HHsearch alignment for GI: 254780958 and conserved domain: cd03408

>cd03408 Band_7_5 A subgroup of the band 7 domain of flotillin (reggie) like proteins. This subgroup contains proteins similar to stomatin, prohibitin, flotillin, HlfK/C and podicin. Many of these band 7 domain-containing proteins are lipid raft-associated. Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Microdomains formed from flotillin proteins may in addition be dynamic units with their own regulatory functions. Flotillins have been implicated in signal transduction, vesicle trafficking, cytoskeleton rearrangement and are known to interact with a variety of proteins. Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons and participates in trafficking of Glut1 glucose transporters. Prohibitin may act as a chaperone for the stabilization of mitochondrial proteins. Prokaryotic H
Probab=99.11  E-value=2.6e-10  Score=87.87  Aligned_cols=161  Identities=21%  Similarity=0.265  Sum_probs=110.7

Q ss_pred             HHHCCCHHHHHHHHHHHHHCCCCCCCCCEEC----CCCCC---------------EEEEEEEEEEE-EEECCCCCCCCCC
Q ss_conf             4214538899999875331135558983664----57532---------------36872204899-9826722114766
Q gi|254780958|r   68 SIYIVHPDERAVELRFGKPKNDVFLPGLHMM----FWPID---------------QVEIVKVIERQ-QKIGGRSASVGSN  127 (355)
Q Consensus        68 g~~~V~~ge~gVv~rfGk~~~~v~~pGlh~~----~ppi~---------------~v~~v~v~~~~-~~~~~~~~~~~~~  127 (355)
T Consensus        15 s~LiV~e~Q~avf~~~Gki~d-v~~pg~~~l~t~n~P~l~~l~~~~~g~~spf~~evyfvn~~~~~~~kwGt~~pi~~~d   93 (207)
T cd03408          15 SQLIVREGQAAVFVNEGKVAD-VFAPGGYYLTTNNLPVLAFLLSGDKGFSSPFKGEVYFFNTRVFTDLLWGTPAPVFGRD   93 (207)
T ss_pred             CEEEECCCCEEEEEECCEEEE-EECCCCCEEECCCCCHHHHHCCCCCCCCCCEECCCCCEEEEEEEEECCCCCCCCCCCC
T ss_conf             899987996899998999989-9779972463599730522226464567764235354677899850456779866668


Q ss_pred             CEEEEECCCEEEEEEEEEEEEECCHHHHHHHHC---------CHHHHHHHHHHHHHHHHHHCCCCCCCC-CCCHHHHHHH
Q ss_conf             503660684188763443422158878532012---------989999888777677775301000001-5546788777
Q gi|254780958|r  128 SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE---------NPGETLKQVSESAMREVVGRRFAVDIF-RSQRQQIALE  197 (355)
Q Consensus       128 ~~~mLT~D~n~V~v~~~V~yrI~Dp~~~~~~v~---------~~~~~l~~~~esalR~vvg~~~~d~il-t~~R~~i~~~  197 (355)
T Consensus        94 ~~~----~~v~lra~G~ys~kI~Dp~~F~~~ivg~~~~~~~~~i~~~l~~~i~~~l~~~l~~~~~~~~~~~~~~~els~~  169 (207)
T cd03408          94 SEF----GGVPLRAFGTYSLKVTDPVLFVTNIVGTRGLFTVEDLEKSLRALIVAALSSALSESGLAVMLLAANRDELSKA  169 (207)
T ss_pred             CCC----CEEEEEEEEEEEEEECCHHHHHHHHCCCCCCEEHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH
T ss_conf             875----5177999999999984899999983688653617999999999999999999986285252678999999999


Q ss_pred             HHHHHHHHHCCCCCEEEEEEEEEECCCHHHHHHHHHHH
Q ss_conf             99998886312346179875343015625789999999
Q gi|254780958|r  198 VRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDE  235 (355)
Q Consensus       198 v~~~lq~~l~~y~~GI~V~~V~i~~v~~P~~v~~A~~~  235 (355)
T Consensus       170 i~~~l~~~~~~~--Glel~~f~I~sI~~pee~~~~i~k  205 (207)
T cd03408         170 VREALAPWFASF--GLELVSVYIESISYPDEVQKLIDK  205 (207)
T ss_pred             HHHHHHHHHHHC--CCEEEEEEEEECCCCHHHHHHHHC
T ss_conf             999999999965--918888889755799899998744