,956,049
Length adjustment: 90
Effective length of query: 290
Effective length of database: 1,913,599
Effective search space: 554943710
Effective search space used: 554943710
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.1 bits)