BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780955|ref|YP_003065368.1| hypothetical protein CLIBASIA_04270 [Candidatus Liberibacter asiaticus str. psy62] (204 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780955|ref|YP_003065368.1| hypothetical protein CLIBASIA_04270 [Candidatus Liberibacter asiaticus str. psy62] Length = 204 Score = 419 bits (1076), Expect = e-119, Method: Compositional matrix adjust. Identities = 204/204 (100%), Positives = 204/204 (100%) Query: 1 MVSLWNFFSSRWQWFFIIKWIDTLMNYDHIRYDILAKEALRGLVKVVLSEVASIGSLPGE 60 MVSLWNFFSSRWQWFFIIKWIDTLMNYDHIRYDILAKEALRGLVKVVLSEVASIGSLPGE Sbjct: 1 MVSLWNFFSSRWQWFFIIKWIDTLMNYDHIRYDILAKEALRGLVKVVLSEVASIGSLPGE 60 Query: 61 HHFYITFATNARGVRISQNLRKNYPEKMTIVIQNQFWDLKVLDNHFEVGLSFSNVPERLV 120 HHFYITFATNARGVRISQNLRKNYPEKMTIVIQNQFWDLKVLDNHFEVGLSFSNVPERLV Sbjct: 61 HHFYITFATNARGVRISQNLRKNYPEKMTIVIQNQFWDLKVLDNHFEVGLSFSNVPERLV 120 Query: 121 IPFNAIKGFYDPSVNFELEFDVHIEHIEEKLEGGNTGKVLTSPDNFDKNQTNSVSQDSSK 180 IPFNAIKGFYDPSVNFELEFDVHIEHIEEKLEGGNTGKVLTSPDNFDKNQTNSVSQDSSK Sbjct: 121 IPFNAIKGFYDPSVNFELEFDVHIEHIEEKLEGGNTGKVLTSPDNFDKNQTNSVSQDSSK 180 Query: 181 KKSTKKQNKNKMASVISLDNFRKK 204 KKSTKKQNKNKMASVISLDNFRKK Sbjct: 181 KKSTKKQNKNKMASVISLDNFRKK 204 >gi|254780887|ref|YP_003065300.1| hypothetical protein CLIBASIA_03920 [Candidatus Liberibacter asiaticus str. psy62] Length = 86 Score = 23.1 bits (48), Expect = 3.5, Method: Compositional matrix adjust. Identities = 11/33 (33%), Positives = 18/33 (54%) Query: 106 FEVGLSFSNVPERLVIPFNAIKGFYDPSVNFEL 138 FE+GL N P++ + P + +V+FEL Sbjct: 21 FEMGLRHKNHPKKALKPSCNLSTIIPQTVSFEL 53 >gi|254780350|ref|YP_003064763.1| hypothetical protein CLIBASIA_01175 [Candidatus Liberibacter asiaticus str. psy62] Length = 431 Score = 22.3 bits (46), Expect = 5.9, Method: Compositional matrix adjust. Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 5/37 (13%) Query: 109 GLSFSNVPERLVIPFNAIKGFYDPSVNFELEFDVHIE 145 +S + ERL+I G DPS + FD ++E Sbjct: 108 SVSVQRLRERLII-----SGDLDPSKGLSVAFDAYVE 139 >gi|254781101|ref|YP_003065514.1| UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate/D-alanyl-D-alanyl ligase [Candidatus Liberibacter asiaticus str. psy62] Length = 472 Score = 21.6 bits (44), Expect = 9.4, Method: Compositional matrix adjust. Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Query: 13 QWFFIIKWIDTLMNYDHIRYDILAKEALRGLVKVVLSEVASIGSL 57 + FF IK +YD + + A + GLV V VASIGSL Sbjct: 41 EAFFAIKG----PHYDGHDFILHAVQKGAGLVVVNTDMVASIGSL 81 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.135 0.402 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 139,683 Number of Sequences: 1233 Number of extensions: 5827 Number of successful extensions: 16 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 12 Number of HSP's gapped (non-prelim): 8 length of query: 204 length of database: 328,796 effective HSP length: 70 effective length of query: 134 effective length of database: 242,486 effective search space: 32493124 effective search space used: 32493124 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 36 (18.5 bits)