HHsearch alignment for GI: 254780958 and conserved domain: KOG3090

>KOG3090 consensus.
Probab=99.94  E-value=1.4e-26  Score=196.13  Aligned_cols=245  Identities=24%  Similarity=0.330  Sum_probs=198.8

Q ss_pred             CHHHHHHHHHHHHHHHHHHHCCCHHHHHHHH-HHHHHCCCCCCCCCEECCCCCCEEEEEEEEEEEEEECCCCCCCCCCCE
Q ss_conf             3799999999999999742145388999998-753311355589836645753236872204899982672211476650
Q gi|254780958|r   51 GSVYIILLLIGSFCAFQSIYIVHPDERAVEL-RFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG  129 (355)
Q Consensus        51 ~~i~ii~~v~~~~~~~sg~~~V~~ge~gVv~-rfGk~~~~v~~pGlh~~~ppi~~v~~v~v~~~~~~~~~~~~~~~~~~~  129 (355)
T Consensus        20 ~l~~~~~~G~~~y~v~~sl~nVdgGHRAI~fnRi~Gik~~iy~EGtHf~iPwfe~pIiYDvRarP~~i~S~tG-------   92 (290)
T KOG3090          20 GLKLLLIGGLGAYGVTQSLYNVDGGHRAIVFNRIGGIKDDIYPEGTHFRIPWFERPIIYDVRARPRLISSPTG-------   92 (290)
T ss_pred             HHHHHHHHCHHHHEECCEEEEECCCCEEEEEECCCCCHHCCCCCCCEEEEECCCCCEEEEECCCCCCCCCCCC-------
T ss_conf             8889987035554001135740487257997501351110056875586002236345552258410358888-------


Q ss_pred             EEEECCCEEEEEEEEEEEEEC-CHHHHHHH---HCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             366068418876344342215-88785320---12989999888777677775301000001554678877799998886
Q gi|254780958|r  130 LILTGDQNIVGLHFSVLYVVT-DPRLYLFN---LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKT  205 (355)
Q Consensus       130 ~mLT~D~n~V~v~~~V~yrI~-Dp~~~~~~---v~~~~~~l~~~~esalR~vvg~~~~d~ilt~~R~~i~~~v~~~lq~~  205 (355)
T Consensus        93 ---skDLQmVnI~lRVLsRP~~~~Lp~iyrtLG~~y~ERVLPSIinEvLKaVVAqfNASqLIT-QRe~VSrliRk~L~eR  168 (290)
T KOG3090          93 ---SKDLQMVNIGLRVLSRPMADQLPEIYRTLGQNYDERVLPSIINEVLKAVVAQFNASQLIT-QREQVSRLIRKILTER  168 (290)
T ss_pred             ---CCCEEEEEEEEEEECCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHH
T ss_conf             ---764167875358844777556589999864484211317899999999999844898878-8999999999999987


Q ss_pred             HCCCCCEEEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             31234617987534301562578999999998878899999999999999877688999999997778999999997232
Q gi|254780958|r  206 MDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG  285 (355)
Q Consensus       206 l~~y~~GI~V~~V~i~~v~~P~~v~~A~~~v~~A~qe~er~i~eAe~~a~~i~~~A~geA~~i~~~Aeay~~~~i~~A~g  285 (355)
T Consensus       169 A~~F--ni~LDDVSiT~l~F~~efTaAiEaKQvA~QeAqRA-------------------~F~VekA~qek~~~ivrAqG  227 (290)
T KOG3090         169 AADF--NIALDDVSITELTFGKEFTAAIEAKQVAAQEAQRA-------------------KFIVEKAEQEKQSAIVRAQG  227 (290)
T ss_pred             HHCC--CEEEECCEEEEEECCHHHHHHHHHHHHHHHHHHHH-------------------HHHHHHHHHHHHHHHHHHCC
T ss_conf             7515--66750214545522778888887888889887642-------------------52267777765423532216


Q ss_pred             HHHHHHHHHHHHHHCHHHHHHHHHHHHHHHH---HCC-CCEEEEECC
Q ss_conf             2999999999998699999999999999998---379-959999679
Q gi|254780958|r  286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGI---LKK-AKKVIIDKK  328 (355)
Q Consensus       286 ea~rf~~i~~~Y~~ap~vt~~rlylet~~~v---l~~-~~k~ii~~~  328 (355)
T Consensus       228 EaksAqliGeAi~nn~~fi~Lr-ki~aAr~IA~tia~S~NkvyL~~~  273 (290)
T KOG3090         228 EAKSAQLIGEAIKNNPAFITLR-KIEAAREIAQTIASSANKVYLSSD  273 (290)
T ss_pred             CHHHHHHHHHHHHCCCCCEEEH-HHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             2478899999984795515413-678899999998607876896365