HHsearch alignment for GI: 254780958 and conserved domain: cd03406

>cd03406 Band_7_3 A subgroup of the band 7 domain of flotillin (reggie) like proteins. This subgroup contains proteins similar to stomatin, prohibitin, flotillin, HlfK/C and podicin. Many of these band 7 domain-containing proteins are lipid raft-associated. Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Microdomains formed from flotillin proteins may in addition be dynamic units with their own regulatory functions. Flotillins have been implicated in signal transduction, vesicle trafficking, cytoskeleton rearrangement and are known to interact with a variety of proteins. Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons and participates in trafficking of Glut1 glucose transporters. Prohibitin may act as a chaperone for the stabilization of mitochondrial proteins. Prokaryotic H
Probab=99.83  E-value=8.1e-19  Score=144.51  Aligned_cols=190  Identities=14%  Similarity=0.202  Sum_probs=140.6

Q ss_pred             HHHHHHCCCHHHHHHHHHHHHHCCCCCCCCCEECCCCCCEEEEEEEEEEEEEECCCCCCCCCCCEEEEECCCEEEEEEEE
Q ss_conf             99742145388999998753311355589836645753236872204899982672211476650366068418876344
Q gi|254780958|r   65 AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFS  144 (355)
Q Consensus        65 ~~sg~~~V~~ge~gVv~rfGk~~~~v~~pGlh~~~ppi~~v~~v~v~~~~~~~~~~~~~~~~~~~~mLT~D~n~V~v~~~  144 (355)
T Consensus         1 ~~~~~H~v~EGhvgvYyRgGaLl~~~s~PG~H~~iPfiT~~~~vQ~TlQTD~v--~nVpCGTsgGvmi~Fd~I-------   71 (280)
T cd03406           1 LSSALHKIEEGHVGVYYRGGALLTSTSGPGFHLMLPFITTYKSVQVTLQTDEV--KNVPCGTSGGVMIYFDRI-------   71 (280)
T ss_pred             CCHHHCCCCCCCEEEEECCCEEECCCCCCCEEEEEEEEEEEEEEEEEEECCCC--CCCCCCCCCCEEEEEEEE-------
T ss_conf             95021015777269997374200467999717998765456788987301100--456777778737987436-------


Q ss_pred             EEEEECC--HHHHHHHH-----CCH-HHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             3422158--87853201-----298-999988877767777530100000155467887779999888631234617987
Q gi|254780958|r  145 VLYVVTD--PRLYLFNL-----ENP-GETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILIN  216 (355)
Q Consensus       145 V~yrI~D--p~~~~~~v-----~~~-~~~l~~~~esalR~vvg~~~~d~ilt~~R~~i~~~v~~~lq~~l~~y~~GI~V~  216 (355)
T Consensus        72 ---eVvN~L~~~~Vydiv~n~t~dYDk~lI~dkihheinqfCS~htlqEVyid~FDqIDE~Lk~aLQ~dl~~~apGl~I~  148 (280)
T cd03406          72 ---EVVNFLIPDSVYDIVKNYTADYDKTLIFNKIHHELNQFCSVHTLQEVYIDLFDQIDENLKLALQKDLTRMAPGLEIQ  148 (280)
T ss_pred             ---EEEECCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             ---76502358899999985266654201344678899888620218899887777664899999987654027773699


Q ss_pred             EEEEECCCHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             5343015625789999999988-------7889999999999999987768899999
Q gi|254780958|r  217 TISIEDASPPREVADAFDEVQR-------AEQDEDRFVEESNKYSNRVLGSARGEAS  266 (355)
Q Consensus       217 ~V~i~~v~~P~~v~~A~~~v~~-------A~qe~er~i~eAe~~a~~i~~~A~geA~  266 (355)
T Consensus       149 aVRvtKPkiPe~Ir~NyE~me~EKTkllia~q~QkvvEKeaETerk~AviEAEk~a~  205 (280)
T cd03406         149 AVRVTKPKIPEAIRRNYELMEAEKTKLLIAIQKQKVVEKEAETERKKAVIEAEKVAQ  205 (280)
T ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999758998199999999998678889999999999998877788899998988888