HHsearch alignment for GI: 254780958 and conserved domain: cd03401

>cd03401 Band_7_prohibitin Band_7_prohibitin. A subgroup of the band 7 domain of flotillin (reggie) like proteins. This subgroup group includes proteins similar to prohibitin (a lipid raft-associated integral membrane protein). Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. These microdomains in addition to being stable scaffolds may also be also dynamic units with their own regulatory functions. Prohibitin is a mitochondrial inner-membrane protein which may act as a chaperone for the stabilization of mitochondrial proteins. Human prohibitin forms a heter-oligomeric complex with Bap-37 (prohibitin 2, a band 7 domain carrying homologue). This complex may protect non-assembled membrane proteins against proteolysis by the m-AAA protease. Prohibitin and Bap-37 yeast homologues have been implicated in yeast longevity and, in the maintenance of mitochondrial morphology.
Probab=100.00  E-value=8.5e-36  Score=257.49  Aligned_cols=188  Identities=23%  Similarity=0.345  Sum_probs=154.9

Q ss_pred             HHHCCCHHHHHHHHHHHHHC-CCCCCCCCEECCCCCCEEEEEEEEEEEEEECCCCCCCCCCCEEEEECCCEEEEEEEEEE
Q ss_conf             42145388999998753311-35558983664575323687220489998267221147665036606841887634434
Q gi|254780958|r   68 SIYIVHPDERAVELRFGKPK-NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVL  146 (355)
Q Consensus        68 g~~~V~~ge~gVv~rfGk~~-~~v~~pGlh~~~ppi~~v~~v~v~~~~~~~~~~~~~~~~~~~~mLT~D~n~V~v~~~V~  146 (355)
T Consensus         1 S~~~V~~ge~gVv~~fg~~v~~~~~~pGlhfkiPfi~~v~~~d~R~q~~~~~~~----------~~tkD~~~v~i~~~v~   70 (196)
T cd03401           1 SLYNVDGGHRAVLFNRGGGVKDLVYGEGLHFRIPWFQKPIIFDVRARPRNIEST----------TGSKDLQMVNITLRVL   70 (196)
T ss_pred             CEEEECCCEEEEEEECCCCCCCCEECCEEEEEECCEEEEEEEECCCEEEECCCC----------CCCCCCCEEEEEEEEE
T ss_conf             969988975999998786444865099049984614899995213141201442----------2465665899999999


Q ss_pred             EEECCHHHH--HHH-H-CC-HHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEE
Q ss_conf             221588785--320-1-29-899998887776777753010000015546788777999988863123461798753430
Q gi|254780958|r  147 YVVTDPRLY--LFN-L-EN-PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE  221 (355)
Q Consensus       147 yrI~Dp~~~--~~~-v-~~-~~~~l~~~~esalR~vvg~~~~d~ilt~~R~~i~~~v~~~lq~~l~~y~~GI~V~~V~i~  221 (355)
T Consensus        71 y~v-~~~~~~~~~~~~g~~~~~~~l~~~~~~~lR~v~g~~~~~ei~s-~R~~i~~~i~~~l~~~~~~~--GI~v~~V~i~  146 (196)
T cd03401          71 FRP-DASQLPRIYQNLGEDYDERVLPSIINEVLKAVVAQFTAEELIT-QREEVSALIREALTERAKDF--GIILDDVSIT  146 (196)
T ss_pred             EEE-CHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHH-HHHHHHHHHHHHHHHHHHHC--CEEEEEEEEE
T ss_conf             960-6778789998634013889999999998898845755999986-59999999999999888728--9499999998


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             1562578999999998878899999999999999877688999999997778999999997232299
Q gi|254780958|r  222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD  288 (355)
Q Consensus       222 ~v~~P~~v~~A~~~v~~A~qe~er~i~eAe~~a~~i~~~A~geA~~i~~~Aeay~~~~i~~A~gea~  288 (355)
T Consensus       147 ~i~~p~~~~~Aie~k~~a~q~a~~a~~~~~--------~-----------Ae~ea~~~i~~Aeg~Ae  194 (196)
T cd03401         147 HLTFSKEFTKAVEAKQVAQQEAERAKFVVE--------K-----------AEQEKQAAVIRAEGEAE  194 (196)
T ss_pred             ECCCCHHHHHHHHHHHHHHHHHHHHHHHHH--------H-----------HHHHHHHHHHHCCCHHH
T ss_conf             548998999999999999999999999999--------9-----------99999989986151530