RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780955|ref|YP_003065368.1| hypothetical protein CLIBASIA_04270 [Candidatus Liberibacter asiaticus str. psy62] (204 letters) >gnl|CDD|33607 COG3814, COG3814, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 157 Score = 182 bits (462), Expect = 7e-47 Identities = 100/180 (55%), Positives = 123/180 (68%), Gaps = 23/180 (12%) Query: 25 MNYDHIRYDILAKEALRGLVKVVLSEVASIGSLPGEHHFYITFATNARGVRISQNLRKNY 84 M DHIRYDILA+EALRG+VK VL++VA+ G LPG+HHFYITF T A GVRI L++ Y Sbjct: 1 MGQDHIRYDILAQEALRGVVKKVLAKVAATG-LPGDHHFYITFLTGAPGVRIPSKLKQKY 59 Query: 85 PEKMTIVIQNQFWDLKVLDNHFEVGLSFSNVPERLVIPFNAIKGFYDPSVNFELEFDVHI 144 PE+MTIV+Q+QFWDLKV D F V LSFS VPE+L IPF+A++GFYDPSVNFELEFDV Sbjct: 60 PEQMTIVLQHQFWDLKVTDTGFSVTLSFSGVPEKLYIPFDALRGFYDPSVNFELEFDVS- 118 Query: 145 EHIEEKLEGGNTGKVLTSPDNFDKNQTNSVSQDSSKKKSTKKQNKNKMASVISLDNFRKK 204 +IEE+ E P+ N+ S + S+ +V+SLD FRKK Sbjct: 119 LNIEEEAE----------PEAEPSNKAKSGATSDSEG-----------PNVVSLDAFRKK 157 >gnl|CDD|146826 pfam04386, SspB, Stringent starvation protein B. Escherichia coli stringent starvation protein B (SspB), is thought to enhance the specificity of degradation of tmRNA-tagged proteins by the ClpXP protease. The tmRNA tag, also known as ssrA, is an 11-aa peptide added to the C terminus of proteins stalled during translation, targets proteins for degradation by ClpXP and ClpAP. SspB a cytoplasmic protein that specifically binds to residues 1-4 and 7 of the tag. Binding of SspB enhances degradation of tagged proteins by ClpX, and masks sequence elements important for ClpA interactions, inhibiting degradation by ClpA. However, more recent work has cast doubt on the importance of SspB in wild-type cells. SspB is encoded in an operon whose synthesis is stimulated by carbon, amino acid, and phosphate starvation. SspB may play a special role during nutrient stress, for example by ensuring rapid degradation of the products of stalled translation, without causing a global increase in degradation of all ClpXP substrates. Length = 152 Score = 172 bits (439), Expect = 5e-44 Identities = 56/167 (33%), Positives = 82/167 (49%), Gaps = 15/167 (8%) Query: 30 IRYDILAKEALRGLVKVVLSEVASIGSLPGEHHFYITFATNARGVRISQNLRKNYPEKMT 89 I YD L ALR + + VL++VA G L +H YITF T A GV++ L + YP+ M Sbjct: 1 ITYDSLRPYALRAVYRWVLTDVAKEG-LDNDHTPYITFDTTAPGVQVPDELVERYPQIML 59 Query: 90 IVIQNQFWDLKVLDNHFEVGLSFSNVPERLVIPFNAIKGFYDPSVNFELEFDVHIEHIEE 149 V+Q+ FWDL+V ++ F L F VPERL +PF AI FYDP F L+F+ +E Sbjct: 60 NVLQHAFWDLEVGNDGFSFNLRFGGVPERLYVPFAAILAFYDPENGFGLQFEPEEADEDE 119 Query: 150 KLEGGNTGKVLTSPDNFDKNQTNSVSQDSSKKKSTKKQNKNKMASVI 196 + + ++ + + + K K V+ Sbjct: 120 --------------EEEEDDEADEEDDEDPEPKDPPKTKGRPSLKVV 152 >gnl|CDD|36420 KOG1206, KOG1206, KOG1206, Peroxisomal multifunctional beta-oxidation protein and related enzymes [Lipid transport and metabolism]. Length = 272 Score = 28.1 bits (62), Expect = 1.8 Identities = 21/85 (24%), Positives = 28/85 (32%), Gaps = 9/85 (10%) Query: 112 FSNVPERLVIPFNAIKGFYDPSVNFELEFDVHIEH---IEEKLEGGNTGKVLTSP-DNFD 167 F +P VIP A + NF+ +H E + L T K L D D Sbjct: 37 FQVLPTFAVIPATATLLMDNLVDNFDYAMLLHGEQYFELCTTLPSNGTLKTLAKVLDVLD 96 Query: 168 KNQ-----TNSVSQDSSKKKSTKKQ 187 K N + D + K Q Sbjct: 97 KGSGALVVGNFETYDETGKLIAYNQ 121 >gnl|CDD|146138 pfam03348, Serinc, Serine incorporator (Serinc). This is a family of eukaryotic membrane proteins which incorporate serine into membranes and facilitate the synthesis of the serine-derived lipids phosphatidylserine and sphingolipid. Members of this family contain 11 transmembrane domains and form intracellular complexes with key enzymes involved in serine and sphingolipid biosynthesis. Length = 426 Score = 27.2 bits (61), Expect = 3.4 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 8/40 (20%) Query: 63 FYITFATNARGVRISQNLRKNYPEKMTIVIQNQFWDLKVL 102 F++ A GV+ S++ R IQN FW K+L Sbjct: 85 FFLILALLMIGVKSSKDPRA--------AIQNGFWFFKIL 116 >gnl|CDD|32800 COG2981, CysZ, Uncharacterized protein involved in cysteine biosynthesis [Amino acid transport and metabolism]. Length = 250 Score = 26.4 bits (58), Expect = 5.3 Identities = 10/29 (34%), Positives = 12/29 (41%), Gaps = 3/29 (10%) Query: 2 VSLWNFFSSRWQWF-FIIKWIDTLMNYDH 29 + LW W F + WIDTLM Sbjct: 36 ILLW--GGLFWLLFSQALPWIDTLMPGIP 62 >gnl|CDD|32922 COG3108, COG3108, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 185 Score = 26.0 bits (57), Expect = 7.3 Identities = 13/64 (20%), Positives = 24/64 (37%), Gaps = 14/64 (21%) Query: 75 RISQNLRKNYPEKMTIVIQNQFWDLKVLDNHFEVGLSFSNVPERLVIPFNAIKGFYDPSV 134 R+ ++ R+N +M + + + LK L+ H P G+ P+ Sbjct: 71 RLLRDWRQNEVVRMDPRLFDLVYQLKTLEGHRR--------------PVQVTSGYRSPAT 116 Query: 135 NFEL 138 N L Sbjct: 117 NRML 120 >gnl|CDD|143839 pfam00054, Laminin_G_1, Laminin G domain. Length = 131 Score = 25.7 bits (57), Expect = 7.9 Identities = 9/52 (17%), Positives = 21/52 (40%) Query: 146 HIEEKLEGGNTGKVLTSPDNFDKNQTNSVSQDSSKKKSTKKQNKNKMASVIS 197 +E + G+ V+ S D + + +SV + + + T + + S Sbjct: 30 RLEVSYDLGSGPAVVRSGDKLNDGKWHSVELERNGRSGTLSVDGEARVTGES 81 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.135 0.402 Gapped Lambda K H 0.267 0.0674 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,500,288 Number of extensions: 126736 Number of successful extensions: 288 Number of sequences better than 10.0: 1 Number of HSP's gapped: 284 Number of HSP's successfully gapped: 14 Length of query: 204 Length of database: 6,263,737 Length adjustment: 89 Effective length of query: 115 Effective length of database: 4,340,536 Effective search space: 499161640 Effective search space used: 499161640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.1 bits)