BLAST/PSIBLAST alignment of GI: 254780958 and GI: 190892525 at iteration 1
>gi|190892525|ref|YP_001979067.1| hydrolase serine protease transmembrane subunit K protein [Rhizobium etli CIAT 652] Length = 361
>gi|190697804|gb|ACE91889.1| hydrolase serine protease transmembrane subunit K protein [Rhizobium etli CIAT 652] Length = 361
>gi|327189902|gb|EGE57033.1| hydrolase serine protease transmembrane subunit K protein [Rhizobium etli CNPAF512] Length = 361
 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 182/329 (55%), Positives = 241/329 (73%), Gaps = 4/329 (1%)

Query: 12  PTRLSGSNGNGDGLPPFDVEAIIRYIKDKF-DLIPFFKSYGSVYIILLLIGSFCAFQSIY 70
           P R  GS G G    P D+E IIR  +D+  +++P   + G   I+L ++  F   Q +Y
Sbjct: 27  PNRPRGSGGKGG---PPDLEDIIRRGQDQLRNIVPGGFNGGVTVIVLAIVAVFWLIQCVY 83

Query: 71  IVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGL 130
            V PDER VELRFGKP+  V +PGLH  FWP+D VEIVKV E+   +GG   S  +  GL
Sbjct: 84  TVQPDERGVELRFGKPRETVSMPGLHFHFWPMDTVEIVKVTEQLLNVGGTQGSSNTAGGL 143

Query: 131 ILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQ 190
           +L+GDQNI+ + F+VLY ++D R YLFN+E+P +TL+QVSESAMREVVGRR A D FR +
Sbjct: 144 MLSGDQNILNVRFNVLYQISDARAYLFNVESPAQTLQQVSESAMREVVGRRPAQDAFRDR 203

Query: 191 RQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEES 250
           R +IA EV N+IQ TM  Y SGI +N ++IED +PPREVADAF EVQRA+QD+ R VEE+
Sbjct: 204 RLEIASEVANIIQDTMSRYNSGISVNKVTIEDVAPPREVADAFQEVQRADQDKQRLVEEA 263

Query: 251 NKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYL 310
           N+Y+N+ LG ARG+ + IRE + AYKDR+++EA+GEA RF++I  +Y  AP + RKR++L
Sbjct: 264 NQYANQKLGQARGDGARIREDAAAYKDRVVKEAEGEAQRFIAIDEEYSKAPDVTRKRLFL 323

Query: 311 ETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           ETME +LK +KKVII++KQ V+PYLPLNE
Sbjct: 324 ETMEQVLKNSKKVIIEEKQGVVPYLPLNE 352