HHsearch alignment for GI: 254780958 and conserved domain: cd02106

>cd02106 Band_7 The band 7 domain of flotillin (reggie) like proteins. This group contains proteins similar to stomatin, prohibitin, flotillin, HlfK/C and podicin. Many of these band 7 domain-containing proteins are lipid raft-associated. Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Microdomains formed from flotillin proteins may in addition be dynamic units with their own regulatory functions. Flotillins have been implicated in signal transduction, vesicle trafficking, cytoskeleton rearrangement and are known to interact with a variety of proteins. Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons and participates in trafficking of Glut1 glucose transporters. Prohibitin may act as a chaperone for the stabilization of mitochondrial proteins. Prokaryotic HflK/C plays a role i
Probab=99.64  E-value=2.4e-15  Score=121.44  Aligned_cols=107  Identities=36%  Similarity=0.597  Sum_probs=98.1

Q ss_pred             CCEEEEECCCEEEEEEEEEEEEECCHHHHHHHHCCHH--HHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             6503660684188763443422158878532012989--99988877767777530100000155467887779999888
Q gi|254780958|r  127 NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG--ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQK  204 (355)
Q Consensus       127 ~~~~mLT~D~n~V~v~~~V~yrI~Dp~~~~~~v~~~~--~~l~~~~esalR~vvg~~~~d~ilt~~R~~i~~~v~~~lq~  204 (355)
T Consensus        12 ~~~~~~T~d~~~i~v~~~v~~rI~d~~~~~~~~~~~~~~~~i~~~~~~~lr~~i~~~~~~~~~-~~r~~i~~~i~~~l~~   90 (121)
T cd02106          12 PPQEVLTKDNVPVRVDAVVQYRVVDPVKALYNVRDPEDEEALRQLAQSALRSVIGKMTLDELL-EDRDEIAAEVREALQE   90 (121)
T ss_pred             CCCEEECCCCCEEEEEEEEEEEEEEHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCHHHHH-HHHHHHHHHHHHHHHH
T ss_conf             986758589989999999999993679864541792099999999999999997115377652-0166689999999988


Q ss_pred             HHCCCCCEEEEEEEEEECCCHHHHHHHHHHHH
Q ss_conf             63123461798753430156257899999999
Q gi|254780958|r  205 TMDYYKSGILINTISIEDASPPREVADAFDEV  236 (355)
Q Consensus       205 ~l~~y~~GI~V~~V~i~~v~~P~~v~~A~~~v  236 (355)
T Consensus        91 ~~~~~--Gi~v~~v~i~~i~~p~~~~~ai~~~  120 (121)
T cd02106          91 DLDKY--GIEVVDVRIKDIDPPEEVQEAMEDR  120 (121)
T ss_pred             HHHHH--CCEEEEEEEEECCCCHHHHHHHHHH
T ss_conf             78751--9589999998638999999999700