BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780956|ref|YP_003065369.1| thymidylate synthase [Candidatus Liberibacter asiaticus str. psy62] (264 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780956|ref|YP_003065369.1| thymidylate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 264 Score = 548 bits (1412), Expect = e-158, Method: Compositional matrix adjust. Identities = 264/264 (100%), Positives = 264/264 (100%) Query: 1 MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60 MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL Sbjct: 1 MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL 60 Query: 61 WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120 WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR Sbjct: 61 WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR 120 Query: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS Sbjct: 121 ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS 180 Query: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL Sbjct: 181 YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL 240 Query: 241 SFRYEDFTLRSYEPHAAILAKVSV 264 SFRYEDFTLRSYEPHAAILAKVSV Sbjct: 241 SFRYEDFTLRSYEPHAAILAKVSV 264 >gi|254780940|ref|YP_003065353.1| ribonuclease III [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Score = 26.6 bits (57), Expect = 0.42, Method: Compositional matrix adjust. Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 2/57 (3%) Query: 72 LHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDG--NVIDQISSIVQSLRADPYSR 126 R + EWA + P Y V +RS PD+D V+ +IS + + D R Sbjct: 153 FRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKR 209 >gi|254780306|ref|YP_003064719.1| DNA topoisomerase I [Candidatus Liberibacter asiaticus str. psy62] Length = 837 Score = 25.8 bits (55), Expect = 0.88, Method: Compositional matrix adjust. Identities = 10/28 (35%), Positives = 16/28 (57%) Query: 32 YQMRFDLSKGFPLLTTKKVHWKSVVHEL 59 Y DL + ++T K++WK V+HE Sbjct: 534 YDFTADLEEKLDEISTGKLNWKEVLHEF 561 >gi|254781112|ref|YP_003065525.1| putative amino acid-binding periplasmic ABC transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 274 Score = 25.4 bits (54), Expect = 0.94, Method: Compositional matrix adjust. Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 2/71 (2%) Query: 177 NIASYSLLT-MMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPN 235 +I S+ LT +A ++G F L +++++FEQ+ LQL S RT MI + Sbjct: 140 DIRSFKDLTDKTVAQILGTDLSRFAKELKSHLVFSHNFEQS-LQLLLSKRTDATMIPDIP 198 Query: 236 IVDLLSFRYED 246 + L R D Sbjct: 199 FFNFLERRPHD 209 >gi|254780395|ref|YP_003064808.1| organic solvent tolerance protein [Candidatus Liberibacter asiaticus str. psy62] Length = 762 Score = 22.7 bits (47), Expect = 6.3, Method: Compositional matrix adjust. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 201 HTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINP 234 HTL ++YNN+ E + + ++ + INP Sbjct: 283 HTLHAAYMYNNNVESGEERHQAMLASIAEFEINP 316 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.140 0.449 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 178,950 Number of Sequences: 1233 Number of extensions: 7533 Number of successful extensions: 17 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 13 Number of HSP's gapped (non-prelim): 5 length of query: 264 length of database: 328,796 effective HSP length: 72 effective length of query: 192 effective length of database: 240,020 effective search space: 46083840 effective search space used: 46083840 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 37 (18.9 bits)