BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780958|ref|YP_003065371.1| HflK protein [Candidatus
Liberibacter asiaticus str. psy62]
         (355 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780958|ref|YP_003065371.1| HflK protein [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040635|gb|ACT57431.1| HflK protein [Candidatus Liberibacter asiaticus str. psy62]
          Length = 355

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/355 (100%), Positives = 355/355 (100%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI 60
           MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI
Sbjct: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI 60

Query: 61  GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGR 120
           GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGR
Sbjct: 61  GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGR 120

Query: 121 SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGR 180
           SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGR
Sbjct: 121 SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGR 180

Query: 181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE 240
           RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE
Sbjct: 181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE 240

Query: 241 QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA 300
           QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA
Sbjct: 241 QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA 300

Query: 301 PTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTKREIRWYQS 355
           PTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTKREIRWYQS
Sbjct: 301 PTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTKREIRWYQS 355


>gi|315122500|ref|YP_004062989.1| HflK protein [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495902|gb|ADR52501.1| HflK protein [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 356

 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 252/340 (74%), Positives = 286/340 (84%), Gaps = 2/340 (0%)

Query: 10  WRPTRLSGSNGNGDGLPPFDVEAII-RYIKDKFDLIPFFKSYGSVYIILLLIGSFCAFQS 68
           W P     ++ N +G PPFD +  I R I+     IP F +Y S+YI  L+  SFC FQS
Sbjct: 12  WGPRSTEFNHSNNNGSPPFDFDNFIARLIRKILGFIPSFYTYSSLYISALVAFSFCLFQS 71

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           IYIVHPDER VELRFGK KN++ LPGLH+MFWPIDQVEIVKVIERQ+ IG R  S  SN+
Sbjct: 72  IYIVHPDERGVELRFGKIKNEISLPGLHVMFWPIDQVEIVKVIERQENIG-RPVSSSSNN 130

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GLILTGDQNIV L FS+LYVV+DPR YLFNLENP + L+QV+ESAMREVVG R AVDIFR
Sbjct: 131 GLILTGDQNIVSLQFSILYVVSDPRSYLFNLENPRDILRQVAESAMREVVGGRIAVDIFR 190

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
           S+RQQIALEVR LIQKTMD YKSGILINTISIED SPPREVA AFDEVQRAEQDE+RF+E
Sbjct: 191 SKRQQIALEVRELIQKTMDSYKSGILINTISIEDVSPPREVASAFDEVQRAEQDEERFIE 250

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESNKY+N++LGSARGEAS IRESSIAYKDRIIQEA+GEADRFLS+YGQYVNAP LLR RI
Sbjct: 251 ESNKYTNQILGSARGEASRIRESSIAYKDRIIQEAKGEADRFLSVYGQYVNAPALLRSRI 310

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTKR 348
           YLETMEGILK +KKV+ID+KQ+V+PYLPLNE FS +Q ++
Sbjct: 311 YLETMEGILKGSKKVVIDQKQTVIPYLPLNEMFSPVQKQQ 350


>gi|15965877|ref|NP_386230.1| putative membrane bound protease protein [Sinorhizobium meliloti
           1021]
 gi|307309635|ref|ZP_07589288.1| HflK protein [Sinorhizobium meliloti BL225C]
 gi|307321774|ref|ZP_07601162.1| HflK protein [Sinorhizobium meliloti AK83]
 gi|15075146|emb|CAC46703.1| Putative membrane bound protease [Sinorhizobium meliloti 1021]
 gi|306892596|gb|EFN23394.1| HflK protein [Sinorhizobium meliloti AK83]
 gi|306899970|gb|EFN30592.1| HflK protein [Sinorhizobium meliloti BL225C]
          Length = 362

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 195/321 (60%), Positives = 253/321 (78%), Gaps = 5/321 (1%)

Query: 29  DVEAIIRYIKDKF-DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
           D+E IIR  +D+  +++P   + G   I+ LLI  F    SIY V PDER VE+RFGKPK
Sbjct: 40  DLEEIIRRGQDQLKNVVPGGFNGGIFVIVGLLILGFVLLNSIYTVQPDERGVEMRFGKPK 99

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
            ++ +PGLH  FWP++ VEIVKV E+QQ IGGR+    SN+GL+L+GDQNIV + FSVL+
Sbjct: 100 EEISMPGLHYHFWPLETVEIVKVTEQQQNIGGRTGQ--SNAGLMLSGDQNIVNVQFSVLF 157

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            VTDP+ YLFN+ENP +TL+QV+ESAMREVVGRR A DIFR  RQ IA +V+N IQ TMD
Sbjct: 158 SVTDPKAYLFNVENPADTLQQVAESAMREVVGRRPAQDIFRDNRQAIAADVKNTIQATMD 217

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y +GI +NT++IEDA+PPREVADAFDEVQRAEQDEDRFVEE+N+Y+N+VLG ARG+ + 
Sbjct: 218 SYGAGISVNTVAIEDAAPPREVADAFDEVQRAEQDEDRFVEEANQYANQVLGRARGQGAQ 277

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK 327
           IRE + AYKDR+++EAQGEA RF+S+Y +Y  AP + RKR+Y+ET++G+L K+KKVI+D+
Sbjct: 278 IREEAAAYKDRVVKEAQGEAQRFISVYDEYSKAPEVTRKRLYIETLQGVLGKSKKVILDE 337

Query: 328 K--QSVMPYLPLNEAFSRIQT 346
           K  Q V+PYLPLNE    +Q+
Sbjct: 338 KNGQGVLPYLPLNEIGRPVQS 358


>gi|150397219|ref|YP_001327686.1| HflK protein [Sinorhizobium medicae WSM419]
 gi|150028734|gb|ABR60851.1| HflK protein [Sinorhizobium medicae WSM419]
          Length = 362

 Score =  404 bits (1039), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 195/321 (60%), Positives = 251/321 (78%), Gaps = 5/321 (1%)

Query: 29  DVEAIIRYIKDKF-DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
           D+E IIR  +D+   ++P   + G   I+ LL+  F    SIY V PDER VE+RFGKPK
Sbjct: 40  DLEEIIRRGQDQLKSVVPGGFNGGIFVIVGLLVLGFILLNSIYTVQPDERGVEMRFGKPK 99

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
            ++ +PGLH  FWP++ VEIVKV E+QQ IGGR+    +NSGL+L+GDQNIV + FSVL+
Sbjct: 100 EEISMPGLHYHFWPLETVEIVKVTEQQQNIGGRTGQ--TNSGLMLSGDQNIVNVQFSVLF 157

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            VTDP+ YLFN+ENP +TL+QV+ESAMREVVGRR A DIFR  RQ IA +V+N IQ TMD
Sbjct: 158 SVTDPKAYLFNVENPADTLQQVAESAMREVVGRRPAQDIFRDNRQAIAADVKNTIQATMD 217

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y +GI +NT++IEDA+PPREVADAFDEVQRAEQDEDRFVEE+N+Y+N+VLG ARG+ + 
Sbjct: 218 SYGAGISVNTVAIEDAAPPREVADAFDEVQRAEQDEDRFVEEANQYANQVLGKARGQGAQ 277

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK 327
           IRE + AYKDR+++EAQGEA RF+S+Y +Y  AP + RKR+YLETM+G+L K+KK I+D+
Sbjct: 278 IREEAAAYKDRVVKEAQGEAQRFISVYDEYSKAPEVTRKRLYLETMQGVLGKSKKFILDE 337

Query: 328 K--QSVMPYLPLNEAFSRIQT 346
           K  Q V+PYLPLNE    +Q+
Sbjct: 338 KNGQGVLPYLPLNEIGRPVQS 358


>gi|222086377|ref|YP_002544911.1| hydrolase serine protease transmembrane subunit K protein
           [Agrobacterium radiobacter K84]
 gi|221723825|gb|ACM26981.1| hydrolase serine protease transmembrane subunit K protein
           [Agrobacterium radiobacter K84]
          Length = 377

 Score =  398 bits (1022), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 191/312 (61%), Positives = 245/312 (78%), Gaps = 2/312 (0%)

Query: 29  DVEAIIRYIKDKFD-LIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
           D+E IIR  +D+   L+P   + G+  I+  +I  F   Q +Y V PDER VELRFGKP+
Sbjct: 46  DLEDIIRRGQDRLKGLVPGGFNGGAFLIVAAVIAVFWLIQCVYTVQPDERGVELRFGKPR 105

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
            +V +PGLH  FWP+D+VEI KV E+Q+ IGGRS S GSN+GL+LTGDQNIV + FSVLY
Sbjct: 106 AEVSMPGLHFHFWPMDRVEIAKVTEQQRNIGGRSGS-GSNAGLMLTGDQNIVNVQFSVLY 164

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            VT+P+ YLF +E+P ETL+QV+ESAMREVVGRR A DI+R  RQQ+A+EVRN+IQ TMD
Sbjct: 165 TVTNPQAYLFEVESPDETLQQVAESAMREVVGRRPAQDIYRDNRQQVAVEVRNIIQDTMD 224

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y +GI IN + IED SPPREVADAFDEVQRAEQ+ED+ V+E+N+Y+N+ LG ARG A+ 
Sbjct: 225 RYSAGISINAVPIEDVSPPREVADAFDEVQRAEQNEDQQVQEANQYANQKLGQARGGAAQ 284

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK 327
           IRE + AYKDR+++EAQGEA RF+SIY +YV AP + RKR++LETME ++  +  +IID 
Sbjct: 285 IREEAAAYKDRVVKEAQGEAQRFISIYDEYVKAPDVTRKRLFLETMESVIGNSNSIIIDD 344

Query: 328 KQSVMPYLPLNE 339
           KQSV+PYLPLN+
Sbjct: 345 KQSVLPYLPLND 356


>gi|325293413|ref|YP_004279277.1| hflK protein [Agrobacterium sp. H13-3]
 gi|325061266|gb|ADY64957.1| hflK protein [Agrobacterium sp. H13-3]
          Length = 373

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 190/312 (60%), Positives = 249/312 (79%), Gaps = 2/312 (0%)

Query: 29  DVEAIIRYIKDKF-DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
           D+E IIR  +D+F +++P   + G++ I+ L++  F   QSIY V PDER VELRFG+PK
Sbjct: 49  DLEEIIRRSQDRFKNVLPGGFNGGAIAIVALVVLVFLGIQSIYTVQPDERGVELRFGRPK 108

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
           +++ +PGLH   WPI+ VEIVKV E+QQ IG R++S  +N G++LTGDQNIV + FSVLY
Sbjct: 109 DEISMPGLHFHLWPIETVEIVKVTEQQQNIGSRASSSSAN-GVMLTGDQNIVNVQFSVLY 167

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            V+DP+ YLFN+++P ETL+QVSESAMRE+VGRR A DIFR  RQ IA +VR +IQ TMD
Sbjct: 168 TVSDPKSYLFNVDSPAETLQQVSESAMREIVGRRPAQDIFRDNRQAIAADVRTIIQSTMD 227

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y +GI IN ++IEDA+PPREVADAFDEVQRAEQDEDRFV+E+N+Y+N+ LG+ARG+A+ 
Sbjct: 228 GYGAGISINAVAIEDAAPPREVADAFDEVQRAEQDEDRFVQEANQYANQKLGAARGQAAQ 287

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK 327
           I E + AYK R++ EA+GEA RF+SIY QY  AP + R+R++LETME +LK + KVIID+
Sbjct: 288 IIEEANAYKSRVVNEAEGEAQRFISIYDQYRTAPDVTRQRMFLETMEQVLKGSNKVIIDE 347

Query: 328 KQSVMPYLPLNE 339
           KQ V+PYLPLNE
Sbjct: 348 KQGVVPYLPLNE 359


>gi|227822572|ref|YP_002826544.1| putative transmembrane serine protease [Sinorhizobium fredii
           NGR234]
 gi|227341573|gb|ACP25791.1| putative transmembrane serine protease [Sinorhizobium fredii
           NGR234]
          Length = 361

 Score =  394 bits (1013), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 192/314 (61%), Positives = 246/314 (78%), Gaps = 4/314 (1%)

Query: 29  DVEAIIRYIKDKF-DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
           D+E IIR  +D+  +++P   + G   I+ LLI  F    SIY V PDER VE+RFGKPK
Sbjct: 38  DLEEIIRRGQDQLKNVVPGGFNGGVFVIVGLLIVGFLLLNSIYTVQPDERGVEMRFGKPK 97

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
            ++ +PGLH  FWP++ VEIVKV E+Q  IG R  +  S++GL+LTGDQNIV + FSVL+
Sbjct: 98  EEISMPGLHYHFWPLETVEIVKVTEQQLNIGSRVGA-QSSAGLMLTGDQNIVNVQFSVLF 156

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            VTDP+ YLFN+ENP +TL+QV+ESAMREVVGRR A DIFR  RQ IA +V+N IQ TMD
Sbjct: 157 SVTDPKSYLFNVENPADTLQQVAESAMREVVGRRPAQDIFRDNRQAIAADVKNTIQATMD 216

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y +GI +NT++IEDA+PPREVADAFDEVQRAEQDEDRFVEE+N+Y+N+VLG ARG+ + 
Sbjct: 217 TYGAGISVNTVAIEDAAPPREVADAFDEVQRAEQDEDRFVEEANQYANQVLGKARGQGAQ 276

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK 327
           IRE + AYKDR+++EAQGEA RF+S+Y  Y  AP + R+R+YLETM+ +L K+KKVI+D+
Sbjct: 277 IREEAAAYKDRVVKEAQGEAQRFISVYDAYSKAPEVTRRRLYLETMQDVLGKSKKVILDE 336

Query: 328 K--QSVMPYLPLNE 339
           K  Q V+PYLPLNE
Sbjct: 337 KNGQGVLPYLPLNE 350


>gi|222149081|ref|YP_002550038.1| HFLK protein [Agrobacterium vitis S4]
 gi|221736066|gb|ACM37029.1| HFLK protein [Agrobacterium vitis S4]
          Length = 383

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 189/315 (60%), Positives = 247/315 (78%), Gaps = 3/315 (0%)

Query: 27  PFDVEAIIRYIKDKF-DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGK 85
           P D+E II+  +D+F +L+P     G   I++L +      Q++Y V PDER VE+RFGK
Sbjct: 57  PPDLEDIIKRGQDQFKNLVPGGLGGGMGLIVVLAVAGLWLTQAVYTVQPDERGVEMRFGK 116

Query: 86  PKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSV 145
           PK+++  PGLH   WP + VE VKV E+QQ IG + AS  S +GL+LTGDQNIV + FSV
Sbjct: 117 PKDEISAPGLHFHLWPFETVEKVKVTEQQQNIGAKVAS-NSTAGLMLTGDQNIVNVQFSV 175

Query: 146 LYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKT 205
           LY V+DP+ YLFNLE+P +TL+QV+ESAMREVVGRR A +IFR  RQ I+++VRN+IQ T
Sbjct: 176 LYTVSDPKAYLFNLESPPQTLQQVAESAMREVVGRRPAQEIFRDARQSISVDVRNIIQGT 235

Query: 206 MDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEA 265
           MD Y SGI IN+++IEDA+PPREVADAFDEVQRAEQDEDRFVEE+N+YSN+ LG ARG++
Sbjct: 236 MDNYGSGISINSVAIEDAAPPREVADAFDEVQRAEQDEDRFVEEANQYSNQKLGQARGQS 295

Query: 266 SHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII 325
           + +RE + AYKDR+++EA+GEA RF+SIY QY  AP + R R+Y+ETME +LKK+ KVI+
Sbjct: 296 AQMREEAAAYKDRVVKEAEGEAQRFISIYDQYTKAPDVTRTRLYIETMEQVLKKSNKVIV 355

Query: 326 DKK-QSVMPYLPLNE 339
           D++ Q V+PYLPLNE
Sbjct: 356 DEQGQGVVPYLPLNE 370


>gi|159185025|ref|NP_355013.2| HFLK protein [Agrobacterium tumefaciens str. C58]
 gi|159140299|gb|AAK87798.2| HFLK protein [Agrobacterium tumefaciens str. C58]
          Length = 372

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 193/312 (61%), Positives = 249/312 (79%), Gaps = 2/312 (0%)

Query: 29  DVEAIIRYIKDKF-DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
           D+E IIR  +D+F +++P   + G V I++L++  F   QSIY V PDER VELRFG+PK
Sbjct: 48  DLEEIIRRSQDRFKNVLPGGFNGGVVAIVVLVVLVFLGIQSIYTVQPDERGVELRFGRPK 107

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
           +++ +PGLH   WPI+ VEIVKV E+QQ IG R AS  S+SG++LTGDQNIV + FSVLY
Sbjct: 108 DEISMPGLHFHLWPIETVEIVKVTEQQQNIGSR-ASSSSSSGVMLTGDQNIVNVQFSVLY 166

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            V+DP+ YLFN++ P ETL+QVSESAMREVVGRR A DIFR  RQ IA +VR++IQ TMD
Sbjct: 167 TVSDPKSYLFNVDAPAETLQQVSESAMREVVGRRPAQDIFRDNRQAIAADVRSIIQSTMD 226

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y +GI IN ++IEDA+PPREVADAFDEVQRAEQDEDRFV+E+N+Y+N+ LG+ARG+A+ 
Sbjct: 227 GYGAGISINAVAIEDAAPPREVADAFDEVQRAEQDEDRFVQEANQYANQKLGAARGQAAQ 286

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK 327
           I E + AYK R++ EA+GEA RF+SIY QY  AP + R+R++LETME +LK + K+IID+
Sbjct: 287 IVEEANAYKSRVVNEAEGEAQRFISIYDQYRTAPEVTRQRMFLETMEQVLKGSNKIIIDE 346

Query: 328 KQSVMPYLPLNE 339
           KQ V+PYLPLNE
Sbjct: 347 KQGVVPYLPLNE 358


>gi|190892525|ref|YP_001979067.1| hydrolase serine protease transmembrane subunit K protein
           [Rhizobium etli CIAT 652]
 gi|190697804|gb|ACE91889.1| hydrolase serine protease transmembrane subunit K protein
           [Rhizobium etli CIAT 652]
 gi|327189902|gb|EGE57033.1| hydrolase serine protease transmembrane subunit K protein
           [Rhizobium etli CNPAF512]
          Length = 361

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 182/329 (55%), Positives = 241/329 (73%), Gaps = 4/329 (1%)

Query: 12  PTRLSGSNGNGDGLPPFDVEAIIRYIKDKF-DLIPFFKSYGSVYIILLLIGSFCAFQSIY 70
           P R  GS G G    P D+E IIR  +D+  +++P   + G   I+L ++  F   Q +Y
Sbjct: 27  PNRPRGSGGKGG---PPDLEDIIRRGQDQLRNIVPGGFNGGVTVIVLAIVAVFWLIQCVY 83

Query: 71  IVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGL 130
            V PDER VELRFGKP+  V +PGLH  FWP+D VEIVKV E+   +GG   S  +  GL
Sbjct: 84  TVQPDERGVELRFGKPRETVSMPGLHFHFWPMDTVEIVKVTEQLLNVGGTQGSSNTAGGL 143

Query: 131 ILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQ 190
           +L+GDQNI+ + F+VLY ++D R YLFN+E+P +TL+QVSESAMREVVGRR A D FR +
Sbjct: 144 MLSGDQNILNVRFNVLYQISDARAYLFNVESPAQTLQQVSESAMREVVGRRPAQDAFRDR 203

Query: 191 RQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEES 250
           R +IA EV N+IQ TM  Y SGI +N ++IED +PPREVADAF EVQRA+QD+ R VEE+
Sbjct: 204 RLEIASEVANIIQDTMSRYNSGISVNKVTIEDVAPPREVADAFQEVQRADQDKQRLVEEA 263

Query: 251 NKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYL 310
           N+Y+N+ LG ARG+ + IRE + AYKDR+++EA+GEA RF++I  +Y  AP + RKR++L
Sbjct: 264 NQYANQKLGQARGDGARIREDAAAYKDRVVKEAEGEAQRFIAIDEEYSKAPDVTRKRLFL 323

Query: 311 ETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           ETME +LK +KKVII++KQ V+PYLPLNE
Sbjct: 324 ETMEQVLKNSKKVIIEEKQGVVPYLPLNE 352


>gi|239832275|ref|ZP_04680604.1| HflK protein [Ochrobactrum intermedium LMG 3301]
 gi|239824542|gb|EEQ96110.1| HflK protein [Ochrobactrum intermedium LMG 3301]
          Length = 382

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 181/329 (55%), Positives = 240/329 (72%), Gaps = 8/329 (2%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLI------PFFKSYGSVYIILLLIGSFCAFQSIY 70
           G  G G   PP D+E I+R  +D+   +          + G +++I   +  F  FQSIY
Sbjct: 35  GPRGGGQNTPP-DLEDILRKGQDRLKQVFPGGGGKGGSNRGVLFLIGAAVLGFWLFQSIY 93

Query: 71  IVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGL 130
            V PDE AVELRFGKPK +V  PGLH  +WPI+  E  +++E+Q  IGG+  +  +  GL
Sbjct: 94  TVQPDELAVELRFGKPKEEVSEPGLHFHWWPIETYEKAQIVEKQINIGGQ-GNRSATQGL 152

Query: 131 ILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQ 190
           +LTGDQNIV + FSVLY V+DP+ YLFN++NP   ++QVSESA+RE+VGRR A D+FR  
Sbjct: 153 MLTGDQNIVNVQFSVLYRVSDPQAYLFNVDNPDAMVQQVSESAIREIVGRRPAQDVFRDN 212

Query: 191 RQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEES 250
           R  IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVEES
Sbjct: 213 RAAIATSVRDIVQQTLDAYKAGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVEES 272

Query: 251 NKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYL 310
           N+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+ G+Y  AP + R R++L
Sbjct: 273 NQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLGEYQKAPEVTRNRLFL 332

Query: 311 ETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           ETME +LK  KKVI++  + V+PYLPLNE
Sbjct: 333 ETMEQVLKSTKKVIVEPGKDVVPYLPLNE 361


>gi|153009124|ref|YP_001370339.1| HflK protein [Ochrobactrum anthropi ATCC 49188]
 gi|151561012|gb|ABS14510.1| HflK protein [Ochrobactrum anthropi ATCC 49188]
          Length = 383

 Score =  368 bits (944), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 179/326 (54%), Positives = 239/326 (73%), Gaps = 8/326 (2%)

Query: 20  GNGDGLPPFDVEAIIRYIKDKFDLI------PFFKSYGSVYIILLLIGSFCAFQSIYIVH 73
           G G   PP D+E I+R  +D+   +          + G +++I   +  F  FQS+Y V 
Sbjct: 38  GGGQNTPP-DLEDILRKGQDRLKQVFPGGGGKGGSNRGVLFLIGAAVVGFWLFQSVYTVQ 96

Query: 74  PDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILT 133
           PDE AVELRFGKPK +V  PGLH  +WPI+  E  +++E+Q  IGG+  +  +  GL+LT
Sbjct: 97  PDELAVELRFGKPKEEVSEPGLHFHWWPIETYEKAQIVEKQINIGGQ-GNRSATQGLMLT 155

Query: 134 GDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQ 193
           GDQNIV + FSVLY V+DP+ YLFN++NP   ++QVSESA+RE+VGRR A D+FR  R  
Sbjct: 156 GDQNIVNVQFSVLYRVSDPQAYLFNVDNPDAMVQQVSESAIREIVGRRPAQDVFRDNRSA 215

Query: 194 IALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKY 253
           IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVEESN+Y
Sbjct: 216 IASSVRDIVQQTLDTYKTGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVEESNQY 275

Query: 254 SNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETM 313
           SN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+ G+Y  AP + R R++LETM
Sbjct: 276 SNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLGEYQKAPEVTRNRLFLETM 335

Query: 314 EGILKKAKKVIIDKKQSVMPYLPLNE 339
           E +LK  KKVI++  + V+PYLPLNE
Sbjct: 336 EQVLKSTKKVIVEPGKDVVPYLPLNE 361


>gi|86358401|ref|YP_470293.1| hydrolase serine protease transmembrane subunit K protein
           [Rhizobium etli CFN 42]
 gi|86282503|gb|ABC91566.1| hydrolase serine protease transmembrane subunit K protein
           [Rhizobium etli CFN 42]
          Length = 362

 Score =  362 bits (930), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 189/329 (57%), Positives = 246/329 (74%), Gaps = 7/329 (2%)

Query: 12  PTRLSGSNGNGDGLPPFDVEAIIRYIKDKF-DLIPFFKSYGSVYIILLLIGSFCAFQSIY 70
           P R  G    G G PP D+E IIR  +D+  +++P   + G   I++ ++  F   Q +Y
Sbjct: 27  PNRPRG----GKGGPP-DLEDIIRRGQDQLRNIVPGGFNGGVAAIVVAIVAVFWLIQCVY 81

Query: 71  IVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGL 130
            V PDER VELRFGKP+ ++ +PGLH   WP+D VEIVKV E+QQ IGGR+ S  S +GL
Sbjct: 82  TVQPDERGVELRFGKPREEISMPGLHFRIWPMDAVEIVKVTEQQQNIGGRNNS-NSTAGL 140

Query: 131 ILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQ 190
           +L+GDQNIV + FSVLY + DP+ YLF LENP ETL+QVSESAMRE+VGRR A D FR  
Sbjct: 141 MLSGDQNIVNVQFSVLYTINDPKSYLFRLENPAETLQQVSESAMREIVGRRPAQDAFRDN 200

Query: 191 RQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEES 250
           R  I  EVRN+IQ TMD Y +GI IN ++IED +PPR+VADAF+EVQRA+QD+ R VEE+
Sbjct: 201 RGPIETEVRNIIQDTMDRYGAGIAINRVTIEDVAPPRDVADAFEEVQRADQDKQRLVEEA 260

Query: 251 NKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYL 310
           N+Y+N+ LG ARG+A+ IRE++ AYKDRI++EA+GEA RF+SIY +Y  AP + R+R++L
Sbjct: 261 NQYANQKLGQARGDAARIREAAAAYKDRIVKEAEGEAQRFVSIYDEYSKAPDVTRERLFL 320

Query: 311 ETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           ETME +LK +KKVIID+K   +PYLPLNE
Sbjct: 321 ETMEQVLKGSKKVIIDQKAGAVPYLPLNE 349


>gi|225627849|ref|ZP_03785886.1| HflK protein [Brucella ceti str. Cudo]
 gi|237815798|ref|ZP_04594795.1| HflK protein [Brucella abortus str. 2308 A]
 gi|225617854|gb|EEH14899.1| HflK protein [Brucella ceti str. Cudo]
 gi|237789096|gb|EEP63307.1| HflK protein [Brucella abortus str. 2308 A]
          Length = 401

 Score =  361 bits (927), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 182/335 (54%), Positives = 240/335 (71%), Gaps = 12/335 (3%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS----YGSVYIILLLIGS----FCAFQS 68
           G  G G   PP D+E I+R  +D+   +  F       GS   I  LIG+    F  FQS
Sbjct: 51  GPRGGGQNTPP-DLEDILRKGQDRLKQV--FPGGGGRKGSNRPIYFLIGAAVLGFWLFQS 107

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PGLH  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 108 VYTVQPDELAVELRFGKPKEEVSEPGLHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 166

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 167 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 226

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 227 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVE 286

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 287 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 346

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSR 343
           +LETME +LK  KKVI++  + V+PYLPL+E   +
Sbjct: 347 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQK 381


>gi|306839207|ref|ZP_07472024.1| HflK protein [Brucella sp. NF 2653]
 gi|306405754|gb|EFM62016.1| HflK protein [Brucella sp. NF 2653]
          Length = 399

 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 182/335 (54%), Positives = 240/335 (71%), Gaps = 12/335 (3%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS----YGSVYIILLLIGS----FCAFQS 68
           G  G G   PP D+E I+R  +D+   +  F       GS   I  LIG+    F  FQS
Sbjct: 49  GPRGGGQNTPP-DLEDILRKGQDRLKQV--FPGGGGRKGSNRPIYFLIGAVVLGFWLFQS 105

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PGLH  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 106 VYTVQPDELAVELRFGKPKEEVSEPGLHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 164

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 165 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 224

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 225 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVE 284

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 285 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 344

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSR 343
           +LETME +LK  KKVI++  + V+PYLPL+E   +
Sbjct: 345 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQK 379


>gi|306844295|ref|ZP_07476887.1| HflK protein [Brucella sp. BO1]
 gi|306275367|gb|EFM57108.1| HflK protein [Brucella sp. BO1]
          Length = 400

 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 182/335 (54%), Positives = 240/335 (71%), Gaps = 12/335 (3%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS----YGSVYIILLLIGS----FCAFQS 68
           G  G G   PP D+E I+R  +D+   +  F       GS   I  LIG+    F  FQS
Sbjct: 50  GPRGGGQNTPP-DLEDILRKGQDRLKQV--FPGGGGRKGSNRPIYFLIGAAVLGFWLFQS 106

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PGLH  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 107 VYTVQPDELAVELRFGKPKEEVSEPGLHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 165

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 166 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 225

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 226 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVE 285

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 286 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 345

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSR 343
           +LETME +LK  KKVI++  + V+PYLPL+E   +
Sbjct: 346 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQK 380


>gi|189024524|ref|YP_001935292.1| Band 7 protein [Brucella abortus S19]
 gi|225852879|ref|YP_002733112.1| HflK protein [Brucella melitensis ATCC 23457]
 gi|297248679|ref|ZP_06932397.1| membrane protease subunit HflK [Brucella abortus bv. 5 str. B3196]
 gi|189020096|gb|ACD72818.1| Band 7 protein [Brucella abortus S19]
 gi|225641244|gb|ACO01158.1| HflK protein [Brucella melitensis ATCC 23457]
 gi|297175848|gb|EFH35195.1| membrane protease subunit HflK [Brucella abortus bv. 5 str. B3196]
          Length = 400

 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 182/335 (54%), Positives = 240/335 (71%), Gaps = 12/335 (3%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS----YGSVYIILLLIGS----FCAFQS 68
           G  G G   PP D+E I+R  +D+   +  F       GS   I  LIG+    F  FQS
Sbjct: 50  GPRGGGQNTPP-DLEDILRKGQDRLKQV--FPGGGGRKGSNRPIYFLIGAAVLGFWLFQS 106

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PGLH  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 107 VYTVQPDELAVELRFGKPKEEVSEPGLHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 165

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 166 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 225

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 226 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVE 285

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 286 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 345

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSR 343
           +LETME +LK  KKVI++  + V+PYLPL+E   +
Sbjct: 346 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQK 380


>gi|306843266|ref|ZP_07475875.1| HflK protein [Brucella sp. BO2]
 gi|306286532|gb|EFM58115.1| HflK protein [Brucella sp. BO2]
          Length = 384

 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 182/335 (54%), Positives = 240/335 (71%), Gaps = 12/335 (3%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS----YGSVYIILLLIGS----FCAFQS 68
           G  G G   PP D+E I+R  +D+   +  F       GS   I  LIG+    F  FQS
Sbjct: 34  GPRGGGQNTPP-DLEDILRKGQDRLKQV--FPGGGGRKGSNRPIYFLIGAAVLGFWLFQS 90

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PGLH  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 91  VYTVQPDELAVELRFGKPKEEVSEPGLHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 149

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 150 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 209

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 210 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVE 269

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 270 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 329

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSR 343
           +LETME +LK  KKVI++  + V+PYLPL+E   +
Sbjct: 330 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQK 364


>gi|256369813|ref|YP_003107324.1| HflK protein [Brucella microti CCM 4915]
 gi|255999976|gb|ACU48375.1| HflK protein [Brucella microti CCM 4915]
          Length = 385

 Score =  360 bits (925), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 182/335 (54%), Positives = 240/335 (71%), Gaps = 12/335 (3%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS----YGSVYIILLLIGS----FCAFQS 68
           G  G G   PP D+E I+R  +D+   +  F       GS   I  LIG+    F  FQS
Sbjct: 35  GPRGGGQNTPP-DLEDILRKGQDRLKQV--FPGGGGRKGSNRPIYFLIGAAVLGFWLFQS 91

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PGLH  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 92  VYTVQPDELAVELRFGKPKEEVSEPGLHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 150

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 151 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 210

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 211 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVE 270

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 271 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 330

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSR 343
           +LETME +LK  KKVI++  + V+PYLPL+E   +
Sbjct: 331 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQK 365


>gi|294852723|ref|ZP_06793396.1| membrane protease subunit HflK [Brucella sp. NVSL 07-0026]
 gi|294821312|gb|EFG38311.1| membrane protease subunit HflK [Brucella sp. NVSL 07-0026]
          Length = 383

 Score =  360 bits (925), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 182/335 (54%), Positives = 240/335 (71%), Gaps = 12/335 (3%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS----YGSVYIILLLIGS----FCAFQS 68
           G  G G   PP D+E I+R  +D+   +  F       GS   I  LIG+    F  FQS
Sbjct: 33  GPRGGGQNTPP-DLEDILRKGQDRLKQV--FPGGGGRKGSNRPIYFLIGAAVLGFWLFQS 89

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PGLH  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 90  VYTVQPDELAVELRFGKPKEEVSEPGLHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 148

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 149 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 208

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 209 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVE 268

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 269 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 328

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSR 343
           +LETME +LK  KKVI++  + V+PYLPL+E   +
Sbjct: 329 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQK 363


>gi|17986893|ref|NP_539527.1| HFLK protein [Brucella melitensis bv. 1 str. 16M]
 gi|62290291|ref|YP_222084.1| HflK protein [Brucella abortus bv. 1 str. 9-941]
 gi|82700214|ref|YP_414788.1| band 7 protein [Brucella melitensis biovar Abortus 2308]
 gi|148559541|ref|YP_001259292.1| band 7 protein:stomatin [Brucella ovis ATCC 25840]
 gi|254689593|ref|ZP_05152847.1| HflK protein [Brucella abortus bv. 6 str. 870]
 gi|254694083|ref|ZP_05155911.1| HflK protein [Brucella abortus bv. 3 str. Tulya]
 gi|254697735|ref|ZP_05159563.1| HflK protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254702119|ref|ZP_05163947.1| HflK protein [Brucella suis bv. 5 str. 513]
 gi|254708071|ref|ZP_05169899.1| HflK protein [Brucella pinnipedialis M163/99/10]
 gi|254710441|ref|ZP_05172252.1| HflK protein [Brucella pinnipedialis B2/94]
 gi|254730624|ref|ZP_05189202.1| HflK protein [Brucella abortus bv. 4 str. 292]
 gi|256031935|ref|ZP_05445549.1| HflK protein [Brucella pinnipedialis M292/94/1]
 gi|256045029|ref|ZP_05447930.1| HflK protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|256061456|ref|ZP_05451600.1| HflK protein [Brucella neotomae 5K33]
 gi|256160133|ref|ZP_05457827.1| HflK protein [Brucella ceti M490/95/1]
 gi|256255339|ref|ZP_05460875.1| HflK protein [Brucella ceti B1/94]
 gi|256257842|ref|ZP_05463378.1| HflK protein [Brucella abortus bv. 9 str. C68]
 gi|256263638|ref|ZP_05466170.1| band 7 protein [Brucella melitensis bv. 2 str. 63/9]
 gi|260169071|ref|ZP_05755882.1| HflK protein [Brucella sp. F5/99]
 gi|260546833|ref|ZP_05822572.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260565373|ref|ZP_05835857.1| HflK protein [Brucella melitensis bv. 1 str. 16M]
 gi|260755120|ref|ZP_05867468.1| HflK protein [Brucella abortus bv. 6 str. 870]
 gi|260758339|ref|ZP_05870687.1| HflK protein [Brucella abortus bv. 4 str. 292]
 gi|260762165|ref|ZP_05874508.1| HflK protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884132|ref|ZP_05895746.1| HflK protein [Brucella abortus bv. 9 str. C68]
 gi|261214381|ref|ZP_05928662.1| HflK protein [Brucella abortus bv. 3 str. Tulya]
 gi|261222540|ref|ZP_05936821.1| HflK protein [Brucella ceti B1/94]
 gi|261315572|ref|ZP_05954769.1| HflK protein [Brucella pinnipedialis M163/99/10]
 gi|261318011|ref|ZP_05957208.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261325462|ref|ZP_05964659.1| HflK protein [Brucella neotomae 5K33]
 gi|261752689|ref|ZP_05996398.1| HflK protein [Brucella suis bv. 5 str. 513]
 gi|261758575|ref|ZP_06002284.1| band 7 protein [Brucella sp. F5/99]
 gi|265989041|ref|ZP_06101598.1| HflK protein [Brucella pinnipedialis M292/94/1]
 gi|265991456|ref|ZP_06104013.1| HflK protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|265998505|ref|ZP_06111062.1| HflK protein [Brucella ceti M490/95/1]
 gi|17982534|gb|AAL51791.1| hflk protein [Brucella melitensis bv. 1 str. 16M]
 gi|62196423|gb|AAX74723.1| HflK, hflK protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616315|emb|CAJ11372.1| Band 7 protein:Stomatin [Brucella melitensis biovar Abortus 2308]
 gi|148370798|gb|ABQ60777.1| band 7 protein:Stomatin [Brucella ovis ATCC 25840]
 gi|260095883|gb|EEW79760.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260151441|gb|EEW86535.1| HflK protein [Brucella melitensis bv. 1 str. 16M]
 gi|260668657|gb|EEX55597.1| HflK protein [Brucella abortus bv. 4 str. 292]
 gi|260672597|gb|EEX59418.1| HflK protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675228|gb|EEX62049.1| HflK protein [Brucella abortus bv. 6 str. 870]
 gi|260873660|gb|EEX80729.1| HflK protein [Brucella abortus bv. 9 str. C68]
 gi|260915988|gb|EEX82849.1| HflK protein [Brucella abortus bv. 3 str. Tulya]
 gi|260921124|gb|EEX87777.1| HflK protein [Brucella ceti B1/94]
 gi|261297234|gb|EEY00731.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261301442|gb|EEY04939.1| HflK protein [Brucella neotomae 5K33]
 gi|261304598|gb|EEY08095.1| HflK protein [Brucella pinnipedialis M163/99/10]
 gi|261738559|gb|EEY26555.1| band 7 protein [Brucella sp. F5/99]
 gi|261742442|gb|EEY30368.1| HflK protein [Brucella suis bv. 5 str. 513]
 gi|262553129|gb|EEZ08963.1| HflK protein [Brucella ceti M490/95/1]
 gi|263002240|gb|EEZ14815.1| HflK protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093691|gb|EEZ17696.1| band 7 protein [Brucella melitensis bv. 2 str. 63/9]
 gi|264661238|gb|EEZ31499.1| HflK protein [Brucella pinnipedialis M292/94/1]
 gi|326409420|gb|ADZ66485.1| Band 7 protein [Brucella melitensis M28]
 gi|326539127|gb|ADZ87342.1| HflK protein [Brucella melitensis M5-90]
          Length = 384

 Score =  360 bits (925), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 182/335 (54%), Positives = 240/335 (71%), Gaps = 12/335 (3%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS----YGSVYIILLLIGS----FCAFQS 68
           G  G G   PP D+E I+R  +D+   +  F       GS   I  LIG+    F  FQS
Sbjct: 34  GPRGGGQNTPP-DLEDILRKGQDRLKQV--FPGGGGRKGSNRPIYFLIGAAVLGFWLFQS 90

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PGLH  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 91  VYTVQPDELAVELRFGKPKEEVSEPGLHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 149

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 150 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 209

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 210 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVE 269

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 270 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 329

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSR 343
           +LETME +LK  KKVI++  + V+PYLPL+E   +
Sbjct: 330 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQK 364


>gi|254719431|ref|ZP_05181242.1| HflK protein [Brucella sp. 83/13]
 gi|265984435|ref|ZP_06097170.1| HflK protein [Brucella sp. 83/13]
 gi|264663027|gb|EEZ33288.1| HflK protein [Brucella sp. 83/13]
          Length = 383

 Score =  360 bits (925), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 182/335 (54%), Positives = 240/335 (71%), Gaps = 12/335 (3%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS----YGSVYIILLLIGS----FCAFQS 68
           G  G G   PP D+E I+R  +D+   +  F       GS   I  LIG+    F  FQS
Sbjct: 33  GPRGGGQNTPP-DLEDILRKGQDRLKQV--FPGGGGRKGSNRPIYFLIGAVVLGFWLFQS 89

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PGLH  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 90  VYTVQPDELAVELRFGKPKEEVSEPGLHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 148

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 149 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 208

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 209 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVE 268

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 269 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 328

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSR 343
           +LETME +LK  KKVI++  + V+PYLPL+E   +
Sbjct: 329 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQK 363


>gi|256113946|ref|ZP_05454734.1| HflK protein [Brucella melitensis bv. 3 str. Ether]
 gi|265995293|ref|ZP_06107850.1| HflK protein [Brucella melitensis bv. 3 str. Ether]
 gi|262766406|gb|EEZ12195.1| HflK protein [Brucella melitensis bv. 3 str. Ether]
          Length = 384

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 182/335 (54%), Positives = 240/335 (71%), Gaps = 12/335 (3%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS----YGSVYIILLLIGS----FCAFQS 68
           G  G G   PP D+E I+R  +D+   +  F       GS   I  LIG+    F  FQS
Sbjct: 34  GPRGGGQNTPP-DLEDILRKGQDRLKQV--FPGGGGRKGSNRPIYFLIGAAVLGFWLFQS 90

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PGLH  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 91  VYTVQPDELAVELRFGKPKEEVSEPGLHFHWWPFETYEKAQIVEKQINIGGQ-GTRDATQ 149

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 150 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 209

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 210 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVE 269

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 270 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 329

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSR 343
           +LETME +LK  KKVI++  + V+PYLPL+E   +
Sbjct: 330 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQK 364


>gi|254714434|ref|ZP_05176245.1| HflK protein [Brucella ceti M644/93/1]
 gi|254717331|ref|ZP_05179142.1| HflK protein [Brucella ceti M13/05/1]
 gi|261219160|ref|ZP_05933441.1| HflK protein [Brucella ceti M13/05/1]
 gi|261322222|ref|ZP_05961419.1| HflK protein [Brucella ceti M644/93/1]
 gi|260924249|gb|EEX90817.1| HflK protein [Brucella ceti M13/05/1]
 gi|261294912|gb|EEX98408.1| HflK protein [Brucella ceti M644/93/1]
          Length = 384

 Score =  358 bits (920), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 181/335 (54%), Positives = 239/335 (71%), Gaps = 12/335 (3%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS----YGSVYIILLLIGS----FCAFQS 68
           G  G G   PP D+E I+R  +D+   +  F       GS   I  LIG+    F  FQS
Sbjct: 34  GPRGGGQNTPP-DLEDILRKGQDRLKQV--FPGGGGRKGSNRPIYFLIGAAVLGFWLFQS 90

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PGLH  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 91  VYTVQPDELAVELRFGKPKEEVSEPGLHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 149

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 150 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 209

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA+PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 210 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAAPPREVADAFDEVQRAEQDEDRFVE 269

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R  +
Sbjct: 270 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNSL 329

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSR 343
           +LETME +LK  KKVI++  + V+PYLPL+E   +
Sbjct: 330 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQK 364


>gi|163843652|ref|YP_001628056.1| HflK protein [Brucella suis ATCC 23445]
 gi|163674375|gb|ABY38486.1| HflK protein [Brucella suis ATCC 23445]
          Length = 399

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 181/335 (54%), Positives = 238/335 (71%), Gaps = 12/335 (3%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS----YGSVYIILLLIGS----FCAFQS 68
           G  G G   PP D+E I+R  +D+   +  F       GS   I  LIG+    F  FQS
Sbjct: 49  GPRGGGQNTPP-DLEDILRKGQDRLKQV--FPGGGGRKGSNRPIYFLIGAAVLGFWLFQS 105

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PG H  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 106 VYTVQPDELAVELRFGKPKEEVSEPGPHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 164

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 165 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 224

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 225 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAPPPREVADAFDEVQRAEQDEDRFVE 284

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 285 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 344

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSR 343
           +LETME +LK  KKVI++  + V+PYLPL+E   +
Sbjct: 345 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQK 379


>gi|161619344|ref|YP_001593231.1| HflK protein [Brucella canis ATCC 23365]
 gi|161336155|gb|ABX62460.1| HflK protein [Brucella canis ATCC 23365]
          Length = 398

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 181/335 (54%), Positives = 238/335 (71%), Gaps = 12/335 (3%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS----YGSVYIILLLIGS----FCAFQS 68
           G  G G   PP D+E I+R  +D+   +  F       GS   I  LIG+    F  FQS
Sbjct: 48  GPRGGGQNTPP-DLEDILRKGQDRLKQV--FPGGGGRKGSNRPIYFLIGAAVLGFWLFQS 104

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PG H  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 105 VYTVQPDELAVELRFGKPKEEVSEPGPHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 163

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 164 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 223

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 224 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAPPPREVADAFDEVQRAEQDEDRFVE 283

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 284 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 343

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSR 343
           +LETME +LK  KKVI++  + V+PYLPL+E   +
Sbjct: 344 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQK 378


>gi|23502268|ref|NP_698395.1| hflK protein [Brucella suis 1330]
 gi|254704656|ref|ZP_05166484.1| HflK protein [Brucella suis bv. 3 str. 686]
 gi|260566098|ref|ZP_05836568.1| HflC protein [Brucella suis bv. 4 str. 40]
 gi|261755349|ref|ZP_05999058.1| HflK protein [Brucella suis bv. 3 str. 686]
 gi|23348242|gb|AAN30310.1| hflK protein [Brucella suis 1330]
 gi|260155616|gb|EEW90696.1| HflC protein [Brucella suis bv. 4 str. 40]
 gi|261745102|gb|EEY33028.1| HflK protein [Brucella suis bv. 3 str. 686]
          Length = 382

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 181/335 (54%), Positives = 238/335 (71%), Gaps = 12/335 (3%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS----YGSVYIILLLIGS----FCAFQS 68
           G  G G   PP D+E I+R  +D+   +  F       GS   I  LIG+    F  FQS
Sbjct: 32  GPRGGGQNTPP-DLEDILRKGQDRLKQV--FPGGGGRKGSNRPIYFLIGAAVLGFWLFQS 88

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK +V  PG H  +WP +  E  +++E+Q  IGG+  +  +  
Sbjct: 89  VYTVQPDELAVELRFGKPKEEVSEPGPHFHWWPFETYEKAQIVEKQINIGGQ-GTRNATQ 147

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+LTGDQNIV + FSVLY V+DPR YLFN+++P   ++QVSESA+RE+VGRR A D+FR
Sbjct: 148 GLMLTGDQNIVNVQFSVLYRVSDPRAYLFNVDSPDAMVQQVSESAIREIVGRRPAQDVFR 207

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  IA  VR+++Q+T+D YK+GI IN +SIEDA PPREVADAFDEVQRAEQDEDRFVE
Sbjct: 208 DNRSAIAQSVRDIVQQTLDNYKAGIQINAVSIEDAPPPREVADAFDEVQRAEQDEDRFVE 267

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ESN+YSN+ LG ARGEA+ +RE + AYK+R++Q+A+GEA RF S+  +Y  AP + R R+
Sbjct: 268 ESNQYSNQKLGQARGEAAQLREEAAAYKNRVVQDAEGEAQRFSSVLKEYQKAPEVTRNRL 327

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSR 343
           +LETME +LK  KKVI++  + V+PYLPL+E   +
Sbjct: 328 FLETMEEVLKGTKKVIVEPGKDVVPYLPLHELMQK 362


>gi|163758994|ref|ZP_02166080.1| putative membrane bound protease protein [Hoeflea phototrophica
           DFL-43]
 gi|162283398|gb|EDQ33683.1| putative membrane bound protease protein [Hoeflea phototrophica
           DFL-43]
          Length = 373

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 182/330 (55%), Positives = 234/330 (70%), Gaps = 15/330 (4%)

Query: 22  GDGLPPFDVEAIIRYIKDKF---------DLIPFFKSYGSVYIILLLIGSFCAFQSIYIV 72
           G G PP D+E +IR  +DK                    +V + L L+G +   QS+Y V
Sbjct: 37  GGGNPP-DLEELIRRGQDKLRQALPGGGGGPGAGGGKMIAVVVALGLVGLWLT-QSVYTV 94

Query: 73  HPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLIL 132
            PDER VELRFGKPK +V  PGLHM+ WP + VE   ++ER+   GG S+  GS+ GL+L
Sbjct: 95  QPDERGVELRFGKPKEEVSQPGLHMILWPFETVEFATIVEREMSTGG-SSRTGSSDGLML 153

Query: 133 TGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQ 192
           +GDQNIV + F +LY V+DP+ +LFNL  P +TL+QV+ESAMREVVGRR A DIFR  R+
Sbjct: 154 SGDQNIVDVEFKLLYAVSDPKSFLFNLAQPEDTLRQVAESAMREVVGRRPAQDIFRDNRE 213

Query: 193 QIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNK 252
            IA EV+ +IQ  MD + SGIL+N +SIEDA+PPREVADAFDEVQRAEQDEDRFVEE N+
Sbjct: 214 VIAAEVQTIIQTVMDSFPSGILVNQVSIEDAAPPREVADAFDEVQRAEQDEDRFVEEGNQ 273

Query: 253 YSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLET 312
           Y+N+ LG ARGEA+ +RE + AYKDR++ EA GEA RFLS+Y +Y  AP + R R+YLET
Sbjct: 274 YANQKLGQARGEAAQLREEASAYKDRVVNEATGEAGRFLSVYEEYAKAPEVTRSRLYLET 333

Query: 313 MEGILKKAKKVIIDKKQS---VMPYLPLNE 339
           +E +L  ++KVII++  S   V+PYLPL E
Sbjct: 334 LEEVLGGSEKVIIEQGGSGSGVVPYLPLPE 363


>gi|319782921|ref|YP_004142397.1| HflK protein [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317168809|gb|ADV12347.1| HflK protein [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 372

 Score =  356 bits (913), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 180/336 (53%), Positives = 238/336 (70%), Gaps = 20/336 (5%)

Query: 12  PTRLSGSNGNGDGLPPFDVEAIIRYIKDKF--------DLIPFFKSYGSVYIILLLIGSF 63
           P   SG  G+     P D+E IIR  +D+            P   +  +  +++L     
Sbjct: 28  PKGPSGPQGS-----PPDLEDIIRRGQDRLRRALPGGGGASPAIFALIAAALVVL----- 77

Query: 64  CAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSAS 123
            AF+++Y V PDE AVELRFGKPK ++  PGLH  +WP++ VE  K+ E+   IGG  A+
Sbjct: 78  WAFKAVYTVQPDEVAVELRFGKPKTELSQPGLHFHWWPLETVETAKISEQLVDIGGGGAT 137

Query: 124 VGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFA 183
            G+ SGL+LTGDQNIV + FSV Y V+DPR YLF++ +P   L+QV+ESAMRE VGRR A
Sbjct: 138 SGNTSGLMLTGDQNIVNVQFSVAYQVSDPRAYLFDVSDPDGMLRQVAESAMREAVGRRPA 197

Query: 184 VDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDE 243
            DIFR  RQ IA  VR +IQ T+D YK+G+ +N +SIEDA+PPREVADAFDEVQRAEQDE
Sbjct: 198 QDIFRDDRQGIAASVREIIQTTLDGYKAGLNVNAVSIEDAAPPREVADAFDEVQRAEQDE 257

Query: 244 DRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTL 303
           D+FVE++N+YSN+ LG ARGEA+ IRE + AYK+R++QEA+GEA RF+S+Y +Y  AP +
Sbjct: 258 DKFVEQANQYSNQKLGQARGEAAQIREDAAAYKNRVVQEAEGEAQRFISVYDEYAKAPDV 317

Query: 304 LRKRIYLETMEGILKKAKKVIIDK--KQSVMPYLPL 337
            RKR+YLETME +LK + KVI+++   Q V+PYLPL
Sbjct: 318 TRKRLYLETMEKVLKDSSKVIVEQGNGQGVVPYLPL 353


>gi|260462165|ref|ZP_05810409.1| HflK protein [Mesorhizobium opportunistum WSM2075]
 gi|259032025|gb|EEW33292.1| HflK protein [Mesorhizobium opportunistum WSM2075]
          Length = 371

 Score =  350 bits (899), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 179/334 (53%), Positives = 240/334 (71%), Gaps = 19/334 (5%)

Query: 12  PTRLSGSNGNGDGLPPFDVEAIIRYIKDKFD-LIPFFKS-----YGSVYIILLLIGSFCA 65
           P   SG  G+     P D+E IIR  +D+    +P         +G +  +L+++    A
Sbjct: 28  PKGPSGPQGS-----PPDLEDIIRRGQDRLRRALPGGGGASPAVFGLIAAVLVVL---WA 79

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVG 125
           FQ++Y V PDE AVELRFGKPK ++  PGLH  +WP++ VE  K+ E+   IGG + S  
Sbjct: 80  FQAVYTVQPDEVAVELRFGKPKAELSQPGLHFHWWPLETVETAKISEQLVDIGGGNTS-- 137

Query: 126 SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVD 185
             +GL+L+GDQNIV + FSV Y V+DPR YLF++ +P   L+QV+ESAMRE VGRR A D
Sbjct: 138 -GNGLMLSGDQNIVNVQFSVAYQVSDPRAYLFDVSDPDGMLRQVAESAMREAVGRRPAQD 196

Query: 186 IFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDR 245
           IFR  RQ IA  VR +IQ T+D YK+G+ +N +SIEDA+PPREVADAFDEVQRAEQDED+
Sbjct: 197 IFRDDRQGIAASVREIIQTTLDGYKAGLNVNAVSIEDAAPPREVADAFDEVQRAEQDEDK 256

Query: 246 FVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLR 305
           FVE++N+YSN+ LG ARGEA+ +RE + AYK+R++QEA+GEA RF+S+Y +YV AP + R
Sbjct: 257 FVEQANQYSNQKLGQARGEAAQVREDAAAYKNRVVQEAEGEAQRFISVYDEYVKAPDVTR 316

Query: 306 KRIYLETMEGILKKAKKVIIDK--KQSVMPYLPL 337
           KR+YLETME +LK + KVI+++   Q V+PYLPL
Sbjct: 317 KRLYLETMERVLKDSSKVIVEQGNGQGVVPYLPL 350


>gi|13471474|ref|NP_103040.1| protease subunit hflK [Mesorhizobium loti MAFF303099]
 gi|14022216|dbj|BAB48826.1| protease subunit; HflK [Mesorhizobium loti MAFF303099]
          Length = 371

 Score =  349 bits (896), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 178/331 (53%), Positives = 239/331 (72%), Gaps = 13/331 (3%)

Query: 12  PTRLSGSNGNGDGLPPFDVEAIIRYIKDKF--DLIPFFKSYGSVY-IILLLIGSFCAFQS 68
           P   SG  G+     P D+E IIR  +D+    L     +  +V+ +I  ++ +  AFQ+
Sbjct: 28  PKGPSGPQGS-----PPDLEDIIRRGQDRLRRALPGGGGASPAVFGLIAAVLVALWAFQA 82

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y V PDE AVELRFGKPK ++  PGLH  +WP++ VE  K+ E+   IGG + S    +
Sbjct: 83  VYTVQPDEVAVELRFGKPKAELSQPGLHFHWWPLETVETAKISEQLVDIGGGNTS---GN 139

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           GL+L+GDQNIV + FSV Y V+DPR YLF++ +P   L+QV+ESAMRE VGRR A DIFR
Sbjct: 140 GLMLSGDQNIVNVQFSVAYQVSDPRAYLFDVSDPDGMLRQVAESAMREAVGRRPAQDIFR 199

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             RQ IA  VR +IQ T+D YK+G+ +N +SIEDA+PPREVADAFDEVQRAEQDED+FVE
Sbjct: 200 DDRQGIAASVREIIQSTLDGYKAGLNVNAVSIEDAAPPREVADAFDEVQRAEQDEDKFVE 259

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           ++N+YSN+ LG ARG+A+ IRE + AYK+R++QEA+GEA RF+S+Y +Y  AP + RKR+
Sbjct: 260 QANQYSNQKLGQARGQAAQIREDAAAYKNRVVQEAEGEAQRFISVYDEYAKAPDVTRKRL 319

Query: 309 YLETMEGILKKAKKVIIDK--KQSVMPYLPL 337
           YLETME +LK + KVI+++   Q V+PYLPL
Sbjct: 320 YLETMERVLKDSSKVIVEQGNGQGVVPYLPL 350


>gi|116252997|ref|YP_768835.1| transmembrane serine protease [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115257645|emb|CAK08742.1| putative transmembrane serine protease [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 360

 Score =  349 bits (895), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 167/312 (53%), Positives = 237/312 (75%), Gaps = 3/312 (0%)

Query: 29  DVEAIIRYIKDKF-DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
           D+E IIR  +D+  ++IP   + G   I++ ++  F   Q IY+V PDER VELRFGKPK
Sbjct: 42  DLEDIIRRGQDQLRNIIPGGFNGGVAVIVVAIVAVFWLIQCIYVVQPDERGVELRFGKPK 101

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
           +++ +PGLH  FWP++ VE VKV  +Q  IG  SAS  S++GL+L+ D++++ + F+V Y
Sbjct: 102 DEISMPGLHFHFWPMETVETVKVTVQQLNIGATSAS--SSNGLMLSSDKSVINVQFAVFY 159

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            V+DP+ YLFN+ENP ETL+QVS+SAMRE+VGRR A D FRS RQ I ++V N++Q TM+
Sbjct: 160 TVSDPKAYLFNVENPAETLQQVSDSAMREIVGRRPAQDAFRSNRQPIEVDVLNILQDTMN 219

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y +G+ +  ++I++ +PPREVADAF+EVQRA +D D  +EE+N+Y+N+ LG ARG+A+ 
Sbjct: 220 RYGAGVTVTGVTIQNVAPPREVADAFEEVQRAGRDRDSTIEEANRYTNQKLGQARGDAAR 279

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK 327
           IRE + AYKDR+++EA+GEA RF +I  +Y  AP + RKR+YLETME +LK ++KVIID+
Sbjct: 280 IREDAAAYKDRVVKEAEGEAQRFTAINDEYSKAPDVTRKRLYLETMEQVLKNSRKVIIDE 339

Query: 328 KQSVMPYLPLNE 339
           KQ V+PYLPLNE
Sbjct: 340 KQGVLPYLPLNE 351


>gi|241205504|ref|YP_002976600.1| HflK protein [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240859394|gb|ACS57061.1| HflK protein [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 360

 Score =  344 bits (883), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 165/312 (52%), Positives = 234/312 (75%), Gaps = 3/312 (0%)

Query: 29  DVEAIIRYIKDKF-DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
           D+E IIR  +D+  ++IP   + G   I++ ++  F   Q IY+V PDER VELRFGKPK
Sbjct: 42  DLEDIIRRGQDQLRNIIPGGFNGGVAVIVVAIVAVFWLIQCIYVVQPDERGVELRFGKPK 101

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
            ++ +PGLH   WP++ VE VKV  +Q  IG  SAS  S++GL+L+ D++++ + F+V Y
Sbjct: 102 EEISMPGLHFHLWPMETVETVKVTVQQLNIGATSAS--SSNGLMLSSDKSVINVQFAVFY 159

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            V+DP+ YLFN+ENP ETL+QVS+SAMRE+VGRR A D FRS RQ I ++V N++Q TM+
Sbjct: 160 TVSDPKAYLFNVENPAETLQQVSDSAMREIVGRRPAQDAFRSNRQPIEVDVLNILQDTMN 219

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y +G+ +  ++I++ +PPREVADAF+EVQRA +D D  +EE+N+Y+N+ LG ARG+A+ 
Sbjct: 220 RYGAGVTVTGVTIQNVAPPREVADAFEEVQRAGRDRDSTIEEANRYTNQKLGQARGDAAR 279

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK 327
           IRE + AY DR+++EA+GEA RF +I  +Y  AP + RKR+YLETME +LK ++KVIID+
Sbjct: 280 IREDAAAYTDRVVKEAEGEAQRFTAINDEYSKAPDVTRKRLYLETMEQVLKNSRKVIIDE 339

Query: 328 KQSVMPYLPLNE 339
           KQ V+PYLPLNE
Sbjct: 340 KQGVLPYLPLNE 351


>gi|209550123|ref|YP_002282040.1| HflK protein [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209535879|gb|ACI55814.1| HflK protein [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 362

 Score =  344 bits (882), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 162/314 (51%), Positives = 236/314 (75%), Gaps = 3/314 (0%)

Query: 27  PFDVEAIIRYIKDKF-DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGK 85
           P D+E IIR  +D+  +++P   + G   I+  ++  F   Q +Y+V PDER VELRFGK
Sbjct: 42  PPDLEDIIRRGQDQLRNIVPGGFNGGVAVIVAAVVAIFWLIQCVYVVQPDERGVELRFGK 101

Query: 86  PKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSV 145
           PK+++ +PGLH   WP++ VE VKV  +Q  IG  SAS  S++GL+L+ D++++ + F+V
Sbjct: 102 PKDEISMPGLHFHLWPLESVETVKVTVQQLNIGATSAS--SSNGLMLSSDKSVINVQFAV 159

Query: 146 LYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKT 205
            Y V+DP+ YLFN+ENP ETL+QVS+SAMRE+VGRR A D FRS RQ I ++V N++Q T
Sbjct: 160 FYTVSDPKAYLFNVENPAETLQQVSDSAMREIVGRRPAQDAFRSNRQPIEVDVLNIVQDT 219

Query: 206 MDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEA 265
           M+ Y +G+ +  ++I++ +PPREVADAF+EVQRA +D D  +E++N+Y+N+ LG ARG+A
Sbjct: 220 MNRYGAGVTVTGVTIQNVAPPREVADAFEEVQRAGRDRDSTIEDANRYTNQKLGQARGDA 279

Query: 266 SHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII 325
           + IRE + AYK+R+++EA+GEA RF +I  +Y  AP + RKR+++ETME +LK +KKVII
Sbjct: 280 ARIREDAAAYKNRVVKEAEGEAQRFTAINDEYSKAPEVTRKRLFIETMEQVLKNSKKVII 339

Query: 326 DKKQSVMPYLPLNE 339
           D+KQ V+PYLPLNE
Sbjct: 340 DEKQGVLPYLPLNE 353


>gi|110634100|ref|YP_674308.1| HflK protein [Mesorhizobium sp. BNC1]
 gi|110285084|gb|ABG63143.1| protease FtsH subunit HflK [Chelativorans sp. BNC1]
          Length = 376

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 175/318 (55%), Positives = 233/318 (73%), Gaps = 7/318 (2%)

Query: 27  PFDVEAIIRYIKDKFD-LIPFF--KSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRF 83
           P D+E IIR  +DK    +P    +S   V +I L++     F+SIY V PDE AVELRF
Sbjct: 35  PPDLEEIIRRGQDKLRRALPGGGGRSPAMVALIALVLVGLWLFKSIYTVQPDEIAVELRF 94

Query: 84  GKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHF 143
           GKPK ++  PGLH  +WP++ V+ V + ER   IG      G++SGL+L+GDQNIV + F
Sbjct: 95  GKPKAELSEPGLHFHWWPVETVDTVSIAERLVDIG--EIRSGASSGLMLSGDQNIVDVKF 152

Query: 144 SVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQ 203
           SV Y V DP  YLF +++P   ++QV+ESAMREVVGRR A DIFR  RQ IAL+V+N+IQ
Sbjct: 153 SVAYQVDDPIAYLFRVDDPDGMVRQVAESAMREVVGRRPAQDIFRDDRQGIALDVQNIIQ 212

Query: 204 KTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARG 263
           +T++ Y +G+ +N +SIED +PPREVADAFDEVQRAEQDEDRFVEESN+Y+N+ LG +RG
Sbjct: 213 QTLNDYGTGVRVNALSIEDVAPPREVADAFDEVQRAEQDEDRFVEESNQYANQQLGQSRG 272

Query: 264 EASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKV 323
           EA+ IRE + AYK+R++ EA+GEA RFLS+Y +Y  AP + R R+YLETME +L+ + KV
Sbjct: 273 EAAQIREEAAAYKNRVVLEAEGEAQRFLSVYEEYAKAPDVTRMRLYLETMENVLRGSNKV 332

Query: 324 IID--KKQSVMPYLPLNE 339
           +++    QSV+PYLPL E
Sbjct: 333 LVEPGSGQSVLPYLPLPE 350


>gi|90419203|ref|ZP_01227113.1| membrane protease subunit HflK [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336140|gb|EAS49881.1| membrane protease subunit HflK [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 395

 Score =  331 bits (849), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 162/295 (54%), Positives = 217/295 (73%), Gaps = 8/295 (2%)

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIV 108
            +G +++  L +     F+++Y V PDE  VEL FGKP+ ++  PGLH+ FWP + VE V
Sbjct: 76  GWGILFVAGLAV--LWLFKAVYTVQPDEIGVELLFGKPRQELSDPGLHVAFWPFETVETV 133

Query: 109 KVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
            V+E Q  +G  S+  G NSGL+L+GDQNIV + F+VLY V DP+ YLF +++P   L+Q
Sbjct: 134 PVVENQITLG--SSQSGDNSGLMLSGDQNIVDVQFAVLYQVDDPQNYLFQVDDPIAMLQQ 191

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
           VSESAMREVVGRR   D+FR  R  IA EVR + Q+TM+ Y++G+ +N ISIEDA+PP +
Sbjct: 192 VSESAMREVVGRRPVQDVFRDDRAGIAEEVRQITQETMNEYQAGLRVNGISIEDAAPPSQ 251

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           VADAFDEVQRAEQDEDRF+EE+N+Y N+ LG ARGEA+ IRE +  YK+R++QEA+GEA 
Sbjct: 252 VADAFDEVQRAEQDEDRFIEEANRYRNQQLGQARGEAAQIREDAAGYKNRVVQEAEGEAQ 311

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK----KQSVMPYLPLNE 339
           RF SI  ++  AP + RKR++LETMEG+LK + K+II+      Q V+PYLPLNE
Sbjct: 312 RFSSILAEFEKAPEITRKRLFLETMEGVLKGSTKMIIEPGAAGGQGVVPYLPLNE 366


>gi|114706850|ref|ZP_01439750.1| Band 7 protein:Stomatin [Fulvimarina pelagi HTCC2506]
 gi|114537798|gb|EAU40922.1| Band 7 protein:Stomatin [Fulvimarina pelagi HTCC2506]
          Length = 398

 Score =  325 bits (834), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 157/278 (56%), Positives = 208/278 (74%), Gaps = 6/278 (2%)

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVG 125
           F+++Y V PDE  VE+ FGKPK ++  PGLH + WP + V+ V V+E Q  +G  S+  G
Sbjct: 87  FKAVYTVQPDEVGVEMLFGKPKQELAQPGLHFIMWPFETVDTVPVVESQITLG--SSQRG 144

Query: 126 SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVD 185
            NSGL+L+GDQNIV + F+VLY V +P+ +LFN+++P   ++QVSESAMREVVGRR   D
Sbjct: 145 ENSGLMLSGDQNIVDVQFAVLYQVDNPQNFLFNVQDPTAMVQQVSESAMREVVGRRPVQD 204

Query: 186 IFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDR 245
           +FR  R  IA EVR + Q T++ Y +GI IN ISIEDA+PP +VADAFDEVQRAEQDEDR
Sbjct: 205 VFRDDRAGIAEEVREITQTTLNDYGTGIRINGISIEDAAPPPQVADAFDEVQRAEQDEDR 264

Query: 246 FVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLR 305
           F+EE+N+Y N+ LG ARGEA+ IRE + AYK R++QEA+GEA RF SI  +Y  AP + R
Sbjct: 265 FIEEANRYRNQQLGQARGEAAQIREDAAAYKSRVVQEAEGEAQRFSSILEEYAKAPEVTR 324

Query: 306 KRIYLETMEGILKKAKKVIIDKK----QSVMPYLPLNE 339
           KR++LETMEG+L+ + K+I++      Q V+PYLPLNE
Sbjct: 325 KRLFLETMEGVLRDSNKIILESNAAGGQGVVPYLPLNE 362


>gi|304392188|ref|ZP_07374130.1| HflK protein [Ahrensia sp. R2A130]
 gi|303296417|gb|EFL90775.1| HflK protein [Ahrensia sp. R2A130]
          Length = 388

 Score =  306 bits (785), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 156/298 (52%), Positives = 206/298 (69%), Gaps = 7/298 (2%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           I+ +L+G    F S Y V  DE AVE  FG P+NDV   GLH  FWP ++V+ V +  RQ
Sbjct: 85  IVAVLLGGLYLFSSAYQVEADELAVETVFGVPRNDVNEAGLHFAFWPFERVDKVNIGVRQ 144

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
             IG  S   GS  GL+L+GDQNIV + FSV Y V  P+ +LFN+ +P   +++V+ESAM
Sbjct: 145 VNIGS-SGRGGSQQGLMLSGDQNIVDVTFSVQYDVNVPKDFLFNVNDPTGMVEEVAESAM 203

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           RE+VGRR A DIFR  RQ IA +VR + Q  +D Y +GI I  ++IED +PP +VADAFD
Sbjct: 204 REIVGRRPAQDIFRDDRQGIAQDVREITQSILDSYGTGIGIRALNIEDVAPPAKVADAFD 263

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           EVQRAEQ+ED+F EE+N+YSN+VLG ARGE++ IRE +  YK RI+QEA+GEA RF+S+Y
Sbjct: 264 EVQRAEQNEDQFQEEANRYSNKVLGEARGESAQIREDAAGYKSRIVQEAEGEAARFISVY 323

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK------KQSVMPYLPLNEAFSRIQT 346
            QY  AP + RKR++LETMEG+L+ + KVI++          V+PYLPL E   R  +
Sbjct: 324 EQYAKAPEVTRKRLFLETMEGVLRDSNKVIMESGGNGQGGTGVVPYLPLPEIGKRANS 381


>gi|218673227|ref|ZP_03522896.1| hydrolase serine protease transmembrane subunit K protein
           [Rhizobium etli GR56]
          Length = 362

 Score =  305 bits (782), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 219/332 (65%), Gaps = 9/332 (2%)

Query: 12  PTRLSGSNGNGDGLPPFDVEAIIRYIKDKF-DLIPFFKSYGSVYIILLLIGSFCAFQSIY 70
           P R  GS G G    P D+E IIR  +D+  +++P   + G   I+L ++  F   Q +Y
Sbjct: 27  PNRPRGSGGKGG---PPDLEDIIRRGQDQLRNIVPGGFNGGVAVIVLAIVAVFWLIQCVY 83

Query: 71  IVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGL 130
            V PDER VELRFGKP+  V +PGLH  FWP+D VEIVKV E+   +GG   S  +  GL
Sbjct: 84  TVQPDERGVELRFGKPRETVSMPGLHFHFWPMDTVEIVKVTEQLLNVGGTQGSSNTAGGL 143

Query: 131 ILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS---ESAMREVVGRRFAVDIF 187
           +L+GD         +   ++D R    +L+      ++ S   ++   EVVGRR A D F
Sbjct: 144 MLSGDPE--HPQCPLQRSLSDQRCARLSLQRRKPRRRRCSRFPKARCAEVVGRRPAQDAF 201

Query: 188 RSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFV 247
           R +R +IA EV N+IQ TM  Y SGI IN ++IED +PPREVADAF EVQRA+QD+ R V
Sbjct: 202 RDRRLEIASEVANIIQDTMSRYSSGISINKVTIEDVAPPREVADAFQEVQRADQDKQRLV 261

Query: 248 EESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKR 307
           EE+N+Y+N+ LG ARG+ + IRE + AYK R+++EA+GEA RF++I  QY  AP + RKR
Sbjct: 262 EEANQYANQKLGQARGDGARIREDAAAYKGRVVKEAEGEAQRFIAIDEQYSKAPDVTRKR 321

Query: 308 IYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           ++LETME +LK ++KVII++KQ V+PYLPLNE
Sbjct: 322 LFLETMEQVLKNSRKVIIEEKQGVVPYLPLNE 353


>gi|240850867|ref|YP_002972267.1| protease subunit HflK [Bartonella grahamii as4aup]
 gi|240267990|gb|ACS51578.1| protease subunit HflK [Bartonella grahamii as4aup]
          Length = 381

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 132/308 (42%), Positives = 198/308 (64%), Gaps = 4/308 (1%)

Query: 33  IIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL 92
           I+R  KD+F     F   G+V + LLL   F  +QS+YIV  +E+AVELRFG PK  +  
Sbjct: 48  ILRKGKDQFKQ---FSRGGTVVLFLLLAVCFLLYQSLYIVQQNEQAVELRFGVPKEGIIG 104

Query: 93  PGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP 152
            GLH  FWPI+    V + E+   IGG+   V  + GL+L+ DQNIV ++FSV Y ++ P
Sbjct: 105 DGLHFHFWPIETYMKVPLTEKTIAIGGKPGQVQQSEGLMLSSDQNIVNVNFSVYYRISHP 164

Query: 153 RLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSG 212
             +LFN+ +   T++QV+ESAMREV+G R   D+ R +++++A +VR +IQ T+D Y+ G
Sbjct: 165 GQFLFNVNDQEGTVRQVAESAMREVIGSRPVDDVLRDKKEEVANDVRKIIQLTVDKYQLG 224

Query: 213 ILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESS 272
           + I+ +SI +A+PP +VA AF+ VQ+AEQ+  R +EE N+     +G A GEAS  RE +
Sbjct: 225 VEISRVSISEAAPPTKVAAAFNSVQQAEQERGRMIEEGNRVRFTKIGLANGEASRTREIA 284

Query: 273 IAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-V 331
              K ++++EA+G A+RF +I  +   +P   R R+Y+ETM  I     K+++D+  S  
Sbjct: 285 KGEKAQMVEEARGRAERFQAIAREAAISPEAARYRLYMETMGRIFSSPNKLVLDQMNSPA 344

Query: 332 MPYLPLNE 339
           +PYLPLNE
Sbjct: 345 VPYLPLNE 352


>gi|218463522|ref|ZP_03503613.1| hydrolase serine protease transmembrane subunit K protein
           [Rhizobium etli Kim 5]
          Length = 257

 Score =  252 bits (643), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 127/233 (54%), Positives = 163/233 (69%), Gaps = 4/233 (1%)

Query: 12  PTRLSGSNGNGDGLPPFDVEAIIRYIKDKF-DLIPFFKSYGSVYIILLLIGSFCAFQSIY 70
           P R  GS G G    P D+E IIR  +D+  +++P   + G   I+L ++  F   Q +Y
Sbjct: 28  PNRPRGSGGKGG---PPDLEDIIRRGQDQLRNIVPGGFNGGVAVIVLAIVAVFWLIQCVY 84

Query: 71  IVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGL 130
            V PDER VELRFGKP+  V +PGLH  FWP+D VEIVKV E+   +GG   S  +  GL
Sbjct: 85  TVQPDERGVELRFGKPRETVSMPGLHFHFWPMDTVEIVKVTEQLLNVGGTQGSSNTAGGL 144

Query: 131 ILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQ 190
           +L+GDQNI+ + F+VLY ++D R YLFN+E+P +TL+QVSESAMREVVGRR A D FR +
Sbjct: 145 MLSGDQNILNVRFNVLYQISDARAYLFNVESPAQTLQQVSESAMREVVGRRPAQDAFRDR 204

Query: 191 RQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDE 243
           R +IA EV N+IQ TM  Y SGI IN ++IED +PPREVADAF EVQRA+QD+
Sbjct: 205 RLEIASEVANIIQDTMSRYNSGISINKVTIEDVAPPREVADAFQEVQRADQDK 257


>gi|319407476|emb|CBI81126.1| ftsH protease activity modulator HflK [Bartonella sp. 1-1C]
          Length = 376

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 138/338 (40%), Positives = 208/338 (61%), Gaps = 13/338 (3%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSF 63
           DK  S  +P    GSNG        +++ I R  +D+          G ++IIL L+  F
Sbjct: 22  DKKLSPKKPFGSGGSNGP-------NIDDIFRKGQDQLKQF----GGGGIFIILFLLALF 70

Query: 64  -CAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSA 122
              FQSIYIV  +E+AVELRFG PK  +   GLH  FWPI+    V + E+   IGG+S 
Sbjct: 71  FWCFQSIYIVQQNEQAVELRFGVPKEGIISDGLHFHFWPIETYMKVPLTEKTIAIGGQSG 130

Query: 123 SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRF 182
            +  + GL+L+ DQNIV ++FSV Y +++P  +LFN+ +   T++QV+ESAMREV+G R 
Sbjct: 131 QLQQSEGLMLSSDQNIVNVNFSVYYRISNPSQFLFNVNDQEGTVRQVAESAMREVIGSRP 190

Query: 183 AVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQD 242
             D+ R +++++A +V+ +IQ T D Y+ G+ IN +SI +A+PP +VA AF+ VQ+AEQ+
Sbjct: 191 VDDVLRDKKEEVADDVKKIIQLTADKYQLGVEINRVSISEAAPPTKVAAAFNSVQQAEQE 250

Query: 243 EDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPT 302
             R +EE N+     +G A GEA+  RE +   K ++I+EA G ++RF +I  +   AP 
Sbjct: 251 RGRMIEEGNRVHFTKMGLANGEAARTREVAKGEKAQMIEEAIGRSERFQAIAREAAIAPE 310

Query: 303 LLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
             R R+Y+ETM  I    +K+++D+  S  + YLPLNE
Sbjct: 311 AARYRLYMETMGRIFSSPRKIVLDQTASPTVSYLPLNE 348


>gi|319404483|emb|CBI78090.1| ftsH protease activity modulator HflK [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 376

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 142/359 (39%), Positives = 215/359 (59%), Gaps = 17/359 (4%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSF 63
           DK  S  +P    GSNG        +++ I R  +D+   I  F   G   I+ LL+  F
Sbjct: 22  DKKLSPKKPFGSGGSNGP-------NIDDIFRKGQDQ---IKQFGGGGVFIILFLLVLFF 71

Query: 64  CAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSAS 123
             FQS+YIV  +E+AVELRFG PK  +   GLH  FWPI+    V + E+   IGG+S  
Sbjct: 72  WCFQSMYIVQQNEQAVELRFGVPKEGIISDGLHFHFWPIETYMKVPLTEKTIAIGGQSGQ 131

Query: 124 VGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFA 183
           +  + GL+L+ DQNIV ++FSV Y +++P  +LFN+ +   T++QV+ESAMREV+G R  
Sbjct: 132 LQQSEGLMLSSDQNIVNVNFSVYYRISNPSQFLFNVNDQEGTVRQVAESAMREVIGSRPI 191

Query: 184 VDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDE 243
            D+ R +++++A +V+ +IQ T D Y+ G+ IN +SI +A+PP +VA AF+ VQ+AEQ+ 
Sbjct: 192 DDVLRDKKEEVADDVKKIIQLTADKYQLGVEINRVSISEAAPPTKVAAAFNSVQQAEQER 251

Query: 244 DRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTL 303
            R +EE N+     +G A GEA+  RE +   K ++I+EA G ++RF +I  +   AP  
Sbjct: 252 GRMIEEGNRVHFTKMGLANGEAARTREVAKGEKAQMIEEAIGRSERFQAIAREAAIAPEA 311

Query: 304 LRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSR------IQTKREIRWYQS 355
            R R+Y+ETM  I    +K+++D+  S  + YLPLNE           ++KR +R   S
Sbjct: 312 ARYRLYMETMGRIFSSPRKIVLDQTASPTVSYLPLNELLGSSSNKTITKSKRSVRLSDS 370


>gi|119386378|ref|YP_917433.1| HflK protein [Paracoccus denitrificans PD1222]
 gi|119376973|gb|ABL71737.1| protease FtsH subunit HflK [Paracoccus denitrificans PD1222]
          Length = 399

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 134/298 (44%), Positives = 198/298 (66%), Gaps = 7/298 (2%)

Query: 46  FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQV 105
           F  S G+  I +L + +  AF S Y V P+ERAVEL FGKP      PGL+   WP+   
Sbjct: 89  FQMSRGTWGIAILAVVAVWAFSSFYTVKPEERAVELLFGKPVG-TGEPGLNFAPWPVVTA 147

Query: 106 EIVKVI-ERQQKIG-GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           E+V+V  ER  +IG GR+  +  +SGL+LT DQNIV + + V++ ++DP  +LFNL +P 
Sbjct: 148 EVVQVSGERTTEIGTGRAGPM--DSGLMLTRDQNIVDMAYQVVWNISDPEKFLFNLADPD 205

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           +T++ VSESAMR++V R     I    R  IA +++  +Q T++ Y++GI +  ++++ A
Sbjct: 206 DTIRAVSESAMRDIVARSELAPILNRDRGAIADDLKLAVQNTLNDYEAGINVLRVNLDRA 265

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PPREV D+F EVQ A+Q+ DR  +E++ Y+NRVL SARGEA+ + E + AY+   +  A
Sbjct: 266 DPPREVIDSFREVQAAQQERDRLEKEADAYANRVLASARGEAAAVIERAEAYRAEAVNTA 325

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
           +GEA RF S+Y +YV AP + R+R+YLETME +L    KVI+D +  Q V+PYLPL++
Sbjct: 326 EGEAARFNSVYDEYVKAPEVTRRRMYLETMEKVLGGVNKVILDGEAGQGVVPYLPLDQ 383


>gi|319408802|emb|CBI82459.1| ftsH protease activity modulator HflK [Bartonella schoenbuchensis
           R1]
          Length = 380

 Score =  245 bits (626), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 128/297 (43%), Positives = 192/297 (64%), Gaps = 4/297 (1%)

Query: 47  FKSYG--SVYIILLLIGS-FCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPID 103
            K +G   ++I+L L+   F  FQS+YIV  +E+AVELRFG PK  +   GLH  FWPI+
Sbjct: 56  LKQFGESGIFIVLFLLAVLFWLFQSVYIVQQNEQAVELRFGVPKAGIVGDGLHFHFWPIE 115

Query: 104 QVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
               V + E+   IGG+S     + GL+L+ DQNIV ++FS+ Y +++P  +LFN+ +  
Sbjct: 116 TYMKVPLTEKTIAIGGQSNQTQQSEGLMLSSDQNIVNVNFSIYYRISNPSQFLFNVSDQE 175

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
            T++QV+ESAMREV+G R   D+ R +++++A +V+ +IQ T + Y+ G+ IN +SI +A
Sbjct: 176 GTVRQVAESAMREVIGSRPVDDVLRDKKEEVADDVKKIIQLTANKYQLGVEINRVSISEA 235

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
           +PP +VA AF+ VQ+AEQ+  R +EE N+     +G A GEAS  RE +   K R+I+EA
Sbjct: 236 APPTKVAAAFNSVQQAEQERGRMIEEGNRVRFTKIGLANGEASRTREIAKGEKARMIEEA 295

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
            G A  F +I  +   AP  +R R Y+ETM  IL    K+++++  S V+PYLPLNE
Sbjct: 296 TGRAQHFQAIAREAAIAPEAVRYRFYMETMGRILSSPNKLVLNQTDSPVIPYLPLNE 352


>gi|146276934|ref|YP_001167093.1| HflK protein [Rhodobacter sphaeroides ATCC 17025]
 gi|145555175|gb|ABP69788.1| HflK protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 394

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 130/302 (43%), Positives = 193/302 (63%), Gaps = 11/302 (3%)

Query: 45  PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQ 104
           P F   G     L L+G + AF S+Y V P+ER+VEL  G+  +D+  PGL+   WP+  
Sbjct: 79  PLFTRQGLALGALALVGVW-AFMSLYTVRPEERSVELFLGE-FSDIGNPGLNFAPWPVVT 136

Query: 105 VEIVKVI-ERQQKIG-GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENP 162
            E+V+V  ER   IG GR     +++GL+LT DQNIV + F V++ ++DP  +LFNL +P
Sbjct: 137 AEVVQVTGERTTDIGTGRGGD--TDNGLMLTRDQNIVDIEFQVVWNISDPAQFLFNLADP 194

Query: 163 GETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIED 222
            +T++ VSESAMR+++ R     I    R  IA ++   +Q T+D Y++GI +  ++ + 
Sbjct: 195 ADTIRAVSESAMRDIIARSELSPILNRDRGIIASDLLAAVQTTLDSYQAGINVVRVNFDK 254

Query: 223 ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQE 282
           A PP+EV D+F EVQ A+Q+ DR  +E++ Y+NRV  +ARGEA+ + E +  Y+  ++  
Sbjct: 255 ADPPQEVIDSFREVQAAQQERDRLEKEADAYANRVTAAARGEAARLTEQAEGYRAEVVNN 314

Query: 283 AQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-----KKQSVMPYLPL 337
           A+GEA RF+SIY +YV AP + R+R+YLETME +L    KVI+D         V+PYLPL
Sbjct: 315 AEGEASRFISIYDEYVKAPDVTRRRLYLETMEKVLGSMDKVILDGIDGQGGSGVVPYLPL 374

Query: 338 NE 339
           NE
Sbjct: 375 NE 376


>gi|49475830|ref|YP_033871.1| protease subunit hflK [Bartonella henselae str. Houston-1]
 gi|49238638|emb|CAF27882.1| Protease subunit hflK [Bartonella henselae str. Houston-1]
          Length = 381

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 128/311 (41%), Positives = 196/311 (63%), Gaps = 4/311 (1%)

Query: 30  VEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKND 89
           ++ I+R  +D+F     F   G   ++ L    F  +QS+YIV  +E+AVELRFG PK +
Sbjct: 45  IDDILRKGQDQFKQ---FGKNGLFVLLFLFAVLFWLYQSLYIVQQNEQAVELRFGVPKTE 101

Query: 90  VFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVV 149
               GLH  FWPI+    V + E+   IGG+      + GL+L+ DQNIV ++FS+ Y +
Sbjct: 102 TIGDGLHFHFWPIETYMKVPLTEKTIAIGGQPGQRQQSEGLMLSSDQNIVNVNFSIYYRI 161

Query: 150 TDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYY 209
           + P  +LFN+ +   T++QV+ESAMREV+G R   D+ R +++++A +VR +IQ T+D Y
Sbjct: 162 SHPGQFLFNVNDQEGTVRQVAESAMREVIGSRPVDDVLRDKKEEVASDVRKIIQLTVDKY 221

Query: 210 KSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIR 269
           + G+ I+ +SI +A+PP +VA AF+ VQ+AEQ+  R +EE N+     +G A GEAS  R
Sbjct: 222 QLGVEISRVSISEAAPPTKVAAAFNSVQQAEQERGRMIEEGNRVRFNKIGLANGEASRTR 281

Query: 270 ESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ 329
           E +   K R+++EA G A+RF +I  +   +P  +R R+Y+ETM  I     K+I+D+  
Sbjct: 282 EIAKGEKARMVEEATGRAERFQAIARESAISPEAVRYRLYMETMGRIFSSPNKLILDQTN 341

Query: 330 S-VMPYLPLNE 339
           S  +PYLPLNE
Sbjct: 342 SPAVPYLPLNE 352


>gi|163868688|ref|YP_001609900.1| ftsH protease activity modulator HflK [Bartonella tribocorum CIP
           105476]
 gi|161018347|emb|CAK01905.1| ftsH protease activity modulator HflK [Bartonella tribocorum CIP
           105476]
          Length = 383

 Score =  242 bits (617), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 195/312 (62%), Gaps = 4/312 (1%)

Query: 29  DVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKN 88
           +++ I+R  +D+F     F   G   + LLL   F  +QS+YIV  +E+AVELRFG PK 
Sbjct: 44  NLDDILRKGQDQFKQ---FSRGGFFVLFLLLAVCFLLYQSLYIVQQNEQAVELRFGVPKE 100

Query: 89  DVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYV 148
            +   GLH  FWPI+    V + E+   IGG       + GL+L+ DQNIV ++FSV Y 
Sbjct: 101 GIIGDGLHFHFWPIETYMKVPLTEKTIAIGGHPGQKQQSEGLMLSSDQNIVNVNFSVYYR 160

Query: 149 VTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDY 208
           ++ P  +LFN+ +   T++QV+ESAMREV+G R   D+ R +++++A +VR + Q T+D 
Sbjct: 161 ISHPGQFLFNVNDQEGTVRQVAESAMREVIGSRPVDDVLRDKKEEVANDVRKITQLTVDK 220

Query: 209 YKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHI 268
           Y+ G+ I+ +SI +A+PP +VA AF+ VQ+AEQ+  R +EE N+     +G A GEAS  
Sbjct: 221 YQLGVEISRVSISEAAPPTKVAAAFNSVQQAEQERGRMIEEGNRVRFTKIGLANGEASRT 280

Query: 269 RESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK 328
           RE +   K ++++EA G A+RF +I  +   +P   R R+Y+ETM  I     K+++D+ 
Sbjct: 281 REIAKGEKAQMVEEATGRAERFQAIAREAAISPEAARYRLYMETMGRIFSSPNKLVLDQI 340

Query: 329 QS-VMPYLPLNE 339
            S  +PYLPLNE
Sbjct: 341 NSPAVPYLPLNE 352


>gi|84500014|ref|ZP_00998280.1| HflK protein [Oceanicola batsensis HTCC2597]
 gi|84391948|gb|EAQ04216.1| HflK protein [Oceanicola batsensis HTCC2597]
          Length = 387

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 122/293 (41%), Positives = 185/293 (63%), Gaps = 3/293 (1%)

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIV 108
           + G++ I LL+  +     S Y V P+E++VEL FG   +    PGL+   WP    E++
Sbjct: 81  TRGTIVIGLLVAFALWLTASFYTVRPEEQSVELFFGD-YSSTGNPGLNFAPWPFVTYEVI 139

Query: 109 KVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
            V   Q +  G   + G ++GL+LTGD+NIV + F V++ + DP  +LFNL +P  T++ 
Sbjct: 140 PVTREQTEDIGVGGNRGGDAGLMLTGDENIVDIDFQVVWNINDPAKFLFNLRDPRMTIRA 199

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
           VSESAMRE++ +     I    R  IA  +R++IQ T+D Y SG+ +  ++ + A PP E
Sbjct: 200 VSESAMREIIAQSELAPILNRDRGAIAGRLRDMIQSTLDSYDSGMNVVRVNFDKADPPAE 259

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V DAF EVQ AEQ+ +    +++ Y+NRVL  ARGEA+ + E +  Y+ R++ EA+GEA 
Sbjct: 260 VIDAFREVQAAEQERETLTNQADAYANRVLAGARGEAAQVLEEAEGYRARVVNEAEGEAS 319

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
           RF ++  +Y  AP + RKR+YLETME +L +  K+IID++  + V+PYLPLNE
Sbjct: 320 RFSAVLTEYTKAPEVTRKRLYLETMEDVLGRVDKIIIDEQTGEGVVPYLPLNE 372


>gi|313575269|emb|CBI71206.1| phydrolase serine protease transmembrane subunit K protein
           [uncultured bacterium]
          Length = 371

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 137/324 (42%), Positives = 198/324 (61%), Gaps = 20/324 (6%)

Query: 29  DVEAIIRYIKDKF-DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVH----PDERAVELRF 83
           ++E I+   +D+F   +P     G  + I+  + +  AF  +  +H       R   +R+
Sbjct: 40  NLEDILNRGRDQFRGGVP-----GGRWAIIGGVLALVAFWGLTRLHDQPAGSRRPAAVRY 94

Query: 84  GKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSAS-----VGSNSGLILTGDQNI 138
            + +      GLH   WPI+ VE       Q +IG  +AS      G++ GL+L+GDQNI
Sbjct: 95  AQAR--TLGSGLHFHLWPIETVERATTTVNQTQIGAANASGQRSNSGASDGLMLSGDQNI 152

Query: 139 VGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEV 198
           V + FSV + + +P  YLFN+ +    ++  +ESAMREVVGRR A DI+   R  I++EV
Sbjct: 153 VNVQFSVFWAINEPVAYLFNVRDQEAMVRYAAESAMREVVGRRPAQDIYSDDRSGISIEV 212

Query: 199 RNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVL 258
            N+ Q  ++ Y  G+ IN I IE+A PP EV DAF+EVQRA QDE R  EE+  Y+N +L
Sbjct: 213 LNITQDILESYGLGVSINQILIENAGPPSEVIDAFNEVQRARQDETRLQEEARSYANTLL 272

Query: 259 GSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILK 318
           G ARG A+ +RE + AY +R++QEA GEA+RF SIY +YVNAP + RKR++LETME +L 
Sbjct: 273 GDARGRAAALREEAAAYTNRVVQEATGEAERFNSIYAEYVNAPEVTRKRLFLETMEQVLG 332

Query: 319 KAKKVIIDK---KQSVMPYLPLNE 339
            ++KV+I+       V+PYLPL E
Sbjct: 333 DSQKVMIESGAGASGVLPYLPLPE 356


>gi|319405982|emb|CBI79614.1| ftsH protease activity modulator HflK [Bartonella sp. AR 15-3]
          Length = 376

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 142/339 (41%), Positives = 208/339 (61%), Gaps = 15/339 (4%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSF 63
           DK  S  +P    GSNG        +++ I R  +D+          G V+IIL  + +F
Sbjct: 22  DKKLSPKKPFGSGGSNGP-------NIDDIFRKGQDQLKQF----GGGGVFIILFFL-AF 69

Query: 64  C--AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRS 121
           C   FQSIYIV  +E+AVELRFG PK  +   GLH  FWPI+    V + E+   IGG+S
Sbjct: 70  CFWCFQSIYIVQQNEQAVELRFGVPKEGIISDGLHFHFWPIETYMKVPLTEKTIAIGGQS 129

Query: 122 ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRR 181
             +    GL+L+ DQNIV ++FSV Y ++ P  +LFN+ +   T++QV+ESAMREV+G R
Sbjct: 130 GQLQQGEGLMLSSDQNIVNVNFSVYYRISSPSQFLFNVNDQEGTVRQVAESAMREVIGSR 189

Query: 182 FAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQ 241
              D+ R +++++A +V+ +IQ T D Y+ G+ IN +SI +A+PP +VA AF+ VQ+AEQ
Sbjct: 190 PVDDVLRDKKEEVADDVKKIIQLTSDKYQLGVEINRVSISEAAPPTKVAAAFNSVQQAEQ 249

Query: 242 DEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAP 301
           +  R +EE N+     +G A GEAS  RE +   K ++I+EA G ++RF +I  +   AP
Sbjct: 250 ERGRMIEEGNRVHFTKMGLANGEASRTREVAKGEKAQMIEEAIGRSERFQAIAREAAIAP 309

Query: 302 TLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
              R R+Y+ETM  IL   +KV++D+  S  + YLPLNE
Sbjct: 310 EAARYRLYMETMGRILSSPRKVVLDQTASPTVSYLPLNE 348


>gi|260575473|ref|ZP_05843472.1| HflK protein [Rhodobacter sp. SW2]
 gi|259022393|gb|EEW25690.1| HflK protein [Rhodobacter sp. SW2]
          Length = 399

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 124/283 (43%), Positives = 186/283 (65%), Gaps = 11/283 (3%)

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI-ERQQKIG-GRSA 122
           +F S Y V P+ER+VEL  GK  + V  PGL+   WP  + EIV+V  ERQ  IG GR+ 
Sbjct: 105 SFASFYTVKPEERSVELFLGK-FSAVGNPGLNFAAWPFTKAEIVQVTGERQTDIGTGRNG 163

Query: 123 SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRF 182
              +++GL+LT DQNIV + F V++ V+DP  +LFNL +P +T++ V+ESAMR+++ R  
Sbjct: 164 D--TDTGLMLTRDQNIVDIEFQVVWNVSDPAKFLFNLADPTDTIRAVAESAMRDIIARSE 221

Query: 183 AVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQD 242
              +    R  IA ++R  IQ T+D Y+SGI +  ++ + A PPREV D+F EVQ A+Q+
Sbjct: 222 LSPVLNRDRGVIASDLRTAIQGTLDSYQSGIAVVRVNFDRADPPREVIDSFREVQAAQQE 281

Query: 243 EDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPT 302
            D+  ++++ Y+N+V   ARGEA+ + E + AY+  ++  A+GEA RF ++Y +Y+ AP 
Sbjct: 282 RDKLEKQADAYANQVTAGARGEAARLTEQAEAYRAEVVNNAEGEASRFEAVYEEYIKAPE 341

Query: 303 LLRKRIYLETMEGILKKAKKVIID------KKQSVMPYLPLNE 339
           + R+R+YLETME +L    KVI+D        Q V+P+LPLNE
Sbjct: 342 VTRRRMYLETMEKVLGDMNKVILDGVSGGAAGQGVVPFLPLNE 384


>gi|49474434|ref|YP_032476.1| protease subunit hflK [Bartonella quintana str. Toulouse]
 gi|49239938|emb|CAF26340.1| Protease subunit hflK [Bartonella quintana str. Toulouse]
          Length = 381

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 131/312 (41%), Positives = 199/312 (63%), Gaps = 4/312 (1%)

Query: 29  DVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKN 88
           +++ I+R  +D+F     F   G   + LLL   F  +QS YIV  +E+AVELRFG PK 
Sbjct: 44  NIDDILRKGQDQFKQ---FGRNGLFVLFLLLAVFFWLYQSFYIVQQNEQAVELRFGVPKT 100

Query: 89  DVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYV 148
            +   GLH  FWPI+    V + E+   IGG+S     + GL+L+ DQNIV ++FSV Y 
Sbjct: 101 GIIGDGLHFHFWPIETYMKVPLTEKTIAIGGQSGQRQQSEGLMLSSDQNIVNINFSVYYR 160

Query: 149 VTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDY 208
           ++ P  +LFN+ +   T++QV+ESAMREV+G R   D+ R +++++A +VR +IQ T+D 
Sbjct: 161 ISHPGQFLFNVNDQEGTVRQVAESAMREVIGSRPVDDVLRDKKEEVANDVRKIIQLTVDK 220

Query: 209 YKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHI 268
           Y+ G+ I+ +SI +A+PP +VA AF+ VQ+AEQ+  R +EE N+     +G A GEAS  
Sbjct: 221 YQLGVEISRVSISEAAPPTKVAAAFNSVQQAEQERGRMIEEGNRVRFNKIGLANGEASRT 280

Query: 269 RESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK 328
           RE +   K ++I+EA G A+RF +I  +   +P   R R+Y+ET+  IL    K+I++++
Sbjct: 281 REIAKGEKAQMIEEATGRAERFQAIAREAAISPEAARYRLYMETIGRILSSPNKLILNQE 340

Query: 329 QS-VMPYLPLNE 339
            S  +PYLPLNE
Sbjct: 341 NSPAVPYLPLNE 352


>gi|319899131|ref|YP_004159224.1| ftsH protease activity modulator HflK [Bartonella clarridgeiae 73]
 gi|319403095|emb|CBI76653.1| ftsH protease activity modulator HflK [Bartonella clarridgeiae 73]
          Length = 377

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 124/277 (44%), Positives = 182/277 (65%), Gaps = 1/277 (0%)

Query: 67  QSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGS 126
           QSIYIV  +E+AVELRFG PK  +   GLH  FWPI+    V + E+   IGG+S  +  
Sbjct: 75  QSIYIVQQNEQAVELRFGIPKEGIISDGLHFHFWPIETYMKVPLTEKNIAIGGQSGQLQQ 134

Query: 127 NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDI 186
           + GL+L+ DQNIV ++FSV Y ++ P  +LFN+ +   T++QV+ESAMREV+G R   D+
Sbjct: 135 SEGLMLSSDQNIVNVNFSVYYRISSPSQFLFNVNDQEGTVRQVAESAMREVIGSRPVDDV 194

Query: 187 FRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRF 246
            R +++++A +V+ +IQ T D Y+ G+ IN +SI +A+PP +VA AF+ VQ+AEQ+  R 
Sbjct: 195 LRDKKEEVADDVKKIIQLTADKYQLGVEINRVSISEAAPPTKVAAAFNSVQQAEQERGRM 254

Query: 247 VEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRK 306
           +EE N+     +G A GEAS  RE +   K ++I+EA G ++RF +I  +   AP   R 
Sbjct: 255 IEEGNRVHFTKMGLANGEASRTREIAKGEKAQMIEEATGRSERFRAIAREAAIAPEAARY 314

Query: 307 RIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFS 342
           R+Y+ETM  IL   +KV++D+  S  + YLPLNE  S
Sbjct: 315 RLYMETMGRILSSPRKVVLDQTASPAVSYLPLNELLS 351


>gi|56696215|ref|YP_166572.1| HflK protein [Ruegeria pomeroyi DSS-3]
 gi|56677952|gb|AAV94618.1| HflK protein [Ruegeria pomeroyi DSS-3]
          Length = 383

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 128/300 (42%), Positives = 190/300 (63%), Gaps = 9/300 (3%)

Query: 45  PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQ 104
           P F + G+V + L++        S Y V P+E++VEL  G+  + +   GL+   WP+  
Sbjct: 78  PAF-TRGTVGLGLVVALGLWGMASFYTVKPEEQSVELFLGE-FSGIGTEGLNFAPWPLVT 135

Query: 105 VEIVKV-IERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
            E++ V +E+ + IG  S   GS++GL+LTGD+NIV + F V++ +TDP  +LFNL +P 
Sbjct: 136 AEVIPVKVEQTETIG--SGGRGSDAGLMLTGDENIVDIDFQVVWNITDPANFLFNLRDPR 193

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           +T++ VSESAMRE++ +     I    R  IA  +++LIQ T+D Y SGI I  ++ + A
Sbjct: 194 QTIQAVSESAMREIIAQSELAPILNRDRAVIAERLKDLIQLTLDSYNSGINIVRVNFDGA 253

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP  V DAF EVQ A Q+ DR  ++++ Y+N VL  ARGEA+ + E +  Y+ R++ EA
Sbjct: 254 DPPEPVKDAFREVQSAGQERDRLEKQADAYANTVLAGARGEAAQVLEEAEGYRARVVNEA 313

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK----QSVMPYLPLNE 339
           QGEA RFL++  +Y  AP + RKR+YLE ME +L    KVI+D +    Q V+PYLPLNE
Sbjct: 314 QGEASRFLAVLEEYSKAPDVTRKRLYLERMEQVLGDIDKVILDGEGSGSQGVVPYLPLNE 373


>gi|77463928|ref|YP_353432.1| HflK protein [Rhodobacter sphaeroides 2.4.1]
 gi|77388346|gb|ABA79531.1| Probable HflK protein [Rhodobacter sphaeroides 2.4.1]
          Length = 393

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 128/301 (42%), Positives = 188/301 (62%), Gaps = 11/301 (3%)

Query: 46  FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQV 105
            F   G     L  +G + AF S Y V P+ER+VEL  G+  + +  PGL+   WP    
Sbjct: 78  LFTRQGLALGALAAVGVW-AFMSFYTVRPEERSVELFLGE-FSAIGNPGLNFAPWPFVTA 135

Query: 106 EIVKVI-ERQQKIG-GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           E+V+V  ER   IG GR     ++SGL+LT DQNIV + F V++ ++DP  +LFNL +P 
Sbjct: 136 EVVQVTGERTTDIGTGRGGD--TDSGLMLTRDQNIVDIEFQVVWNISDPAQFLFNLADPA 193

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           +T++ VSESAMR+++ R     I    R  IA ++   +Q T+D Y++GI +  ++ + A
Sbjct: 194 DTIRAVSESAMRDIIARSELSPILNRDRGIIASDLLAAVQTTLDSYQAGINVVRVNFDKA 253

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP+EV D+F EVQ A+Q+ DR  +E++ Y+NRV  +ARGEA+ + E +  Y+  ++  A
Sbjct: 254 DPPQEVIDSFREVQAAQQERDRLEKEADAYANRVTAAARGEAARLTEQAEGYRAEVVNNA 313

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-----SVMPYLPLN 338
           +GEA RF S+Y +YV AP + R+R+YLETME +L    KVI+D  Q      V+PYLPLN
Sbjct: 314 EGEASRFNSVYEEYVKAPDVTRRRMYLETMEKVLGSMDKVILDGVQGEGGSGVVPYLPLN 373

Query: 339 E 339
           E
Sbjct: 374 E 374


>gi|159045276|ref|YP_001534070.1| Protein HflK [Dinoroseobacter shibae DFL 12]
 gi|157913036|gb|ABV94469.1| Protein HflK [Dinoroseobacter shibae DFL 12]
          Length = 382

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 124/296 (41%), Positives = 188/296 (63%), Gaps = 6/296 (2%)

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIV 108
           + G+V +  + I     + S Y V P+E++VEL  G+  + V  PGL+   WP+   E++
Sbjct: 79  TKGTVGLAGIAILGLWLYSSFYTVRPEEQSVELFLGE-FSAVGNPGLNFAPWPLVTAEVL 137

Query: 109 KVI-ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
            V  E  ++IG          GL+LT D+NIV + F V++ ++DP  +LFNL +  +T++
Sbjct: 138 PVTRENTEEIGTSRNGARGEDGLMLTTDENIVDIDFDVVWNISDPAAFLFNLRDGQQTVR 197

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
            VSE++MREV+ R     I    R+ IA +V++LIQ T+D Y SGI I  ++++ A PP 
Sbjct: 198 AVSEASMREVIARSELAPILNRDRELIAQQVQDLIQTTLDSYDSGINIVRLNLDRADPPE 257

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
           +V DAF EVQ AEQ+ DR   +++ Y+NRVL  ARGEA+ + E + AY+ +++ EA+GEA
Sbjct: 258 QVIDAFREVQAAEQERDRLERQADAYANRVLAGARGEAAQLLEQAEAYRAQVVNEAEGEA 317

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK----KQSVMPYLPLNE 339
            RF ++  +Y NAP + RKR+YLETME +L    KVI+D+     Q V+PYLP+NE
Sbjct: 318 SRFTAVLAEYQNAPEVTRKRLYLETMERVLGGIDKVILDEGASGGQGVVPYLPINE 373


>gi|126462763|ref|YP_001043877.1| HflK protein [Rhodobacter sphaeroides ATCC 17029]
 gi|221639785|ref|YP_002526047.1| HflK protein [Rhodobacter sphaeroides KD131]
 gi|126104427|gb|ABN77105.1| HflK protein [Rhodobacter sphaeroides ATCC 17029]
 gi|221160566|gb|ACM01546.1| HflK protein precursor [Rhodobacter sphaeroides KD131]
          Length = 393

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 128/301 (42%), Positives = 188/301 (62%), Gaps = 11/301 (3%)

Query: 46  FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQV 105
            F   G     L  +G + AF S Y V P+ER+VEL  G+  + +  PGL+   WP    
Sbjct: 78  LFTRQGLALGALAAVGVW-AFMSFYTVRPEERSVELFLGE-FSAIGNPGLNFAPWPFVTA 135

Query: 106 EIVKVI-ERQQKIG-GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           E+V+V  ER   IG GR     ++SGL+LT DQNIV + F V++ ++DP  +LFNL +P 
Sbjct: 136 EVVQVTGERTTDIGTGRGGD--TDSGLMLTRDQNIVDIEFQVVWNISDPAQFLFNLADPA 193

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           +T++ VSESAMR+++ R     I    R  IA ++   +Q T+D Y++GI +  ++ + A
Sbjct: 194 DTIRAVSESAMRDIIARSELSPILNRDRGIIASDLLAAVQTTLDSYQAGINVVRVNFDKA 253

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP+EV D+F EVQ A+Q+ DR  +E++ Y+NRV  +ARGEA+ + E +  Y+  ++  A
Sbjct: 254 DPPQEVIDSFREVQAAQQERDRLEKEADAYANRVTAAARGEAARLTEQAEGYRAEVVNNA 313

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-----SVMPYLPLN 338
           +GEA RF S+Y +YV AP + R+R+YLETME +L    KVI+D  Q      V+PYLPLN
Sbjct: 314 EGEASRFNSVYEEYVKAPDVTRRRMYLETMEKVLGSMDKVILDGVQGEGGSGVVPYLPLN 373

Query: 339 E 339
           E
Sbjct: 374 E 374


>gi|332558802|ref|ZP_08413124.1| HflK protein precursor [Rhodobacter sphaeroides WS8N]
 gi|332276514|gb|EGJ21829.1| HflK protein precursor [Rhodobacter sphaeroides WS8N]
          Length = 351

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 128/301 (42%), Positives = 188/301 (62%), Gaps = 11/301 (3%)

Query: 46  FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQV 105
            F   G     L  +G + AF S Y V P+ER+VEL  G+  + +  PGL+   WP    
Sbjct: 36  LFTRQGLALGALAAVGVW-AFMSFYTVRPEERSVELFLGE-FSAIGNPGLNFAPWPFVTA 93

Query: 106 EIVKVI-ERQQKIG-GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           E+V+V  ER   IG GR     ++SGL+LT DQNIV + F V++ ++DP  +LFNL +P 
Sbjct: 94  EVVQVTGERTTDIGTGRGGD--TDSGLMLTRDQNIVDIEFQVVWNISDPAQFLFNLADPA 151

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           +T++ VSESAMR+++ R     I    R  IA ++   +Q T+D Y++GI +  ++ + A
Sbjct: 152 DTIRAVSESAMRDIIARSELSPILNRDRGIIASDLLAAVQTTLDSYQAGINVVRVNFDKA 211

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP+EV D+F EVQ A+Q+ DR  +E++ Y+NRV  +ARGEA+ + E +  Y+  ++  A
Sbjct: 212 DPPQEVIDSFREVQAAQQERDRLEKEADAYANRVTAAARGEAARLTEQAEGYRAEVVNNA 271

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-----SVMPYLPLN 338
           +GEA RF S+Y +YV AP + R+R+YLETME +L    KVI+D  Q      V+PYLPLN
Sbjct: 272 EGEASRFNSVYEEYVKAPDVTRRRMYLETMEKVLGSMDKVILDGVQGEGGSGVVPYLPLN 331

Query: 339 E 339
           E
Sbjct: 332 E 332


>gi|83951309|ref|ZP_00960041.1| HflK protein [Roseovarius nubinhibens ISM]
 gi|83836315|gb|EAP75612.1| HflK protein [Roseovarius nubinhibens ISM]
          Length = 381

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 123/298 (41%), Positives = 184/298 (61%), Gaps = 12/298 (4%)

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIV 108
           S G+V + +L +    AF S Y V P+E+ VEL  G+  N    PGL+   WP+   E++
Sbjct: 82  SRGTVGLGVLAVIGLWAFSSFYTVKPEEQGVELFLGEYSNTTG-PGLNFAPWPLVTAEVI 140

Query: 109 KVIERQQK---IGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGET 165
            V   Q +   +G R    GS + L+LTGD+NIV + F V++ + DP  YLFNL++P  T
Sbjct: 141 AVTREQSENIGVGPR----GSEANLMLTGDENIVEIDFQVVWNINDPAKYLFNLQDPQAT 196

Query: 166 LKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASP 225
           ++ VSESAMRE++ +     I    R+ IA  +++LIQ T+D Y SG+ I  ++ + A P
Sbjct: 197 IRAVSESAMREIIAQSELAPILNRDRESIADRLQDLIQLTLDSYDSGVSIIRVNFDKADP 256

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           P +V DAF +VQ A Q+ DR  ++++ Y+ +VL  ARGEA+   E +  Y+ R++ EA+G
Sbjct: 257 PEQVIDAFRDVQAAAQERDRLEKQADAYAAKVLAEARGEAAQTLEVAEGYRARVVNEAEG 316

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK----QSVMPYLPLNE 339
           EA RF ++ G+Y  AP + RKR+YLE ME +L    K+I+D+       V+PYLPLNE
Sbjct: 317 EASRFSAVLGEYEKAPNVTRKRLYLEAMEDVLGGMDKIILDETSEGGSGVVPYLPLNE 374


>gi|254463857|ref|ZP_05077268.1| HflK protein [Rhodobacterales bacterium Y4I]
 gi|206684765|gb|EDZ45247.1| HflK protein [Rhodobacterales bacterium Y4I]
          Length = 381

 Score =  233 bits (594), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 124/301 (41%), Positives = 184/301 (61%), Gaps = 10/301 (3%)

Query: 45  PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQ 104
           P F + G++ +  +       F SIY V P+E++VEL  G+  +    PGL+   WP+  
Sbjct: 78  PLF-TKGTLGLAAVAAVVLWGFASIYTVKPEEQSVELFLGE-YSATGQPGLNFAPWPVVT 135

Query: 105 VEIVKV-IERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
            E++ V +E+ + IG  + S G  +GL+LTGD+NI+ + F V++ ++DP  YLFNL NP 
Sbjct: 136 YEVIPVRVEQTENIG--AGSRGGEAGLMLTGDENIIDVDFQVVWNISDPAKYLFNLANPR 193

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
            T+  VSESAMRE++ +     I    R  I   +  LIQ T+D Y SG+ I  ++ + A
Sbjct: 194 TTINAVSESAMREIIAQSELAPILNRDRGAITARLEELIQTTLDSYNSGVNIVRVNFDGA 253

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP  V DAF EVQ A Q+ DR  ++++ Y+NR L  ARG+A+   E + AY+ +++ EA
Sbjct: 254 DPPEPVKDAFREVQSAGQERDRLEKQADAYANRKLAGARGQAAQTLEEAEAYRAQVVNEA 313

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-----QSVMPYLPLN 338
           QGEA RF ++  +Y  AP + RKR+YLETME +L    K+I+D       Q+V+PYLPLN
Sbjct: 314 QGEASRFSAVLEEYQKAPEVTRKRLYLETMEQVLSGVDKIILDDTTGEGGQAVVPYLPLN 373

Query: 339 E 339
           E
Sbjct: 374 E 374


>gi|254460287|ref|ZP_05073703.1| HflK protein [Rhodobacterales bacterium HTCC2083]
 gi|206676876|gb|EDZ41363.1| HflK protein [Rhodobacteraceae bacterium HTCC2083]
          Length = 381

 Score =  232 bits (592), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 119/295 (40%), Positives = 184/295 (62%), Gaps = 6/295 (2%)

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIV 108
           + G++ + ++         S Y V P+E++VEL  G   +    PGL+   WPI   E++
Sbjct: 79  TRGTIGLGVVAAVVLWGMASFYTVKPEEQSVELFLGA-YSSTGNPGLNFAPWPIVTKEVI 137

Query: 109 KVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
            V   Q +  G  A  GS +GL+LTGD+NIV + F V++ +TDP  +LFNL +P  T++ 
Sbjct: 138 PVTREQTEDIGVGAR-GSEAGLMLTGDENIVDIDFQVVWNITDPAKFLFNLRDPQMTIRA 196

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
           VSESAMRE++ +     I    R  I   +++LIQ T+D Y SG+ +  ++ + A PP++
Sbjct: 197 VSESAMREIIAQSELAPILNRDRASIGDRLKDLIQSTLDSYDSGMNVVRVNFDKADPPQQ 256

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V D+F EVQ AEQ+ DR  ++++ Y+NR++  ARGEA+ + E +  Y+ R++ EA GEA 
Sbjct: 257 VIDSFREVQAAEQERDRLEKQADAYANRIVAEARGEAAQVLEEAEGYRARVVNEATGEAS 316

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK----QSVMPYLPLNE 339
           RF ++  +Y  AP + RKR+YLETME +L +  K+I+D+     Q V+PYLPLNE
Sbjct: 317 RFTAVLAEYEKAPEVTRKRLYLETMEEVLGRVDKIILDENGGGGQGVVPYLPLNE 371


>gi|260433202|ref|ZP_05787173.1| HflK protein [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417030|gb|EEX10289.1| HflK protein [Silicibacter lacuscaerulensis ITI-1157]
          Length = 384

 Score =  231 bits (589), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 186/295 (63%), Gaps = 16/295 (5%)

Query: 58  LLIGSFCA-----FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV-I 111
           +L+G   A     F S Y V P+E++VEL FG+  + +   GL+   WP+   E++ V +
Sbjct: 84  ILLGGVAALVLWGFASAYTVKPEEQSVELLFGR-FSGIGTEGLNFAPWPVVTAEVIPVKV 142

Query: 112 ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSE 171
           E+ + IG  S   G+++GL+LTGD+NIV + F V++ +++P  +LFNL +P ET++ VSE
Sbjct: 143 EQTETIG--SGGRGTDAGLMLTGDENIVDIDFQVVWNISNPADFLFNLRDPRETIRAVSE 200

Query: 172 SAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231
           SAMRE++ +     I    R  IA  +  LIQ T+D Y SGI I  ++ + A PP  V D
Sbjct: 201 SAMREIIAQSDLAPILNRDRAVIAERLEELIQSTLDSYNSGINIVRVNFDGADPPEPVKD 260

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           AF EVQ A Q+ DR  ++++ Y+NRVL  ARGEA+ + E +  Y+ +++ EAQGEA RF 
Sbjct: 261 AFREVQSAGQERDRLEKQADAYANRVLAGARGEAARVLEEAEGYRAQVVNEAQGEASRFS 320

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-------KQSVMPYLPLNE 339
           ++  +Y  AP + RKR+YLE ME IL+   K+I+D+        Q V+PYLPLNE
Sbjct: 321 AVLEEYAKAPDVTRKRLYLERMEQILRDVDKIILDEGAGGAGDGQGVVPYLPLNE 375


>gi|121602393|ref|YP_989206.1| HflK protein [Bartonella bacilliformis KC583]
 gi|120614570|gb|ABM45171.1| HflK protein [Bartonella bacilliformis KC583]
          Length = 380

 Score =  231 bits (588), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 121/285 (42%), Positives = 181/285 (63%), Gaps = 1/285 (0%)

Query: 67  QSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGS 126
           QS+YI+  +E+AVELRFG PK  +   GLH  FWPI+    V + E+   IG  S  +  
Sbjct: 79  QSVYIIQQNEQAVELRFGVPKEGIVSDGLHFHFWPIETYMKVPLTEKTIAIGSSSGQIQQ 138

Query: 127 NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDI 186
           + GL+L+ DQNIV ++FSV Y +++P  +LFN+ +   T++QV+ESAMREV+G R   D+
Sbjct: 139 SEGLMLSSDQNIVNVNFSVYYRISNPSQFLFNVNDQEGTVRQVAESAMREVIGSRPVDDV 198

Query: 187 FRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRF 246
            R +++++A +V+ +IQ T++ Y+ G+ IN +SI +A+PP +VA AF+ VQ+AEQ   R 
Sbjct: 199 LRDKKEEVADDVKKIIQSTVNKYQLGVDINRVSISEAAPPTKVAAAFNFVQQAEQARGRM 258

Query: 247 VEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRK 306
           +EE N+     +G A GEAS  RE +   K ++I+EA G A+RF +I  +   +P   R 
Sbjct: 259 IEEGNRVRFTKIGLANGEASRTREVAKGEKVQMIEEATGRAERFAAIAREAAISPEAARY 318

Query: 307 RIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQTKREI 350
           RIY+ETM  IL    K+++D+  S  + YLPLNE       K  I
Sbjct: 319 RIYMETMGRILSSPNKLVLDQVDSPAVSYLPLNELLRSASEKATI 363


>gi|163737664|ref|ZP_02145081.1| HflK protein [Phaeobacter gallaeciensis BS107]
 gi|161389190|gb|EDQ13542.1| putative protein hflK [Phaeobacter gallaeciensis BS107]
          Length = 384

 Score =  231 bits (588), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 122/295 (41%), Positives = 182/295 (61%), Gaps = 5/295 (1%)

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIV 108
           + G++ +  L    F AF S Y V P+E++VEL  G+  +    PGL+   WP+   EI+
Sbjct: 84  TKGTLALGALAAVGFWAFASFYTVKPEEQSVELFLGE-YSATGQPGLNFAPWPLVTKEIL 142

Query: 109 KVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
            V   Q +  G    + S++GL+LTGD+NIV + F V++ + DP  YLFNL +   T++ 
Sbjct: 143 PVTREQTEDIGVGGGISSDAGLMLTGDENIVDIDFQVVWNINDPAKYLFNLRDAQTTIRA 202

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
           VSESAMRE++ +     I    R  IA  +++LIQ T+D Y SGI I  ++ + A PP  
Sbjct: 203 VSESAMREIIAQSELAPILNRDRGAIASRLQDLIQFTLDDYDSGINIIRVNFDKADPPAS 262

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V  AF +VQ AEQ+ DR   E++ Y+N  L  ARG+A+ + E +  Y+ R++ EAQGEA 
Sbjct: 263 VIAAFRDVQAAEQERDRRQNEADAYANNALAEARGQAAELLEKAEGYRARVVNEAQGEAS 322

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK----QSVMPYLPLNE 339
           RF ++  +Y  AP + RKR+Y+ETME +L +  K+I+D++    Q V+PYLPLNE
Sbjct: 323 RFSAVLTEYEKAPDVTRKRLYIETMEKVLSRVDKIILDEQTGEGQGVVPYLPLNE 377


>gi|163740763|ref|ZP_02148156.1| HflK protein [Phaeobacter gallaeciensis 2.10]
 gi|161385754|gb|EDQ10130.1| HflK protein [Phaeobacter gallaeciensis 2.10]
          Length = 384

 Score =  231 bits (588), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 122/295 (41%), Positives = 182/295 (61%), Gaps = 5/295 (1%)

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIV 108
           + G++ +  L    F AF S Y V P+E++VEL  G+  +    PGL+   WP+   EI+
Sbjct: 84  TKGTLALGALAAVGFWAFASFYTVKPEEQSVELFLGE-YSATGQPGLNFAPWPLVTKEIL 142

Query: 109 KVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
            V   Q +  G    + S++GL+LTGD+NIV + F V++ + DP  YLFNL +   T++ 
Sbjct: 143 PVTREQTEDIGVGGGISSDAGLMLTGDENIVDIDFQVVWNINDPAKYLFNLRDARTTIRA 202

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
           VSESAMRE++ +     I    R  IA  +++LIQ T+D Y SGI I  ++ + A PP  
Sbjct: 203 VSESAMREIIAQSELAPILNRDRGAIASRLQDLIQFTLDDYDSGINIIRVNFDKADPPAS 262

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V  AF +VQ AEQ+ DR   E++ Y+N  L  ARG+A+ + E +  Y+ R++ EAQGEA 
Sbjct: 263 VIAAFRDVQAAEQERDRRQNEADAYANNALAEARGQAAELLEKAEGYRARVVNEAQGEAS 322

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK----QSVMPYLPLNE 339
           RF ++  +Y  AP + RKR+Y+ETME +L +  K+I+D++    Q V+PYLPLNE
Sbjct: 323 RFSAVLTEYEKAPDVTRKRLYIETMEKVLSRVDKIILDEQTGEGQGVVPYLPLNE 377


>gi|84687724|ref|ZP_01015597.1| HflK protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84664307|gb|EAQ10798.1| HflK protein [Rhodobacterales bacterium HTCC2654]
          Length = 390

 Score =  230 bits (587), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 126/300 (42%), Positives = 186/300 (62%), Gaps = 12/300 (4%)

Query: 45  PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQ 104
           P F + G++ I++L   +   F S Y V   E++VEL FG+ +  V   GL+   WP+  
Sbjct: 83  PRF-TRGTIGIVVLAAVALWLFASFYRVDTSEQSVELLFGE-RYQVGTEGLNFAPWPVVT 140

Query: 105 VEIVKVI-ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
            EI  V  E  + IG     VG + GL+LTGD+NIV + + V++ + D   ++FNL +P 
Sbjct: 141 KEIYPVTRENTEDIG-----VGLDEGLMLTGDENIVDIDYQVVWNIGDVEQFVFNLADPV 195

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
            T++ VSESAMRE++GR     I    R  IA E+  LIQ T+D Y SG+ I  ++ + A
Sbjct: 196 NTIRAVSESAMREIIGRSSLAPILNRDRGVIAQELEELIQSTLDSYNSGVNIVRVNFDRA 255

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PPREV D+F EVQ AEQ  D    +++ Y+NRV+  ARGEA+   E + AY+ R++ EA
Sbjct: 256 DPPREVIDSFREVQAAEQTRDTLQSQADAYANRVVAEARGEAAQTLEQAEAYRARVVNEA 315

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK----KQSVMPYLPLNE 339
           +GEA RF+++Y +Y  AP + R+R+Y+ET+E +L    K+I+D     +Q V+PYLPLNE
Sbjct: 316 EGEAARFIAVYNEYAKAPEVTRRRLYIETLERVLGDVDKIIMDDAVGGEQGVVPYLPLNE 375


>gi|89069153|ref|ZP_01156526.1| HflK protein [Oceanicola granulosus HTCC2516]
 gi|89045326|gb|EAR51392.1| HflK protein [Oceanicola granulosus HTCC2516]
          Length = 395

 Score =  227 bits (579), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 120/290 (41%), Positives = 181/290 (62%), Gaps = 10/290 (3%)

Query: 58  LLIGSFCAF-----QSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE 112
           L+I +  A       S Y V P+ER+VEL  G+  +    PGL+   WP+   E++ V  
Sbjct: 89  LIIAALAAVGLWLVASFYTVKPEERSVELFLGR-YSATGEPGLNFAPWPVVHAEVIPVT- 146

Query: 113 RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
           R+Q I   ++  G ++GL+LTGD+NIV + F V++ +TDP  YLFNL +P  T++ V+ES
Sbjct: 147 REQTIDIGTSRSGQDAGLMLTGDENIVDIDFQVVWNITDPAQYLFNLADPPATIEAVAES 206

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           AMRE++ +     I    R  IA  +++LIQ T+D Y SG+ I  I+ + A PP  V  +
Sbjct: 207 AMREIIAQSQLAPILNRDRGPIADRLKDLIQTTLDSYDSGVNIVRINFDKADPPEAVIAS 266

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           F  VQ AEQ+ DR    ++ Y+NRVL  ARGEA+ + E +  Y+ R++ EAQGEA RF +
Sbjct: 267 FRRVQDAEQERDRLQNVADAYANRVLAEARGEAAQLLEEAEGYRARVVNEAQGEASRFSA 326

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK---QSVMPYLPLNE 339
           +  +Y +AP + RKR+YLETME +L     +++D++   Q V+PYLPL++
Sbjct: 327 VLQEYASAPEVTRKRLYLETMEQVLGGTDIILLDEQSGSQGVVPYLPLDQ 376


>gi|158424193|ref|YP_001525485.1| HflK protein precursor [Azorhizobium caulinodans ORS 571]
 gi|158331082|dbj|BAF88567.1| HflK protein precursor [Azorhizobium caulinodans ORS 571]
          Length = 376

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 202/345 (58%), Gaps = 20/345 (5%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKF-DLIP-FFKSYGSVYIILLLIGSFCAFQSIYIVHP 74
           G   N  G  P D+E IIR  +D+   ++P    + G++ ++ L++  +      Y V P
Sbjct: 20  GQGPNNSGPTPPDIEDIIRRSQDRLRHMLPGSMGTKGAILLVALVVAGWL-LSGFYRVEP 78

Query: 75  DERAVELRFGKPKNDVFLPGL-HMMFWPIDQVEIVKVIE--------RQQKIGGRSASVG 125
           DE+ V LRFG+    +  PGL + + +PI+ V   KV          R  +   R+A+V 
Sbjct: 79  DEQGVVLRFGR-FVQLTQPGLNYHLPYPIETVLTPKVTRVNRIDIGMRLAEDTRRNATVL 137

Query: 126 SN---SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRF 182
            +     L+LTGD+NIV + F+V +V+ +   YLFN++NP  T+K V+ESAMREVVGR  
Sbjct: 138 RDVPEESLMLTGDENIVDVDFAVFWVINNAEQYLFNVQNPESTIKAVAESAMREVVGRNN 197

Query: 183 AVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQD 242
              I    RQ I   V++L+Q+ +D Y +G+ I  + ++   PP +V DAF +VQ A  D
Sbjct: 198 IQPILTGARQNIETGVQDLMQRVLDSYSAGVKITQVQLQKVDPPAQVIDAFRDVQAARAD 257

Query: 243 EDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPT 302
            +R   E+  Y+NRV+  ARGEA+ I   + AY++R + EA+G+A+RFL IY +YV A  
Sbjct: 258 AERAQNEAQTYANRVVPEARGEAARIENGAQAYRERTVVEARGQAERFLKIYDEYVKAKD 317

Query: 303 LLRKRIYLETMEGILKKAKKVIIDKKQS----VMPYLPLNEAFSR 343
           + R+R+YLETME +L    KVI+D+  S    V+P LPLNE   R
Sbjct: 318 VTRERMYLETMERVLGGTDKVIVDQNASRSGGVVPVLPLNEPARR 362


>gi|114771705|ref|ZP_01449109.1| Probable HflK protein [alpha proteobacterium HTCC2255]
 gi|114547777|gb|EAU50667.1| Probable HflK protein [alpha proteobacterium HTCC2255]
          Length = 384

 Score =  225 bits (574), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 130/302 (43%), Positives = 185/302 (61%), Gaps = 23/302 (7%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFG---KPKNDVFLPGLHMMFWPIDQVEIVKVI 111
           +I + I     F S Y V   E++VEL FG   K  N+    GL+   WP+   +I+ V 
Sbjct: 80  LIFIAIFGLWVFNSFYRVDTSEQSVELFFGEYYKTGNE----GLNFAPWPVVTKQILPVT 135

Query: 112 -ERQQKIG-GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
            E  + IG GR A   ++ GL+LTGD+NIV + F V++ +TD + +LFNL++P ET++ V
Sbjct: 136 RENSEDIGVGRGAR--ADEGLMLTGDENIVDIDFQVVWNITDAQQFLFNLQDPKETIRAV 193

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKS---------GILINTISI 220
           SESAMRE++ R     I    R  I  E++ LIQ T+D Y S         GI I  +++
Sbjct: 194 SESAMREIIARSNLSPILNKDRGAITAELKKLIQDTLDIYGSDSDGNVTGSGINIIRVNL 253

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
             A+PPREV DAF EVQ AEQ  D   ++++ YSNRV+  ARG+A+ + E +  Y+ + I
Sbjct: 254 LGANPPREVIDAFREVQAAEQTRDTLEKQADAYSNRVVAEARGKAAQLMEQAEGYRAQTI 313

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK---QSVMPYLPL 337
            EA+GEA RF+S+Y +Y  AP + RKR+YLET+E +     KV+ID+    Q V+PYLPL
Sbjct: 314 NEAEGEASRFVSVYQEYAKAPEVTRKRLYLETIEKVYGSVNKVVIDESSSGQGVVPYLPL 373

Query: 338 NE 339
           NE
Sbjct: 374 NE 375


>gi|255263826|ref|ZP_05343168.1| HflK protein [Thalassiobium sp. R2A62]
 gi|255106161|gb|EET48835.1| HflK protein [Thalassiobium sp. R2A62]
          Length = 385

 Score =  224 bits (572), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 117/281 (41%), Positives = 175/281 (62%), Gaps = 6/281 (2%)

Query: 63  FCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSA 122
                S Y V P+E++VEL  G+  + V  PGL+   WP+   E++ V  R+Q I    +
Sbjct: 94  LWGMASFYTVRPEEKSVELFLGE-FSSVGEPGLNFAPWPVVTAEVIPVT-REQTIDIGVS 151

Query: 123 SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRF 182
             GS++GL+LTGD+NIV + F V++ +T P  YLFNL NP  T++ VSESAMRE++ +  
Sbjct: 152 RAGSDAGLMLTGDENIVDIDFQVVWNITQPEQYLFNLANPPLTIEAVSESAMREIIAQSE 211

Query: 183 AVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQD 242
              I    R  I+  +++LIQ T+D Y SG+ I  ++ + A PP  V  +F  VQ AEQ+
Sbjct: 212 LAPILNRDRGAISDRLQDLIQSTLDSYDSGVNIIRVNFDKADPPAPVIASFRAVQDAEQE 271

Query: 243 EDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPT 302
            DR    ++ Y+NRV+  ARGEA+ + E + AY+  ++ EA+GEA RF ++ G+Y  AP 
Sbjct: 272 RDRLQNVADAYANRVVAEARGEAAQMLEQAEAYRASVVNEAEGEASRFTAVLGEYEKAPE 331

Query: 303 LLRKRIYLETMEGILKKAKKVII----DKKQSVMPYLPLNE 339
           + RKR+YLETME +L +   +++    D  Q V+PYLPLN+
Sbjct: 332 VTRKRLYLETMERVLGRVNMIVLEESGDGGQGVVPYLPLND 372


>gi|86136610|ref|ZP_01055189.1| HflK protein [Roseobacter sp. MED193]
 gi|85827484|gb|EAQ47680.1| HflK protein [Roseobacter sp. MED193]
          Length = 387

 Score =  224 bits (572), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 127/303 (41%), Positives = 183/303 (60%), Gaps = 14/303 (4%)

Query: 45  PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQ 104
           P F + G+V I  ++   F   QS Y V P+E++VEL  G+   D   PGL+   WP+  
Sbjct: 83  PLF-TKGTVAIAAVVGVLFWGSQSFYSVKPEEQSVELFLGE-YMDTGNPGLNFAPWPLVT 140

Query: 105 VEIVKVIERQQK---IGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
            EI+ V   Q +   +GG     GS++GL+LTGD+NIV + F V++ + DP  YLFNL +
Sbjct: 141 KEILPVTREQTEDIGVGG----AGSDAGLMLTGDENIVDIDFQVVWNINDPAKYLFNLRD 196

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
              T++ VSESAMRE++ +     I    R  IA  ++ LIQ T+D Y SGI I  ++ +
Sbjct: 197 ARATIRAVSESAMREIIAQSELAPILNRDRGSIASRLQELIQSTLDDYDSGIDIIRVNFD 256

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
            A PP  V  AF +VQ AEQ+ D+   E++ Y+N  L  ARG+A+ + E +  Y+ +++ 
Sbjct: 257 KADPPASVIAAFLDVQAAEQERDQRQNEADAYANNALAQARGQAAELLERAEGYRAQVVN 316

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-----QSVMPYLP 336
           EAQGEA RF ++  +Y  AP + RKR+YLETME +L    KVI+D+      Q V+PYLP
Sbjct: 317 EAQGEASRFSAVLTEYQKAPEVTRKRLYLETMEQVLGNVNKVILDQSTGEGGQGVVPYLP 376

Query: 337 LNE 339
           LNE
Sbjct: 377 LNE 379


>gi|126729287|ref|ZP_01745101.1| Probable HflK protein [Sagittula stellata E-37]
 gi|126710277|gb|EBA09329.1| Probable HflK protein [Sagittula stellata E-37]
          Length = 387

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 127/301 (42%), Positives = 181/301 (60%), Gaps = 15/301 (4%)

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIV 108
           + G+V + +L++    AF S Y V P+E++VEL  GK  +    PGL+   WP+   E V
Sbjct: 79  TRGTVALGVLVLAGLWAFSSFYTVKPEEQSVELFLGK-YSSTGNPGLNFAPWPLVTYEKV 137

Query: 109 KVI-ERQQKIG-GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
            V  ER + IG GR    G + GL+LT D NIV + F V++ V DP   LFN+ +P  T+
Sbjct: 138 NVTSERTETIGSGR----GGSDGLMLTTDANIVDIDFQVVWNVADPAKLLFNIRDPELTV 193

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
           + VSES MRE++       I    R  IA    + IQ T+D Y+SGI I  +++ +A PP
Sbjct: 194 QAVSESTMREIIAASNLAPILNRDRGLIADTAFDNIQMTLDEYESGIRIVRVNLREADPP 253

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
           REV DAF EVQ AEQ+ DR   +++ Y+NRV+  ARG+A+  RE +  Y+ R++ +A GE
Sbjct: 254 REVIDAFREVQAAEQERDRLERQADAYANRVVAEARGQAAQTREEAEGYRARVVNDALGE 313

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--------QSVMPYLPLN 338
           A RF S+  +Y  AP + R+R+YLETME +L    K+I+D+           V+PYLPLN
Sbjct: 314 AARFTSVQQEYAQAPDVTRRRLYLETMEKVLGDVDKMILDESIAGGGQSGSGVVPYLPLN 373

Query: 339 E 339
           E
Sbjct: 374 E 374


>gi|260426460|ref|ZP_05780439.1| HflK protein [Citreicella sp. SE45]
 gi|260420952|gb|EEX14203.1| HflK protein [Citreicella sp. SE45]
          Length = 383

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 125/298 (41%), Positives = 178/298 (59%), Gaps = 13/298 (4%)

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIV 108
           + G+V I  L+      + S Y V P+E++VEL  GK  +    PGL+   WP    E+V
Sbjct: 81  TKGTVAIAALVAVGLWGYMSFYTVKPEEQSVELFLGK-YSSTGNPGLNFAPWPFVSAEVV 139

Query: 109 KVI-ERQQKIG-GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
            V  ER + IG GR A      GL+LT D NIV + F V++ ++DP   LFN+ +P  T+
Sbjct: 140 NVTSERTETIGAGRDAD-----GLMLTTDANIVDIEFQVVWNISDPAKLLFNIRDPQLTV 194

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
           + VSE+ MRE++       I    R  IA      IQ T+D Y+SGI I  I+++ A PP
Sbjct: 195 QAVSEAVMREIIAASNLAPILNRDRGIIADTALEQIQATLDEYESGITIVRINLDTADPP 254

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
           REV DAF EVQ AEQ+ DR   +++ Y+NRV+  ARG+A+ IRE S  Y+ +++ +A GE
Sbjct: 255 REVIDAFREVQAAEQERDRLERQADAYANRVVAEARGDAAQIREQSEGYRAQVVNDALGE 314

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-----VMPYLPLNE 339
           A RF ++  +Y  AP + R+R+YLETME +L    K I+D+  +     V+PYLPLNE
Sbjct: 315 ASRFTAVLEEYAKAPEVTRRRLYLETMERVLGDVDKTILDEALTGSDGGVVPYLPLNE 372


>gi|259415712|ref|ZP_05739632.1| HflK protein [Silicibacter sp. TrichCH4B]
 gi|259347151|gb|EEW58928.1| HflK protein [Silicibacter sp. TrichCH4B]
          Length = 386

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 118/294 (40%), Positives = 185/294 (62%), Gaps = 15/294 (5%)

Query: 58  LLIGSFCA-----FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV-I 111
           L++G+  A     + S Y V  +E++VEL  G+  + V  PGL+   WP+   E+V V +
Sbjct: 88  LMLGAVAAVFLWGYNSFYTVKTEEKSVELFLGE-FSSVGNPGLNFAPWPVVTYEVVPVSV 146

Query: 112 ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSE 171
           E+ + IG  + + GS++GL+LTGD+NI+ + F V++ + +P  +LFNL +P  T++ VSE
Sbjct: 147 EQTESIG--AGARGSDAGLMLTGDENIIDVDFQVVWNINEPDKFLFNLRDPKATIQAVSE 204

Query: 172 SAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231
           SAMRE++ +     I    R  I+  +  LIQ T+D Y +G+ I  ++ + A PP  V D
Sbjct: 205 SAMREIIAQSQLAPILNRDRGIISQRLEELIQSTLDSYDAGVNIVRVNFDGADPPEPVKD 264

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           AF +VQ A Q+ DR  ++++ Y+NR L SARG+A+   E + AY+ +++ +AQGEA RF 
Sbjct: 265 AFRDVQSAGQERDRLEKQADAYANRKLASARGQAAQTLEEAEAYRAQVVNQAQGEASRFT 324

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK------QSVMPYLPLNE 339
           ++  +Y  AP + RKR+YLETME +L +  K+I+D        Q V+PYLPLNE
Sbjct: 325 AVLSEYEKAPEVTRKRLYLETMEDVLSRVDKIILDDNAGGENGQGVVPYLPLNE 378


>gi|126735317|ref|ZP_01751063.1| HflK protein [Roseobacter sp. CCS2]
 gi|126715872|gb|EBA12737.1| HflK protein [Roseobacter sp. CCS2]
          Length = 380

 Score =  223 bits (569), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 123/296 (41%), Positives = 182/296 (61%), Gaps = 18/296 (6%)

Query: 55  IILLLIGSFCAFQ--SIYIVHPDERAVELRFGKPKNDVFL----PGLHMMFWPIDQVEIV 108
           I L LI +  A+   S Y V P+E++VEL  G      FL    PGL+   WP+   E++
Sbjct: 82  IGLGLIAAVIAWSAASFYTVRPEEKSVELFLGD-----FLAVGEPGLNFAPWPVVTREVL 136

Query: 109 KVI-ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
            V  ER   IG  ++  G ++GL+LTGD+NIV + F V++ +TDP+ YLFNL NP +T++
Sbjct: 137 AVTTERNIDIG--TSRSGMDAGLMLTGDENIVDIDFQVVWNITDPQTYLFNLANPPQTIE 194

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
             +ESAMRE++ +     I    R  IA  +R+LIQ T+D Y SG+ I  ++ + A PP 
Sbjct: 195 ATAESAMREIISQSDLAPILNRDRGAIADRLRDLIQTTLDSYNSGVNIIRVNFDKADPPE 254

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
            V  +F  VQ AEQ+ DR    ++ Y+N+V+  ARG+A+ I E +  Y+ R++ EA GEA
Sbjct: 255 PVIASFRAVQDAEQERDRVQNVADAYANQVVAEARGQAAQILEQAEGYRARVVNEATGEA 314

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK----KQSVMPYLPLNE 339
            RFL++ G+Y  AP + RKR+YLETME +      +++D+     Q V+PYLPLN+
Sbjct: 315 SRFLAVLGEYEQAPEVTRKRLYLETMESVFGGVDIILLDEGNGSGQGVVPYLPLND 370


>gi|99081796|ref|YP_613950.1| HflK protein [Ruegeria sp. TM1040]
 gi|99038076|gb|ABF64688.1| HflK protein [Ruegeria sp. TM1040]
          Length = 387

 Score =  223 bits (569), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 117/294 (39%), Positives = 185/294 (62%), Gaps = 15/294 (5%)

Query: 58  LLIGSFCA-----FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV-I 111
           L++G+  A     + S Y V  +E++VEL  G+  + V  PGL+   WP+   E+V V +
Sbjct: 89  LMLGAVAAVFLWGYNSFYTVKTEEKSVELFLGE-FSAVGNPGLNFAPWPVVTYEVVPVSV 147

Query: 112 ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSE 171
           E+ + IG  + + GS++GL+LTGD+NI+ + F V++ + +P  +LFNL +P  T++ VSE
Sbjct: 148 EQTESIG--AGARGSDAGLMLTGDENIIDVDFQVVWNINEPDKFLFNLRDPKATIQAVSE 205

Query: 172 SAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231
           SAMRE++ +     I    R  I+  +  LIQ T+D Y +G+ I  ++ + A PP  V D
Sbjct: 206 SAMREIIAQSQLAPILNRDRGLISQRLEELIQSTLDSYDAGVNIVRVNFDGADPPEPVKD 265

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           AF EVQ A Q+ DR  ++++ Y+NR L +ARG+A+   E + AY+ +++ +AQGEA RF 
Sbjct: 266 AFREVQSAGQERDRLEKQADAYANRKLAAARGQAAQTLEEAEAYRAQVVNQAQGEASRFT 325

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK------QSVMPYLPLNE 339
           ++  +Y  AP + RKR+YLETME +L +  K+I+D        Q ++PYLPLNE
Sbjct: 326 AVLSEYEKAPEVTRKRLYLETMEDVLSRVDKIILDDNAGSEGGQGIVPYLPLNE 379


>gi|126725618|ref|ZP_01741460.1| HflK protein [Rhodobacterales bacterium HTCC2150]
 gi|126704822|gb|EBA03913.1| HflK protein [Rhodobacterales bacterium HTCC2150]
          Length = 381

 Score =  223 bits (568), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 128/298 (42%), Positives = 182/298 (61%), Gaps = 11/298 (3%)

Query: 48  KSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEI 107
           ++   + I+ +L+    A  S Y V   E++VEL FGK        GL+   WP+ + EI
Sbjct: 80  RAIAGIAIVGVLVAWTAA--SFYRVDTSEQSVELLFGKYVQ-TGEEGLNFAPWPVVKAEI 136

Query: 108 VKVI-ERQQKIG-GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGET 165
             V  E    IG GR     S+ GL+LTGD+NIV + F V++ ++D R YLFNL  P  T
Sbjct: 137 ESVTRENTVDIGVGRGNR--SDEGLMLTGDENIVDIDFQVVWNISDLRSYLFNLAEPQAT 194

Query: 166 LKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASP 225
           +  VSESAMRE++ R     I    R  IA E++ LIQ TMD Y+SG+ I  ++ + A P
Sbjct: 195 ISAVSESAMREIIARSNLAPILNRDRGAIAQELQELIQATMDSYESGVQIVRVNFDKADP 254

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           PREV D+F EVQ AEQ  D   ++++ Y+N  + +ARG A+ + E +  Y+ + + +A+G
Sbjct: 255 PREVIDSFREVQAAEQTRDTLEKQADAYANERVAAARGTAAEVLERAEGYRAQTVNQAEG 314

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK----QSVMPYLPLNE 339
           EA RFL++YG+YV A  + RKR+YLETME +L    KVI+D+     Q V+PYLPLNE
Sbjct: 315 EASRFLAVYGEYVKAEEVTRKRLYLETMERVLGGVDKVILDEAARGGQGVVPYLPLNE 372


>gi|110679209|ref|YP_682216.1| HflK protein, putative [Roseobacter denitrificans OCh 114]
 gi|109455325|gb|ABG31530.1| HflK protein, putative [Roseobacter denitrificans OCh 114]
          Length = 387

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 122/279 (43%), Positives = 171/279 (61%), Gaps = 13/279 (4%)

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI-ERQQKIGGRSASVGS 126
           S+Y V P+E++VEL  G+  +     GL+   WP+   E++ V  E+ + IG R+ S   
Sbjct: 106 SLYTVAPEEQSVELFLGE-YSATGNSGLNFAPWPLVTAEVLPVTREQTEDIGSRTGS--- 161

Query: 127 NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDI 186
             GL+LT D+NI+ + F V++ + DP  +LFNL  P ET++ VSESAMREV+ R     I
Sbjct: 162 --GLMLTTDENIIDIDFQVVWNINDPAKFLFNLAEPQETIRAVSESAMREVIARNELAPI 219

Query: 187 FRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRF 246
               RQ IA E   LIQ T+D Y SG+ I  ++++ A PPREV D+F EVQ AEQ+ DR 
Sbjct: 220 LNRDRQVIADEAEQLIQATLDQYDSGVNIIRLNLDKADPPREVIDSFREVQAAEQERDRL 279

Query: 247 VEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRK 306
             +++ Y+NRV   ARGEA+   E + AY+ + + EAQGEA RF S+  +Y  AP + RK
Sbjct: 280 ERQADAYANRVTAGARGEAASQLEQAEAYRAQQVNEAQGEAARFTSVLEEYAKAPEVTRK 339

Query: 307 RIYLETMEGILKKAKKVI------IDKKQSVMPYLPLNE 339
           R+YLETME +     K+I       +    V+PYLPLNE
Sbjct: 340 RLYLETMEKVFGSVDKIILESGLGGEGGNGVVPYLPLNE 378


>gi|126740006|ref|ZP_01755696.1| HflK protein [Roseobacter sp. SK209-2-6]
 gi|126718825|gb|EBA15537.1| HflK protein [Roseobacter sp. SK209-2-6]
          Length = 386

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 120/299 (40%), Positives = 180/299 (60%), Gaps = 6/299 (2%)

Query: 45  PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQ 104
           P F + G+V I +++        S Y V P+E++VEL  G+  +    PGL+   WP+  
Sbjct: 83  PLF-TKGTVGIGVIIAAVLWGMSSFYTVKPEEQSVELFLGE-YSSTGQPGLNFAPWPLVT 140

Query: 105 VEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
            EI+ V   Q +  G      S++GL+LTGD+NIV + F V++ + DP  +LFNL +   
Sbjct: 141 KEILPVTREQTEDIGVGGGRSSDAGLMLTGDENIVDIDFQVVWNINDPAKFLFNLRDART 200

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           T++ VSESAMRE++ +     I    R  IA  ++ LIQ T+D Y SGI I  ++ + A 
Sbjct: 201 TIRAVSESAMREIIAQSELAPILNRDRGAIASRLQELIQFTLDDYDSGINIIRVNFDKAD 260

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP  V  AF +VQ AEQ+ D+   E++ Y+N  L  ARG+A+ + E +  Y+ +++ EAQ
Sbjct: 261 PPASVIAAFRDVQAAEQERDQRQNEADAYANNALAEARGQAAELLEKAEGYRAQVVNEAQ 320

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK----QSVMPYLPLNE 339
           GEA RF ++  +Y  AP + RKR+YLETME +L +  K+I+D +    Q V+PYLPLNE
Sbjct: 321 GEASRFSAVLEEYSKAPEVTRKRLYLETMEEVLGRVDKIILDDQSGEGQGVVPYLPLNE 379


>gi|149200764|ref|ZP_01877739.1| Probable HflK protein [Roseovarius sp. TM1035]
 gi|149145097|gb|EDM33123.1| Probable HflK protein [Roseovarius sp. TM1035]
          Length = 383

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 123/299 (41%), Positives = 174/299 (58%), Gaps = 15/299 (5%)

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFG---KPKNDVFLPGLHMMFWPIDQVEI 107
           G++ +  L   +   F S+Y V P+E++VEL  G   K  N    PGL+   WPI   EI
Sbjct: 80  GTIGLAALGAVALWVFASVYTVKPEEQSVELFLGAYYKTGN----PGLNFAPWPIVTAEI 135

Query: 108 VKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
           V V   + +  GRS   G   GL+LT D NIV + F V++ ++DP   LFN+ +P  T++
Sbjct: 136 VNVTSERTEDIGRSTG-GREGGLMLTTDANIVDIGFQVVWNISDPAKLLFNIRDPQLTVQ 194

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
            VSES MRE++       I    R  IA      IQ+ +D Y+SGI +  ++++ A PPR
Sbjct: 195 AVSESVMREIIAASNLAPILNRDRGIIADTAMRNIQEALDEYESGIQVVRVNLDKADPPR 254

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
           EV D+F EVQ AEQ+ DR   +++ Y+NR L  ARG+A+ I E S  Y+ R++ EAQG+A
Sbjct: 255 EVIDSFREVQAAEQERDRLQRQADAYANRALAEARGQAAQILEDSEGYRARVVNEAQGDA 314

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-------QSVMPYLPLNE 339
            RF S+  +Y  AP + RKR+Y+ETME +L    K I+D           V+PYLPLNE
Sbjct: 315 SRFTSVLEEYAKAPDVTRKRLYIETMERVLGGIDKTILDSSIVGSEGGNGVVPYLPLNE 373


>gi|163733302|ref|ZP_02140745.1| HflK protein, putative [Roseobacter litoralis Och 149]
 gi|161393090|gb|EDQ17416.1| HflK protein, putative [Roseobacter litoralis Och 149]
          Length = 387

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 123/279 (44%), Positives = 175/279 (62%), Gaps = 13/279 (4%)

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI-ERQQKIGGRSASVGS 126
           S+Y V P+E++VEL  G+  +     GL+   WP+   E++ V  E+ + IG R+     
Sbjct: 106 SLYTVAPEEQSVELFLGE-YSATGNSGLNFAPWPLVTAEVLPVTREQTEDIGART----- 159

Query: 127 NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDI 186
           +SGL+LT D+NI+ + F V++ ++DP  YLFNL  P ET++ VSESAMREV+ R     I
Sbjct: 160 DSGLMLTTDENIIDIDFQVVWNISDPAKYLFNLAEPQETIRAVSESAMREVIARNELAPI 219

Query: 187 FRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRF 246
               RQ +A E   LIQ T++ Y SG+ I  ++++ A PPREV D+F EVQ AEQ+ DR 
Sbjct: 220 LNRDRQVVADEALQLIQSTLNGYDSGVNIIRLNLDKADPPREVIDSFREVQAAEQERDRL 279

Query: 247 VEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRK 306
             +++ Y+NRV   ARGEA+   E + AY+ + + EAQGEA RF S+  +YV AP + RK
Sbjct: 280 ERQADAYANRVTAGARGEAASRLEQAEAYRAQQVNEAQGEAARFTSVLEEYVKAPDVTRK 339

Query: 307 RIYLETMEGILKKAKKVI------IDKKQSVMPYLPLNE 339
           R+YLETME +     K+I       +  Q V+PYLPLNE
Sbjct: 340 RLYLETMERVFGGVDKIILESGLGGEGGQGVVPYLPLNE 378


>gi|254476547|ref|ZP_05089933.1| HflK protein [Ruegeria sp. R11]
 gi|214030790|gb|EEB71625.1| HflK protein [Ruegeria sp. R11]
          Length = 388

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 185/302 (61%), Gaps = 11/302 (3%)

Query: 45  PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQ 104
           P F + G+V +  L   +F A+ S Y V  + R+VEL  G+  +    PGL+   WP   
Sbjct: 84  PMF-TKGTVALGALAAAAFWAYMSFYSVKTESRSVELFLGE-YSQTGQPGLNFAPWPFVT 141

Query: 105 VEIVKV-IERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
            E++ V +E+ + IG  +   GS++GL+LTGD+NI+ + F V++ + DP  +LFNL +  
Sbjct: 142 YEVIPVLVEQTENIG--AGGRGSDAGLMLTGDENIIDVDFQVVWNINDPAKFLFNLRDAR 199

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
            T+  VSESAMRE++ +     I    R  I+  ++ LIQ T+D Y SG+ I  ++ + A
Sbjct: 200 TTIAAVSESAMREIIAQSELAPILNRDRGVISDRLKELIQSTLDSYDSGVNIVRVNFDGA 259

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP  V DAF EVQ A Q+ DR  ++++ Y+NR L +ARG+A+   E + AY+ +++ +A
Sbjct: 260 DPPDPVKDAFREVQSAGQERDRLEKQADAYANRKLAAARGQAAQTLEEAEAYRAQVVNQA 319

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK------QSVMPYLPL 337
           QGEA RF ++  +Y  AP + RKR+YLETME +L +  K+I+D        Q V+PYLPL
Sbjct: 320 QGEASRFTAVLEEYQKAPEVTRKRLYLETMEEVLGRVDKIILDDTAGGEGGQGVVPYLPL 379

Query: 338 NE 339
           NE
Sbjct: 380 NE 381


>gi|254511276|ref|ZP_05123343.1| HflK protein [Rhodobacteraceae bacterium KLH11]
 gi|221534987|gb|EEE37975.1| HflK protein [Rhodobacteraceae bacterium KLH11]
          Length = 381

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 122/300 (40%), Positives = 182/300 (60%), Gaps = 9/300 (3%)

Query: 45  PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQ 104
           P F + G+V I  L+        S+Y V P+E++VEL  G+    V  PGL++  WP   
Sbjct: 76  PLF-TKGTVAIGALVAVGLWLAASVYTVKPEEQSVELFLGE-FYKVGNPGLNVAPWPFVT 133

Query: 105 VEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
            E++ V   Q +  G + S  ++ GL+LTGD+N+V + + V++ ++DP  +LFNL +P +
Sbjct: 134 AEVIPVTREQTEDMGGARS--TDDGLMLTGDENVVDIDYQVVWNISDPAKFLFNLSDPRQ 191

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           T++ VSESAMRE++ +     I    R  IA  ++ LIQ TMD Y SG+ I  ++ + A 
Sbjct: 192 TIRAVSESAMREIIAQSELAPILNRDRGIIAERLQELIQSTMDSYDSGVNIIRVNFDKAD 251

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP+EV  AF +VQ A Q+ DR    ++ Y+NRVL  ARGEA+ + E + AY+ + I  A 
Sbjct: 252 PPQEVIAAFRDVQAAAQERDRLQNVADAYANRVLAEARGEAAQVLEQAEAYRAQQINSAM 311

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-----QSVMPYLPLNE 339
           GEA RF ++  +Y  AP + RKR+YLE ME +L    K+I+D+      Q V+PYLPLNE
Sbjct: 312 GEASRFSAVLEEYSKAPDVTRKRLYLERMEQVLGDVDKIILDENSSGSGQGVVPYLPLNE 371


>gi|84516430|ref|ZP_01003789.1| HflK protein [Loktanella vestfoldensis SKA53]
 gi|84509466|gb|EAQ05924.1| HflK protein [Loktanella vestfoldensis SKA53]
          Length = 382

 Score =  219 bits (558), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 180/294 (61%), Gaps = 8/294 (2%)

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
           G+V + +L + +   F S Y V P+ER+VEL  G        PGL+   WP+   E++ V
Sbjct: 80  GTVGLGILALVALWLFASFYTVRPEERSVELFLGS-YYKTGEPGLNFAPWPVVTREVLAV 138

Query: 111 -IERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
             ER   +G  +++   + GL+LTGD+NIV + F +++ + DP+LYLF+L +P +T+  V
Sbjct: 139 STERTIDVG--ASATRRDPGLMLTGDENIVDIDFQIVWNIIDPQLYLFSLTDPPQTIAAV 196

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           SESAMRE++ +     I    R  IA  +R  IQ ++D + SG+ +  ++ + A PP  V
Sbjct: 197 SESAMREIISQSELAPILNRDRGAIADSLREAIQASLDSFDSGVNVIRVNFDKADPPEPV 256

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
             AF +VQ A Q+ DR    ++ Y+NRV+  ARG+++ + E +  Y+ R++ EA GEA R
Sbjct: 257 IAAFRQVQDARQERDRLQNVADAYANRVVAEARGQSAQVLEQAEGYRARVVNEALGEASR 316

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK----QSVMPYLPLNE 339
           F +I  +YV AP + RKRIYLET+EG+L     +++D+     Q V+PYLPLNE
Sbjct: 317 FSAILAEYVQAPDVTRKRIYLETLEGVLSDVDIIMMDENAAGSQGVVPYLPLNE 370


>gi|114766779|ref|ZP_01445716.1| Probable HflK protein [Pelagibaca bermudensis HTCC2601]
 gi|114541036|gb|EAU44093.1| Probable HflK protein [Roseovarius sp. HTCC2601]
          Length = 384

 Score =  218 bits (555), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 122/295 (41%), Positives = 176/295 (59%), Gaps = 13/295 (4%)

Query: 52  SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI 111
           ++ +  L+      + S Y V P+E++VEL  GK  +    PGL+   WP    E+V V 
Sbjct: 84  TIGLAALVALGLWGYMSFYTVKPEEQSVELFLGK-YSSTGNPGLNFAPWPFVTAEVVNVT 142

Query: 112 -ERQQKIG-GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
            ER + IG GR A      GL+LT D NIV + F V++ ++DP   LFN+ +P  T++ V
Sbjct: 143 SERTETIGAGRDAD-----GLMLTTDANIVDIEFQVVWNISDPSKLLFNIRDPQLTVQAV 197

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           SE+ MRE++       I    R  IA      IQ T+D Y SGI +  I+++ A PPREV
Sbjct: 198 SEAVMREIIAASNLAPILNRDRGIIADTAMEQIQATLDEYDSGINVVRINLDTADPPREV 257

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
            DAF EVQ AEQ+ DR   +++ Y+NRV+  ARG+A+ IRE S  Y+ +++ +A GEA R
Sbjct: 258 IDAFREVQAAEQERDRLERQADAYANRVVAEARGQAAQIREQSEGYRAQVVNQALGEASR 317

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-----KKQSVMPYLPLNE 339
           F ++  +Y  AP + R+R+YLETME +L    K I+D     ++ SV+PYLPLNE
Sbjct: 318 FSAVREEYAKAPEVTRRRLYLETMERVLGDVDKTILDESIAGEQGSVVPYLPLNE 372


>gi|209884418|ref|YP_002288275.1| HflK protein [Oligotropha carboxidovorans OM5]
 gi|209872614|gb|ACI92410.1| HflK protein [Oligotropha carboxidovorans OM5]
          Length = 379

 Score =  218 bits (554), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 134/361 (37%), Positives = 202/361 (55%), Gaps = 29/361 (8%)

Query: 4   DKNNSDWRPTRLS--GSNGNGDGLPPFDVEAIIRYIKDKFD-LIPFFKSYGSVYIILLLI 60
           ++  S W P      GS     G  P D+E ++R  +D+   ++P     G    +L++ 
Sbjct: 5   NQGGSPWGPGPKGPWGSGPQSQGPKPSDLEDLLRRSQDRIQQMMPGGHMSGMGIALLVVA 64

Query: 61  G-SFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGL-HMMFWPIDQVEIVKVIERQQ-KI 117
           G +       + V PDE    LRFGK    V  PGL + M +PI+ V + K +      I
Sbjct: 65  GIAIWGLSGFFRVQPDELGAVLRFGKHVRTV-QPGLNYHMPYPIETVLLPKALRVSTLNI 123

Query: 118 GGRSASVGSNSG-------------LILTGDQNIVGLHFSVLYVVTDPRL--YLFNLENP 162
           G    +V  +SG             L+LTGD+NIV + F+VL+ +    +  +LFN++NP
Sbjct: 124 G---MTVSDDSGRRGRVVRDVPEESLMLTGDENIVDVDFTVLWRIAPDGVGNFLFNIQNP 180

Query: 163 GETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIED 222
             T+K V+ESAMREV+GR     I    R  +   V  L+QKT+D Y +GI+I  + ++ 
Sbjct: 181 EGTVKAVAESAMREVIGRSDIQPILTGARNTVEAAVHQLMQKTLDGYGAGIMIQQVQLQK 240

Query: 223 ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQE 282
             PP++V DAF +VQ A  D +R   E+  Y+NRV+  ARG A+ + + +  YK++ I E
Sbjct: 241 VDPPQQVIDAFRDVQAARADLERLQNEAQTYANRVIPDARGRAAQVLQQAQGYKEQTIAE 300

Query: 283 AQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK----KQSVMPYLPLN 338
           A+G+A RFLS++ +Y  AP + R+RIYLETME +L  A+K+++D      Q V+PYLPLN
Sbjct: 301 AKGQAARFLSVFDEYKKAPDVTRQRIYLETMEHVLGPAEKIVLDSGGAGGQGVVPYLPLN 360

Query: 339 E 339
           E
Sbjct: 361 E 361


>gi|71082717|ref|YP_265436.1| integral membrane proteinase [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71061830|gb|AAZ20833.1| probable integral membrane proteinase [Candidatus Pelagibacter
           ubique HTCC1062]
          Length = 366

 Score =  216 bits (549), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 138/339 (40%), Positives = 198/339 (58%), Gaps = 35/339 (10%)

Query: 27  PFDVEAIIRYIKDKFD-LIPFFKSYGSVYIILLLIGSFCAF----QSIYIVHPDERAVEL 81
           P DV+AIIR I+ K +  +P   S G   IIL+LI    AF      +Y V PDE+ V L
Sbjct: 29  PPDVDAIIRDIQSKINKFLPGGSSSGGKPIILVLI--ILAFVWLASGLYRVLPDEQGVVL 86

Query: 82  RFGKPKNDVFL----PGL--HMMFWPIDQVEIVKVI-----------ERQQKI--GGRSA 122
           RFGK     F+    PGL  H+ F P++ VE  KV            ER+     GG  A
Sbjct: 87  RFGK-----FIKTTQPGLNYHIPF-PVEAVETPKVTKVNRMDIGFRSERESGFSQGGGVA 140

Query: 123 SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRF 182
            +   S L+LTGD+NIV + FSV +++ D   +LF +++P  T+K  +E+AMREVV +  
Sbjct: 141 DIPQES-LMLTGDENIVNIDFSVFWIIKDAGKFLFEVQDPESTVKAAAETAMREVVAKSN 199

Query: 183 AVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQD 242
              I    R +I +E + +IQK +D Y SGI +  +  + A PP +V D+F +VQ A  D
Sbjct: 200 IQSILTEGRAKIEIETQEIIQKILDEYNSGIQVTQVQTQKADPPNQVIDSFRDVQAARAD 259

Query: 243 EDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPT 302
            +R   E+  Y+N V+  ARGEA+ I +++ AYK +++ +A+GEA RF+SIY +Y  A  
Sbjct: 260 MERSKNEAEAYANDVIPRARGEAAKIMQAAEAYKQQVVAQAEGEASRFVSIYEEYAKAKE 319

Query: 303 LLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
           + ++R+YLETME +L    KVII+K     V+PYLPL E
Sbjct: 320 VTQERMYLETMEKVLADIDKVIIEKNAGSGVVPYLPLPE 358


>gi|89055664|ref|YP_511115.1| HflK protein [Jannaschia sp. CCS1]
 gi|88865213|gb|ABD56090.1| protease FtsH subunit HflK [Jannaschia sp. CCS1]
          Length = 394

 Score =  215 bits (548), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 174/287 (60%), Gaps = 5/287 (1%)

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQ 115
           I+L +G++  + S Y V P E+ VEL  G  +  +   G H+  WP+   E++   + + 
Sbjct: 95  IILGLGAWL-YASFYSVQPGEQGVELFLGS-EYRITGDGPHLAPWPLVTAEVLDTDQERT 152

Query: 116 KIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMR 175
           +  G + S  S++GL+LT D+NIV + F V++ + +P  +LFNL +P  T++ V+ESAMR
Sbjct: 153 EAIGNNRSGASDTGLMLTTDENIVDIDFDVVWNINNPADFLFNLRDPENTIRSVAESAMR 212

Query: 176 EVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDE 235
           E++ +     I    RQ I  +   LIQ TMD Y SG+ I  I+++ A PP +V D+F E
Sbjct: 213 EIIAQSELAPILNRDRQLIGDQALALIQTTMDSYGSGVNIIRINLDRADPPTQVIDSFRE 272

Query: 236 VQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYG 295
           VQ A Q+ DR    ++ YSNRV   ARGEA+ + E +  Y+ R++ EA GEA RFL+I  
Sbjct: 273 VQAAAQERDRLERTADAYSNRVTAGARGEAAQLLEEAEGYRARVVNEALGEASRFLAILQ 332

Query: 296 QYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK---QSVMPYLPLNE 339
           +Y  AP + R+R+YLET+E +L     V+ID       V+PYLPLNE
Sbjct: 333 EYEAAPEVTRRRLYLETLERVLGDTDLVVIDGDAGGSGVVPYLPLNE 379


>gi|91762863|ref|ZP_01264828.1| probable integral membrane proteinase [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|91718665|gb|EAS85315.1| probable integral membrane proteinase [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 366

 Score =  215 bits (548), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 137/339 (40%), Positives = 198/339 (58%), Gaps = 35/339 (10%)

Query: 27  PFDVEAIIRYIKDKFD-LIPFFKSYGSVYIILLLIGSFCAF----QSIYIVHPDERAVEL 81
           P D++AIIR I+ K +  +P   S G   IIL+LI    AF      +Y V PDE+ V L
Sbjct: 29  PPDIDAIIRDIQSKINKFLPGGSSSGGKPIILVLI--ILAFVWLASGLYRVLPDEQGVVL 86

Query: 82  RFGKPKNDVFL----PGL--HMMFWPIDQVEIVKVI-----------ERQQKI--GGRSA 122
           RFGK     F+    PGL  H+ F P++ VE  KV            ER+     GG  A
Sbjct: 87  RFGK-----FIKTTQPGLNYHIPF-PVEAVETPKVTKVNRMDIGFRSERESGFSQGGGVA 140

Query: 123 SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRF 182
            +   S L+LTGD+NIV + FSV +++ D   +LF +++P  T+K  +E+AMREVV +  
Sbjct: 141 DIPQES-LMLTGDENIVNIDFSVFWIIKDAGKFLFEVQDPESTVKAAAETAMREVVAKSN 199

Query: 183 AVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQD 242
              I    R +I +E + +IQK +D Y SGI +  +  + A PP +V D+F +VQ A  D
Sbjct: 200 IQSILTEGRAKIEIETQEIIQKILDEYNSGIQVTQVQTQKADPPNQVIDSFRDVQAARAD 259

Query: 243 EDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPT 302
            +R   E+  Y+N V+  ARGEA+ I +++ AYK +++ +A+GEA RF+SIY +Y  A  
Sbjct: 260 MERSKNEAEAYANDVIPRARGEAAKIMQAAEAYKQQVVAQAEGEASRFVSIYEEYAKAKE 319

Query: 303 LLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
           + ++R+YLETME +L    KVII+K     V+PYLPL E
Sbjct: 320 VTQERMYLETMEKVLADIDKVIIEKNAGSGVVPYLPLPE 358


>gi|299131891|ref|ZP_07025086.1| HflK protein [Afipia sp. 1NLS2]
 gi|298592028|gb|EFI52228.1| HflK protein [Afipia sp. 1NLS2]
          Length = 380

 Score =  215 bits (547), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 134/360 (37%), Positives = 201/360 (55%), Gaps = 28/360 (7%)

Query: 4   DKNNSDWRPTRLS--GSNGNGDGLPPFDVEAIIRYIKDKFD-LIPFFKSYGSVYIILLLI 60
           ++  S W P      GS     G  P D+E ++R  +D+   L+P     G    ++++ 
Sbjct: 5   NQGGSPWGPGPKGPWGSGPQSQGPKPSDLEDLLRRGQDRIQQLLPGGHMSGMGIALIVIA 64

Query: 61  G-SFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGL-HMMFWPIDQVEIVKVIERQQ-KI 117
           G +       + V PDE    LRFGK    V  PGL + + +PI+ V + K +      I
Sbjct: 65  GIAIWLLSGFFRVQPDELGAVLRFGKHVRTV-QPGLNYHLPYPIETVLLPKALRVSTLNI 123

Query: 118 GGRSASVGSNSG-------------LILTGDQNIVGLHFSVLYVVTDPRL--YLFNLENP 162
           G    +V  +SG             L+LTGD+NIV + F+VL+ +    +  +LFN++NP
Sbjct: 124 G---MTVSDDSGRRGRVVRDVPEESLMLTGDENIVDVDFTVLWRIAPDGVGKFLFNIQNP 180

Query: 163 GETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIED 222
             T+K V+ESAMREV+GR     I    R  I   V  L+QKT+D Y +GI++  + ++ 
Sbjct: 181 EGTVKAVAESAMREVIGRSDIQPILTGARNTIESAVHQLMQKTLDSYGAGIMVQQVQMQK 240

Query: 223 ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQE 282
             PP++V D+F +VQ A  D +R   E+  Y+NRV+  ARG A+ + + +  YK++ + E
Sbjct: 241 VDPPQQVIDSFRDVQAARADLERLQNEAQTYANRVVPDARGRAAQVLQQAQGYKEQTVAE 300

Query: 283 AQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID---KKQSVMPYLPLNE 339
           A+G+A RFLS+Y +Y  AP + R+RIYLETME +L  A KVI+D     Q V+PYLPLNE
Sbjct: 301 AKGQAARFLSVYDEYKKAPEVTRQRIYLETMEHVLGPADKVILDPGSSGQGVVPYLPLNE 360


>gi|149912785|ref|ZP_01901319.1| HflK protein [Roseobacter sp. AzwK-3b]
 gi|149813191|gb|EDM73017.1| HflK protein [Roseobacter sp. AzwK-3b]
          Length = 388

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 121/294 (41%), Positives = 177/294 (60%), Gaps = 16/294 (5%)

Query: 58  LLIGSFCAF-----QSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI- 111
           +L+G   A       S Y V P+E++VEL  G+    +  PGL+   WP+   E+V V  
Sbjct: 85  ILLGGVIAVVLWGAASFYTVKPEEQSVELFLGEYAA-IGNPGLNFAPWPVMTYEVVNVTS 143

Query: 112 ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSE 171
           ER +++GG  +    N GL+LT D NIV + F V++ ++DP   LFN+ +P  T++ VSE
Sbjct: 144 ERTEEVGGGRSG---NDGLMLTTDANIVDIDFQVVWNISDPAKLLFNMRDPQLTVQAVSE 200

Query: 172 SAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231
           S MRE++       I    R  IA   R  IQ T+D Y SGI I  ++++ A PPREV D
Sbjct: 201 SVMREIIAASTLAPILNRDRGLIADTARENIQATLDDYDSGINIVRVNLDTADPPREVID 260

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           AF EVQ AEQ+ DR   +++ Y+NRVL  ARGE + I E +  Y+ R++ EA GEA RF+
Sbjct: 261 AFREVQAAEQERDRLQRQADAYANRVLAEARGEGARIIEEAEGYRARVVNEAIGEASRFV 320

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK------QSVMPYLPLNE 339
           ++  ++  AP + ++R+YLET+E  L +  K++ID+       Q V+PYLPLNE
Sbjct: 321 AVSQEFNLAPEVTQRRLYLETVERTLGQLDKILIDENSGAGNGQGVVPYLPLNE 374


>gi|262277525|ref|ZP_06055318.1| HflK protein [alpha proteobacterium HIMB114]
 gi|262224628|gb|EEY75087.1| HflK protein [alpha proteobacterium HIMB114]
          Length = 359

 Score =  214 bits (546), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 121/296 (40%), Positives = 186/296 (62%), Gaps = 15/296 (5%)

Query: 57  LLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQ 115
           ++++G + A    Y V PDE+ V LRFGK  N    PGLH    +PI+     KV +  +
Sbjct: 59  IIILGLWLA-SGFYRVLPDEQGVVLRFGKYVNQT-QPGLHYHLPYPIETALTPKVTKVNR 116

Query: 116 -KIGGRSAS-VGSNSG--------LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGET 165
             +G RSAS  G  +G        L+LTGD+NIV + +SV +++ D   +LFN+++P ++
Sbjct: 117 IDVGYRSASDTGRATGVSDVPEESLMLTGDENIVDIDYSVFWIIKDAGKFLFNIQDPEDS 176

Query: 166 LKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASP 225
           +K V+E+AMREV+ +R    I    R Q+ ++ +N++Q+ +D Y SGI I  +  + A P
Sbjct: 177 VKSVAETAMREVIAKRDIQSILTEGRAQVEVDTQNIMQEILDSYDSGITITQVQTQKADP 236

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           P+EV DAF +VQ A+ D++R   E+  Y+N V+  ARGEA+ I + + AYK  ++  ++G
Sbjct: 237 PKEVIDAFRDVQAAKADKERAQNEAEAYANDVIPRARGEAAQILQQAEAYKREVVALSEG 296

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ--SVMPYLPLNE 339
           EA RFL+IY +Y  A T+ ++R+YLETME ++    K+IIDKK    V+PYLPL E
Sbjct: 297 EASRFLAIYNEYRKARTVTQERMYLETMEKVMADINKIIIDKKSGGGVVPYLPLPE 352


>gi|85704113|ref|ZP_01035216.1| HflK protein [Roseovarius sp. 217]
 gi|85671433|gb|EAQ26291.1| HflK protein [Roseovarius sp. 217]
          Length = 382

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 122/300 (40%), Positives = 172/300 (57%), Gaps = 16/300 (5%)

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFG---KPKNDVFLPGLHMMFWPIDQVEI 107
           G+V + +L   +   F S+Y V P+E++VEL  G   K  N    PGL+   WP+   EI
Sbjct: 78  GTVGLAVLGAVALWVFASVYTVKPEEQSVELFLGEYYKTGN----PGLNFAPWPLVTAEI 133

Query: 108 VKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
           V V   + +  GRS       GL+LT D NIV + F V++ ++DP   LFN+ +P  T++
Sbjct: 134 VNVTSERTEDVGRSTGA-REEGLMLTTDANIVDIGFQVVWNISDPGKLLFNIRDPQLTVQ 192

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
            VSES MRE++       I    R  IA      IQ+++D Y SGI I  ++++ A PP 
Sbjct: 193 AVSESVMREIIAASNLAPILNRDRGIIADTAMQNIQESLDEYDSGIRIVRVNLDKADPPN 252

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
           EV D+F EVQ AEQ+ DR   +++ Y+NR L  ARG+A+ I E S  Y+ R++ EAQG+A
Sbjct: 253 EVIDSFREVQAAEQERDRLQRQADAYANRALAEARGQAAQILEDSEGYRARVVNEAQGDA 312

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--------QSVMPYLPLNE 339
            RF S+  +Y  A  + RKR+YLETME +L    K I+D            V+PYLPLNE
Sbjct: 313 SRFTSVLTEYSKAQDVTRKRLYLETMERVLGDIDKTILDSSIVGTEGGGNGVVPYLPLNE 372


>gi|209965275|ref|YP_002298190.1| HflK protein, putative [Rhodospirillum centenum SW]
 gi|209958741|gb|ACI99377.1| HflK protein, putative [Rhodospirillum centenum SW]
          Length = 381

 Score =  214 bits (544), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 124/330 (37%), Positives = 189/330 (57%), Gaps = 17/330 (5%)

Query: 29  DVEAIIRYIKDKFD-LIPF-FKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGK- 85
           D+E ++R  +D+F  ++P  F S   + + + ++        IY V  DE+ V LRFG+ 
Sbjct: 42  DLEDLLRRSQDRFKRMVPGGFGSGKGIALAIFVVALLWVASGIYRVQQDEQGVVLRFGEF 101

Query: 86  PKNDVFLPGLHMMF-WPIDQVEIVKVIERQQ-KIGGRSASVGSNSG-------LILTGDQ 136
            + D   PGL   F  PI+     KV    + +IG RS + G  +G       L+LTGD+
Sbjct: 102 VRTD--QPGLRWHFPAPIETALTPKVTRVNRIEIGYRSVADGRRAGGDVVDESLMLTGDE 159

Query: 137 NIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIAL 196
           NI+ + F+V + + D   YLFN+ +P  T+K+ +ESAMREV+GR          RQ+I  
Sbjct: 160 NIIDIDFTVFWFIKDAGAYLFNIRDPEATVKKAAESAMREVIGRTDIQPALTEARQEIEA 219

Query: 197 EVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNR 256
               L+Q  +D Y+SGI I  + ++   PP  V DAF++VQRA QD +R   E+  Y N 
Sbjct: 220 STLGLLQAMLDEYQSGIEITQVQLQKVDPPSAVVDAFNDVQRARQDRERLRNEAEGYRND 279

Query: 257 VLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGI 316
           ++  ARGEA  + + + AY+++++  AQG+A RF+S+   Y  AP +  +R+YLETM+ +
Sbjct: 280 IIPRARGEAERLIQEASAYREQVVNLAQGDAQRFISVLEAYAKAPEVTARRMYLETMQEV 339

Query: 317 LKKAKKVIIDKK---QSVMPYLPLNEAFSR 343
           +    K+IID K   Q V+PYLPLNE   R
Sbjct: 340 MSGTNKIIIDGKSGGQGVLPYLPLNELLQR 369


>gi|294677921|ref|YP_003578536.1| HflK protein [Rhodobacter capsulatus SB 1003]
 gi|294476741|gb|ADE86129.1| HflK protein [Rhodobacter capsulatus SB 1003]
          Length = 391

 Score =  213 bits (542), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 112/310 (36%), Positives = 186/310 (60%), Gaps = 21/310 (6%)

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIV 108
           + G++ I  + + +  A+ S Y V  +ER++EL FGK  +    PGL+   WP+    ++
Sbjct: 70  TLGTIAIGAVALAAVWAWSSFYTVQQNERSIELMFGK-YHATGNPGLNFAPWPVVSKVVI 128

Query: 109 KVI-ERQQKIG-------------------GRSASVGSNSGLILTGDQNIVGLHFSVLYV 148
            V  ER  ++G                   GRS+   ++SGL+LT DQNIV + + +++ 
Sbjct: 129 PVTDERTTEVGTGRTRAIGTSESSDGVFSSGRSSDFVTDSGLMLTRDQNIVDVSYQIVWN 188

Query: 149 VTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDY 208
           V+DP  +LFNL +P +T++ VSESAMR+++ R     I    R  IA ++R  +Q T+D 
Sbjct: 189 VSDPSKFLFNLADPEDTIRAVSESAMRDIIARSELAPILNRDRGTIAADLRTAVQGTLDS 248

Query: 209 YKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHI 268
           Y++GI I  ++   A PPREV D+F +VQ A+Q+ D+  +E++ Y+N+V   ARG+A+ +
Sbjct: 249 YQAGINIVRVNFNRADPPREVIDSFRDVQAAQQERDKLEKEADAYANQVTAGARGQAAQL 308

Query: 269 RESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK 328
            + + AY+  ++ +AQG+A RF S+Y +Y  AP + ++R++ ETM   L    KV+ID +
Sbjct: 309 VQQAEAYRAEVVNDAQGQAARFTSVYEEYRKAPEVTKRRMFYETMSTTLGGVNKVVIDGQ 368

Query: 329 QSVMPYLPLN 338
              +PYLPL+
Sbjct: 369 SGTVPYLPLD 378


>gi|330812983|ref|YP_004357222.1| HflK protein [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486078|gb|AEA80483.1| HflK protein [Candidatus Pelagibacter sp. IMCC9063]
          Length = 371

 Score =  212 bits (540), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 123/301 (40%), Positives = 189/301 (62%), Gaps = 21/301 (6%)

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGL--HMMFWPIDQVEIVKV 110
           +  I L +GS       Y V PDE+ V LRFGK  N +  PGL  H+ F P++     KV
Sbjct: 69  IIAIALWLGS-----GFYRVLPDEQGVVLRFGKFVN-LTQPGLNYHLPF-PVETALTPKV 121

Query: 111 IERQQ-KIGGRSAS-VGSNSG--------LILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
               +  +G RSAS  G  +G        L+LTGD+NIV +++SV +++ D   +LFN++
Sbjct: 122 TRVNRIDVGFRSASDTGRATGIADVPEESLMLTGDENIVDINYSVFWLIKDGGKFLFNIQ 181

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
           +P ET+K V+E+AMREVV R     +    R +I ++ + ++Q+ +D+Y+SGI I  +  
Sbjct: 182 DPEETVKSVAETAMREVVARNPIQTVLTGGRARIEIDTQKIMQEILDFYESGIQITQVQT 241

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           + A PP+EV D+F +VQ A+ D++R   E++ Y+N V+  ARGEA+ + + +  YK +++
Sbjct: 242 QKADPPKEVIDSFRDVQAAKADKERLQNEADAYANDVIPRARGEAAQVVQQAEGYKRQVV 301

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS--VMPYLPLN 338
             A+GEA RFL+IY +Y NA  + ++R+YLETME +L    K+IID+K S  V+PYLPL 
Sbjct: 302 ASAEGEASRFLAIYSEYKNAKAVTQERMYLETMEKVLAGIDKIIIDQKSSGGVVPYLPLP 361

Query: 339 E 339
           E
Sbjct: 362 E 362


>gi|154245608|ref|YP_001416566.1| HflK protein [Xanthobacter autotrophicus Py2]
 gi|154159693|gb|ABS66909.1| HflK protein [Xanthobacter autotrophicus Py2]
          Length = 385

 Score =  209 bits (533), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 137/356 (38%), Positives = 199/356 (55%), Gaps = 32/356 (8%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKF-DLIPFFKSYGSVYIILL--LIGSFCAFQSIYIVH 73
           GS  +  G  P D+E +IR  +D+   +IP   S+G+  IILL  L+ +       Y V 
Sbjct: 20  GSGPSSSGPTPPDLEDLIRRSQDRLRTMIP--GSFGAKGIILLVALVVAGWFLSGFYRVQ 77

Query: 74  PDERAVELRFGKPKNDVFLPGLHMMF-WPID-----QVEIVKVIERQQKIGG---RSASV 124
           PDE+   LRFGK    V  PGL+  + +PI+     +V  V  I+   + G    R  SV
Sbjct: 78  PDEQGAVLRFGK-FVGVTQPGLNYHWPYPIETVLTPRVTFVNRIDIGMRTGEDTRRGTSV 136

Query: 125 GSN---SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRR 181
             +     L+LTGD+NIV + F+V + +++   YLFN++NP  T+K V+ESAMREV+GR 
Sbjct: 137 MRDVPEESLMLTGDENIVDVDFAVFWRISNAEQYLFNVQNPEGTIKAVAESAMREVIGRT 196

Query: 182 FAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQ 241
               I    RQ I   V+ L+Q  ++ YK+G+ I  + ++   PP +V DAF +VQ A  
Sbjct: 197 NIQPILTGARQNIETGVQELMQSVLNSYKAGVEITQVQMQKVDPPSQVIDAFRDVQAARA 256

Query: 242 DEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAP 301
           D +R   E+  Y+NRVL  ARGEAS I  ++  Y++R + EA+G+A RFL IY +Y  A 
Sbjct: 257 DAERSQNEAQTYANRVLPEARGEASRIENAAQGYRERTVVEARGQAARFLKIYDEYQKAK 316

Query: 302 TLLRKRIYLETMEGILKKAKKVIIDKKQS--------------VMPYLPLNEAFSR 343
            + R+R+YLETME +L    KVI+D   +              V+P LPLN+   R
Sbjct: 317 VVTRERMYLETMERVLGGVDKVIVDSAGTRQGPGGVSAGGPGGVVPVLPLNDLLRR 372


>gi|300021806|ref|YP_003754417.1| HflK protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523627|gb|ADJ22096.1| HflK protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 390

 Score =  208 bits (529), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 117/296 (39%), Positives = 187/296 (63%), Gaps = 17/296 (5%)

Query: 62  SFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE-RQQKIGG 119
           +F  F   Y V+PDE+ + LRFG+  N    PGLH    +PI++V + KV + R  ++G 
Sbjct: 91  TFYGF--FYRVNPDEQGIVLRFGE-YNRWDTPGLHWRLPYPIEEVRLPKVTQQRTIEVGS 147

Query: 120 RSASVGS-NSGLILTGDQNIVGLHFSVLYVV---------TDPRLYLFNLENPGETLKQV 169
             +++G+ +SGL+LTGD ++V + F V + +         T  + +LFN+  P  T+++V
Sbjct: 148 ARSTLGARDSGLMLTGDGSVVDVRFVVFWRISPDKSENGDTGVQQFLFNIAQPETTVREV 207

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           +ESAMREVVG+     +    RQQI  +V+ L+QKT+DYY++GI I+ I +++  PP EV
Sbjct: 208 AESAMREVVGQSALQPLLTGGRQQIQEDVQKLMQKTLDYYRAGIKIDQIQLKEVDPPEEV 267

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
             +F EV  A Q+ +  V+++  Y+++V   ARG+A  I  ++  Y+D+ + EA G+A R
Sbjct: 268 IGSFREVAAAAQERETLVKQAQTYADQVTPRARGDADRIVAAAEGYRDQTVAEATGQAAR 327

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNEAFSR 343
           FL +Y +Y  AP + R+R+YLE  E +L+ A K+IID+K  Q V+PYLPL++   R
Sbjct: 328 FLKVYDEYKKAPDVTRQRLYLEMQERVLEGADKIIIDQKSGQGVVPYLPLDQLQKR 383


>gi|92118238|ref|YP_577967.1| HflK protein [Nitrobacter hamburgensis X14]
 gi|91801132|gb|ABE63507.1| protease FtsH subunit HflK [Nitrobacter hamburgensis X14]
          Length = 385

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 131/348 (37%), Positives = 200/348 (57%), Gaps = 22/348 (6%)

Query: 16  SGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFC--AFQSIYIVH 73
           SG    G   PP D+E ++R  +++   +       ++ I+L+LIG+         + V 
Sbjct: 21  SGPQPAGGPKPP-DLEDLLRRAQERLRQLLPGGHLSTMGIVLILIGAIVIWGMSGFFRVQ 79

Query: 74  PDERAVELRFGKPKNDVFLPGL-HMMFWPIDQVEIVKVIERQQ-KIG-------GRSASV 124
           PDE    LRFGK    V  PGL + + +PI+ V + K +      IG        R  S 
Sbjct: 80  PDELGAVLRFGKHVRTV-QPGLNYHLPYPIETVLLPKALRVSTLNIGMTLVQDPARHTST 138

Query: 125 GSN---SGLILTGDQNIVGLHFSVLYVVTDPRL--YLFNLENPGETLKQVSESAMREVVG 179
             +     L+LTGD+NIV + F+VL+ +    +  +LFN++NP  T+K V+ESAMRE VG
Sbjct: 139 MRDVPEESLMLTGDENIVDVDFTVLWRIKPDGVGDFLFNIQNPEGTVKAVAESAMREWVG 198

Query: 180 RRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRA 239
           R     I  S+R +I + V++L+QKT+D Y +G+LI  + ++   PP +V D+F +VQ A
Sbjct: 199 RSDIQPILTSERTKIEVSVQDLMQKTLDQYGAGVLIQQVQMQKVDPPSQVIDSFRDVQAA 258

Query: 240 EQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVN 299
             D +R   E+  Y+NRV+  ARG AS I +++  YK++ I EA+G++ RFL +Y  Y  
Sbjct: 259 RADLERLQNEAQTYANRVIPDARGRASQIVQNAEGYKEQAIAEAKGQSSRFLQVYEAYKA 318

Query: 300 APTLLRKRIYLETMEGILKKAKKVIIDKKQS----VMPYLPLNEAFSR 343
           AP + R+RIYLETME +L  A K++ D   S    ++PYLPL+E  S+
Sbjct: 319 APDVTRERIYLETMEQVLGDADKLVYDPGSSSSAGIVPYLPLSELTSQ 366


>gi|254455465|ref|ZP_05068894.1| HflK protein [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082467|gb|EDZ59893.1| HflK protein [Candidatus Pelagibacter sp. HTCC7211]
          Length = 367

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 137/333 (41%), Positives = 197/333 (59%), Gaps = 23/333 (6%)

Query: 27  PFDVEAIIRYIKDKFD--LIPFFKSYGSVYIILLLIGSFCAFQS-IYIVHPDERAVELRF 83
           P D++AIIR I++K +  L    KS G    ++LLI  F    S +Y V PDE+ V LRF
Sbjct: 30  PPDIDAIIRDIQNKINKFLPGGSKSGGKPIGLILLILLFVWLASGLYRVLPDEQGVVLRF 89

Query: 84  GKPKNDVFLPGL--HMMFWPIDQVEIVKVI-----------ERQQ--KIGGRSASVGSNS 128
           GK       PGL  H+ F P++ VE  KV            ER+     GG  A V   S
Sbjct: 90  GKFVKTT-QPGLNYHIPF-PVETVETPKVTKVNRMDIGFRSERESGFSTGGGVADVPQES 147

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
            L+LTGD+NIV + FSV +V+ D   +LF +++P  T+K  +E+AMREV+ +     I  
Sbjct: 148 -LMLTGDENIVNIDFSVFWVIKDAGKFLFEIQDPEGTVKAAAETAMREVIAKSDIQPILT 206

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R +I LE + +IQ  +D Y+SGI +  +  + A PP +V DAF +VQ A  D +R   
Sbjct: 207 EGRAKIELETQEIIQSILDEYQSGIQVTQVQTQKADPPDQVIDAFRDVQAARADMERSKN 266

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           E+  Y+N V+  ARGEA  I +++ AYK++++ +A+GEA RF+SIY +Y  A  + ++R+
Sbjct: 267 EAEAYANDVIPRARGEAQKILQAAEAYKNQVVAKAEGEASRFISIYDEYAKAKEVTQERM 326

Query: 309 YLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
           YLETME +L   +KVII+K     V+PYLPL E
Sbjct: 327 YLETMEKVLADIEKVIIEKNAGSGVVPYLPLPE 359


>gi|312113787|ref|YP_004011383.1| HflK protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311218916|gb|ADP70284.1| HflK protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 375

 Score =  206 bits (525), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 122/297 (41%), Positives = 177/297 (59%), Gaps = 25/297 (8%)

Query: 72  VHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQKI------------G 118
           ++PDER V  RFG    ++   GL+  + +PI++V +V    RQ ++            G
Sbjct: 78  INPDERGVVQRFGAYDRELS-NGLNFRWPYPIEEVTVVPFT-RQNRVEVGFSSGPTGPFG 135

Query: 119 GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL------KQVSES 172
              +S  +   L+LTGD+NIV L+F+V + V D   YLFN+ N G+TL      K V+ES
Sbjct: 136 AIRSSARNEESLMLTGDENIVELNFNVFWNVKDAPAYLFNVRNQGDTLDASPNVKAVAES 195

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           AMREV+G+     I    RQ I   V+ LIQ+T+D YKSGI IN ++++   PP EV  A
Sbjct: 196 AMREVIGQNDIQPILTKSRQNIEESVKTLIQRTLDSYKSGININQVNLQKVDPPTEVIAA 255

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           F +VQ A  D++R   E+  Y+NRV+  ARGEA  I + +  Y+++ + EA G  +RFL 
Sbjct: 256 FRDVQAARADQERLRNEAEAYANRVVPEARGEAQRILQGAQGYREQAVAEATGRTERFLK 315

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK---QSVMPYLPLNEAFSRIQT 346
           ++ +Y  AP + RKR+YLET+E +L    K+IID+K     V+PYLPLNE   R Q+
Sbjct: 316 VFDEYQKAPDVTRKRMYLETLERVLGGMDKIIIDEKSGSNGVVPYLPLNE-LQRTQS 371


>gi|115524191|ref|YP_781102.1| HflK protein [Rhodopseudomonas palustris BisA53]
 gi|115518138|gb|ABJ06122.1| HflK protein [Rhodopseudomonas palustris BisA53]
          Length = 382

 Score =  206 bits (523), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 127/348 (36%), Positives = 195/348 (56%), Gaps = 23/348 (6%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFC--AFQSIYIVHP 74
           GS     G  P D+E ++R  +D+   +     + ++ I L+L+G+         + V  
Sbjct: 20  GSGPQPSGPRPPDLEDLLRRGQDRLQQLLPGGHFSAMGIALILVGALAVWGLSGFFRVQS 79

Query: 75  DERAVELRFGKPKNDVFLPGL-HMMFWPIDQVEIVK------------VIERQQKIGGRS 121
           +E  V LRFGK    V  PGL + + +PI+ V + K            +I    + G   
Sbjct: 80  EELGVVLRFGKHVRTV-QPGLNYHLPYPIETVLLPKALRVSTINVGMSLINDPARRGATM 138

Query: 122 ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRL--YLFNLENPGETLKQVSESAMREVVG 179
             V   S L+LTGD+NIV + F+VL+ +    +  YLFN++NP  T+K V+ESAMREV+G
Sbjct: 139 RDVPEES-LMLTGDENIVDVDFTVLWRIKPDGVGNYLFNIQNPEGTVKAVAESAMREVIG 197

Query: 180 RRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRA 239
           R     I    R      V++L+Q+T+D Y +G+L+  + ++   PP +V DAF +VQ A
Sbjct: 198 RSNIQPILTGARTTTESGVQDLMQRTLDGYGAGVLVQQVQLQKVDPPAQVIDAFRDVQAA 257

Query: 240 EQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVN 299
             D +R   E+  Y+NRV+  ARG  + I + +  YK++ I EA+G++ RFL +Y +Y  
Sbjct: 258 RADLERLQNEAQTYANRVIPDARGRGAQILQVAQGYKEQAIAEAKGQSSRFLQVYEEYRK 317

Query: 300 APTLLRKRIYLETMEGILKKAKKVIIDK----KQSVMPYLPLNEAFSR 343
           AP + R+RIYLETME I   ++K+I+D      Q V+PYLPLNE  +R
Sbjct: 318 APEVTRERIYLETMERIFGGSEKLIVDTGSGGSQGVVPYLPLNELTAR 365


>gi|121997461|ref|YP_001002248.1| HflK protein [Halorhodospira halophila SL1]
 gi|121588866|gb|ABM61446.1| protease FtsH subunit HflK [Halorhodospira halophila SL1]
          Length = 395

 Score =  205 bits (522), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 120/305 (39%), Positives = 186/305 (60%), Gaps = 16/305 (5%)

Query: 51  GSVYIILLLIGSFCAF--QSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP--IDQVE 106
           G+  I LL +G+F  +    IYIV    R VEL FG+  +D   PG H   WP  I QVE
Sbjct: 57  GATGISLLALGAFVVWMLSGIYIVDQGWRGVELTFGR-HSDTTEPGPHW-HWPRPIGQVE 114

Query: 107 IVKVIERQ------QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
            V V +R+      + +  R+  V S   L++T D+NIV +  +  Y V+DP LYLFN  
Sbjct: 115 RVNVEQRRIAEVGYESMQNRARPV-SAEALMITRDENIVDVRIAAQYEVSDPFLYLFNFR 173

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
            P +TLKQV+ESA+RE++G+R    +    R ++A E   L+Q+ MD Y++G+ +  +++
Sbjct: 174 MPEQTLKQVTESAVREIIGKRELQYVLTEGRTEVAQETGRLLQEVMDDYRTGLSVVQVAV 233

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           +D  PP  V  AF++  RA +DE R +  +  Y+N ++  A+G+A+ I E +  Y++++I
Sbjct: 234 QDIQPPEPVQPAFEDAIRAREDEQRTINRAQAYANELIPRAQGQAARILEEADGYREQVI 293

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLN 338
            +A+G+A RF ++  QY   P L+R+RIYLETME IL +  KV++D +  QS+M YLPL+
Sbjct: 294 AQAEGDAARFEALVPQYRADPQLMRQRIYLETMEEILGRVPKVMLDSESSQSLM-YLPLD 352

Query: 339 EAFSR 343
           +   R
Sbjct: 353 KLMDR 357


>gi|316933230|ref|YP_004108212.1| HflK protein [Rhodopseudomonas palustris DX-1]
 gi|315600944|gb|ADU43479.1| HflK protein [Rhodopseudomonas palustris DX-1]
          Length = 382

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 128/349 (36%), Positives = 198/349 (56%), Gaps = 23/349 (6%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFC--AFQSIYIVHP 74
           GS     G  P D+E ++R  +D+   I     + S+ II++++G+         + V  
Sbjct: 20  GSGPQSSGPRPPDLEDLLRRGQDRLQQILPGGHFSSLGIIVVVLGALAIWGLSGFFRVQS 79

Query: 75  DERAVELRFGKPKNDVFLPGL-HMMFWPIDQVEI-----VKVIERQQKIGGRSASVGSN- 127
           +E  V LRFGK    V  PGL + + +PI+ V +     V  I     + G ++  G+  
Sbjct: 80  EELGVVLRFGKHVRTV-QPGLNYHLPYPIETVLLPKALRVNTISIGMIVSGETSRRGATM 138

Query: 128 -----SGLILTGDQNIVGLHFSVLYVVTDPRL--YLFNLENPGETLKQVSESAMREVVGR 180
                  L+LTGD+NIV + F+VL+ +    +  +LFN++NP  T+K V+ESAMREV+GR
Sbjct: 139 QDVPEESLMLTGDENIVDVDFTVLWRIKPDGVGDFLFNIQNPQGTVKAVAESAMREVIGR 198

Query: 181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE 240
                I    R  I   V+ L+QKT+D Y +G+L+  + ++   PP++V DAF +VQ A 
Sbjct: 199 SDIQPILTGARTTIEGAVQELMQKTLDSYGAGVLVQQVQLQKVDPPQQVIDAFRDVQAAR 258

Query: 241 QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA 300
            D +R   E+  Y+NRV+  A+G A+ I +++  YK + I EA+G++ RFL +Y +Y  A
Sbjct: 259 ADLERLQNEAQTYANRVIPDAKGRAAQITQNAEGYKQQAIAEARGQSARFLDVYEEYRKA 318

Query: 301 PTLLRKRIYLETMEGILKKAKKVIIDK------KQSVMPYLPLNEAFSR 343
           P + R+RIYLETME +L  A+K++ D        Q V+PYLPLNE   R
Sbjct: 319 PDVTRQRIYLETMERVLGPAEKLVYDPGAGVGGGQGVIPYLPLNELSPR 367


>gi|310815310|ref|YP_003963274.1| Probable HflK protein [Ketogulonicigenium vulgare Y25]
 gi|308754045|gb|ADO41974.1| Probable HflK protein [Ketogulonicigenium vulgare Y25]
          Length = 351

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 171/294 (58%), Gaps = 10/294 (3%)

Query: 55  IILLLIGS--FCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI- 111
           II  ++G+    AF S Y V P+E++VEL  G   + +  PGL+   WP+    +V    
Sbjct: 39  IIAGVVGAIGLWAFSSFYTVRPEEQSVELFLGS-YHQIGEPGLNFAPWPLITHTVVNTTS 97

Query: 112 ERQQKIGGRSA-SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
           ER + +G  +A S  S +GL+LT D NIV + F V++ + DP   LFN+ +P  T+  VS
Sbjct: 98  ERTEIVGASTAGSAASGAGLMLTTDSNIVDIGFQVVWNINDPAKLLFNIADPQLTVNAVS 157

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
           ES MRE++       I    R  IA   R  IQ  +D Y SGI I  +++E A PP EV 
Sbjct: 158 ESVMREIIAASLLSPILNRDRGLIADTARERIQAILDEYDSGIAIIRVNLERADPPLEVI 217

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
           D+F EVQ AEQ+ DR   E++ YSNRV+ ++RG+A+ + E + AY+ + + +A GEA RF
Sbjct: 218 DSFREVQAAEQERDRLEREADAYSNRVMAASRGQAAQVIEGAEAYRAQTVNQALGEASRF 277

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-----QSVMPYLPLNE 339
            S+  +Y  AP + R+R+YLET+E +L     V++D         V+P LPL +
Sbjct: 278 NSVRVEYELAPDVTRQRLYLETVESVLSSTGAVVLDPSLTGAGNGVVPLLPLTD 331


>gi|111073598|emb|CAL29444.1| Protease subunit, HflK [Wolbachia endosymbiont of Onchocerca
           volvulus]
          Length = 344

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 116/292 (39%), Positives = 179/292 (61%), Gaps = 9/292 (3%)

Query: 54  YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE 112
           Y+I+ +I  F A    YIVHP E  +EL FGK  N    PGL   F +PI +V  V V E
Sbjct: 49  YLIIFVILFFYACTGFYIVHPSEEGIELIFGKYSN-TETPGLRYHFPYPIGKVFKVNVKE 107

Query: 113 RQQKIGGRSASVGSNS----GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN--PGETL 166
             ++  G S+S G ++    G++LTGD+NIV ++F V + V D + YLF + +  PG ++
Sbjct: 108 VNREEIGVSSSYGRDADRGEGVMLTGDENIVNVNFEVQWRVKDAKDYLFKVRDYKPGFSV 167

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
           K  +ESAMRE++G+          RQ+I ++ + L+Q+ +D Y+ GI I +I ++   PP
Sbjct: 168 KNAAESAMREIIGKNTISFALGQGRQEIPIDTKTLLQQILDGYQMGIEILSIQMKKIDPP 227

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            +V  +F +VQ A  D++R + E+  Y N ++  A+GEA  I+  + AY++ II EA+G 
Sbjct: 228 EKVISSFRDVQSARADKERIINEAYAYGNDIIPRAKGEAIKIKLDAEAYENEIISEAKGN 287

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII-DKKQSVMPYLPL 337
           A+RF S+Y +Y + P+L++ RIYLETME I  +  K++I D  + V  YLPL
Sbjct: 288 ANRFFSLYKEYKHNPSLVKSRIYLETMENIFNQVDKIVITDDLKGVFSYLPL 339


>gi|192292371|ref|YP_001992976.1| HflK protein [Rhodopseudomonas palustris TIE-1]
 gi|192286120|gb|ACF02501.1| HflK protein [Rhodopseudomonas palustris TIE-1]
          Length = 383

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 130/360 (36%), Positives = 198/360 (55%), Gaps = 23/360 (6%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFC--AFQSIYIVHP 74
           GS     G  P D+E ++R  +D+   I     +  + I ++L+G+         + V  
Sbjct: 20  GSGPQSSGPRPPDLEDLLRRGQDRLQQILPGGHFSGLGIAIVLLGALAIWGLSGFFRVQS 79

Query: 75  DERAVELRFGKPKNDVFLPGL-HMMFWPIDQVEIVK------------VIERQQKIGGRS 121
           +E  V LRFGK    V  PGL + + +PI+ V + K            +I    + G   
Sbjct: 80  EELGVVLRFGKHVRTV-QPGLNYHLPYPIETVLLPKALRVNTISIGMTLINDPARRGATM 138

Query: 122 ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRL--YLFNLENPGETLKQVSESAMREVVG 179
             V   S L+LTGD+NIV + F+VL+ +    +  YLFN+++P  T+K V+ESAMREV+G
Sbjct: 139 HDVPEES-LMLTGDENIVDVDFTVLWRIKPDGVGNYLFNIQSPQGTVKAVAESAMREVIG 197

Query: 180 RRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRA 239
           R     I    R  I   V+ L+QKT+D Y +G+LI  + ++   PP++V DAF +VQ A
Sbjct: 198 RSDIQPILTGARTTIENAVQELMQKTLDSYGAGVLIQQVQMQKVDPPQQVIDAFRDVQAA 257

Query: 240 EQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVN 299
             D +R   E+  Y+NRV+  A+G AS I +++  YK + I EA+G++ RFL ++ +Y  
Sbjct: 258 RADLERLQNEAQTYANRVIPDAKGRASQIIQNAEGYKGQAIAEAKGQSARFLDVFEEYKK 317

Query: 300 APTLLRKRIYLETMEGILKKAKKVIID----KKQSVMPYLPLNEAFSRIQTKREIRWYQS 355
           AP + R+RIYLETME +L  A K++ D      Q ++PYLPLNE   R      ++  QS
Sbjct: 318 APAVTRERIYLETMERVLGSADKLVYDPGAGNGQGIVPYLPLNELTRRSSPPATVQQNQS 377


>gi|39936553|ref|NP_948829.1| HflK protein [Rhodopseudomonas palustris CGA009]
 gi|39650409|emb|CAE28932.1| putative protease subunit hflK [Rhodopseudomonas palustris CGA009]
          Length = 383

 Score =  203 bits (517), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 130/360 (36%), Positives = 198/360 (55%), Gaps = 23/360 (6%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFC--AFQSIYIVHP 74
           GS     G  P D+E ++R  +D+   I     +  + I ++L+G+         + V  
Sbjct: 20  GSGPQLSGPRPPDLEDLLRRGQDRLQQILPGGHFSGLGIAIVLLGALAIWGLSGFFRVQS 79

Query: 75  DERAVELRFGKPKNDVFLPGL-HMMFWPIDQVEIVK------------VIERQQKIGGRS 121
           +E  V LRFGK    V  PGL + + +PI+ V + K            +I    + G   
Sbjct: 80  EELGVVLRFGKHVRTV-QPGLNYHLPYPIETVLLPKALRVNTISIGMTLINDPARRGATM 138

Query: 122 ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRL--YLFNLENPGETLKQVSESAMREVVG 179
             V   S L+LTGD+NIV + F+VL+ +    +  YLFN+++P  T+K V+ESAMREV+G
Sbjct: 139 HDVPEES-LMLTGDENIVDVDFTVLWRIKPDGVGNYLFNIQSPQGTVKAVAESAMREVIG 197

Query: 180 RRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRA 239
           R     I    R  I   V+ L+QKT+D Y +G+LI  + ++   PP++V DAF +VQ A
Sbjct: 198 RSDIQPILTGARTTIENAVQELMQKTLDSYGAGVLIQQVQMQKVDPPQQVIDAFRDVQAA 257

Query: 240 EQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVN 299
             D +R   E+  Y+NRV+  A+G AS I +++  YK + I EA+G++ RFL ++ +Y  
Sbjct: 258 RADLERLQNEAQTYANRVIPDAKGRASQIIQNAEGYKGQAIAEAKGQSARFLDVFEEYKK 317

Query: 300 APTLLRKRIYLETMEGILKKAKKVIID----KKQSVMPYLPLNEAFSRIQTKREIRWYQS 355
           AP + R+RIYLETME +L  A K++ D      Q ++PYLPLNE   R      ++  QS
Sbjct: 318 APAVTRERIYLETMERVLGSADKLVYDPGAGNGQGIVPYLPLNELTRRSSPPATVQQNQS 377


>gi|328542999|ref|YP_004303108.1| membrane bound protease protein [polymorphum gilvum SL003B-26A1]
 gi|326412745|gb|ADZ69808.1| Putative membrane bound protease protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 393

 Score =  203 bits (517), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 125/343 (36%), Positives = 192/343 (55%), Gaps = 21/343 (6%)

Query: 29  DVEAIIRYIKDKF-DLIPFFKSYGSVYIILLLIGSFCA---FQSIYIVHPDERAVELRFG 84
           D+E +++  +D+   ++P          +LL             +Y V   +  VEL FG
Sbjct: 47  DLEELLKRTQDRMKTVLPGGGGNLGAKGMLLAGVVVVGVWMLTGLYRVEQGQVGVELVFG 106

Query: 85  KPKNDVFLPGLHMMF-WPIDQVEIVKVI-ERQQKIGGRSASVGSN--------SGLILTG 134
           +  +D   PGL+  + +PI +V    V  +R+  +G      GS+          L+LTG
Sbjct: 107 Q-VSDQTAPGLNYNWPYPIGEVYTPDVERQREMTVGMEEFVSGSSVRSRDVPEESLMLTG 165

Query: 135 DQNIVGLHFSVLYVVTDPRL----YLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQ 190
           D+NIV + F V + + + R     +LFN++NP  T+K V+ESAMREVVG      I    
Sbjct: 166 DENIVDVDFKVQWRIQNTREGVANFLFNIQNPEGTVKAVAESAMREVVGESNIDAILTEN 225

Query: 191 RQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEES 250
           R  I + V+ L+Q T+D Y++GI I  + ++   PP++V DAF +VQ A  D++R   E+
Sbjct: 226 RAPIQIAVQELMQSTLDTYRAGIEITQVQMQKVDPPQQVIDAFRDVQAARADQERIQNEA 285

Query: 251 NKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYL 310
             Y+NR++  ARGEA+ + E++ AY+D+ I EA G+A RF  I+ +Y  AP + R+R+YL
Sbjct: 286 QTYANRIVPEARGEAARVMEAASAYRDQTIAEATGQAQRFTKIFDEYRKAPDVTRERLYL 345

Query: 311 ETMEGILKKAKKVIIDKK--QSVMPYLPLNEAFSRIQTKREIR 351
           ET+E +L    K+IID +  Q V+PYLPLNE   R QT    R
Sbjct: 346 ETIEKVLGSNSKIIIDSQGSQGVVPYLPLNELTGRTQTPAATR 388


>gi|85714703|ref|ZP_01045690.1| HflK [Nitrobacter sp. Nb-311A]
 gi|85698588|gb|EAQ36458.1| HflK [Nitrobacter sp. Nb-311A]
          Length = 381

 Score =  203 bits (516), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 127/346 (36%), Positives = 198/346 (57%), Gaps = 20/346 (5%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFC--AFQSIYIVHP 74
           G+     G  P D+E ++R  +++   +       ++ ++L+LIG+         + V  
Sbjct: 20  GAGPQPTGPKPPDLEDLLRRAQERIRQLLPGGHLSTMGVLLILIGAVVIWGMSGFFRVQS 79

Query: 75  DERAVELRFGKPKNDVFLPGL-HMMFWPIDQVEIVKVIERQQ-KIG-------GRSASVG 125
           +E  V LRFGK    V  PGL + + +PI+ V + K +      IG        R+ S  
Sbjct: 80  EELGVVLRFGKHVRTV-QPGLNYHLPYPIESVLLPKALRVSTLNIGLTLAQDPARNTSTM 138

Query: 126 SN---SGLILTGDQNIVGLHFSVLYVVTDPRL--YLFNLENPGETLKQVSESAMREVVGR 180
            +     L+LTGD+NIV + F+VL+ +    +  +LFN++NP  T+K V+ESAMRE VGR
Sbjct: 139 RDVPEESLMLTGDENIVDVDFTVLWRIKPGGVGDFLFNIQNPEGTVKAVAESAMREWVGR 198

Query: 181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE 240
                I  S+R +I   V  L+QKT+D Y +G+LI  + ++   PP +V D+F +VQ A 
Sbjct: 199 SDIQPILTSERTKIEASVHELMQKTLDQYGAGVLIQQVQMQKVDPPAQVIDSFRDVQAAR 258

Query: 241 QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA 300
            D +R   E+  Y+NRV+  ARG A+ I +++  YK++ I EA+G++ RFL +Y  Y  A
Sbjct: 259 ADLERLQNEAQTYANRVIPDARGRAAQIVQNAEGYKEQAIAEAKGQSSRFLQVYQAYKAA 318

Query: 301 PTLLRKRIYLETMEGILKKAKKVIIDKKQS---VMPYLPLNEAFSR 343
           P + R+RIYLETME +L +A K++ D   S   ++PYLPL+E  SR
Sbjct: 319 PDVTRERIYLETMEHVLGEADKLVYDPGSSSSGIVPYLPLSELTSR 364


>gi|75676534|ref|YP_318955.1| HflK [Nitrobacter winogradskyi Nb-255]
 gi|74421404|gb|ABA05603.1| protease FtsH subunit HflK [Nitrobacter winogradskyi Nb-255]
          Length = 382

 Score =  202 bits (515), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 131/341 (38%), Positives = 197/341 (57%), Gaps = 23/341 (6%)

Query: 24  GLPPFDVEAIIRYIKDKF-DLIPFFKSYGSVYIILLLIGSFC--AFQSIYIVHPDERAVE 80
           G  P D+E ++R  +++   L+P     G + I+L+LIG+         + V  +E  V 
Sbjct: 27  GPKPPDLEDLLRRAQERIRQLLPGGHLSG-MGILLILIGAVAIWGMSGFFRVQSEELGVV 85

Query: 81  LRFGKPKNDVFLPGL-HMMFWPIDQVEIVKVIERQQ-KIG-------GRSASVGSN---S 128
           LRFGK    V  PGL + + +PI+ V + K +      IG        RS S   +    
Sbjct: 86  LRFGKHVRTV-QPGLNYHLPYPIETVLLPKALRVSTLNIGLTLVQDSARSTSTMRDVPEE 144

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRL--YLFNLENPGETLKQVSESAMREVVGRRFAVDI 186
            L+LTGD+NIV + F+VL+ +    +  +LFN++NP  T+K V+ESAMRE VGR     I
Sbjct: 145 SLMLTGDENIVDVDFTVLWRIKPDGVGDFLFNIQNPEGTVKAVAESAMREWVGRSDIQPI 204

Query: 187 FRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRF 246
             S+R +I   V  L+QKT+D Y +G+LI  + ++   PP +V D+F +VQ A  D +R 
Sbjct: 205 LTSERTKIEASVHELMQKTLDQYGAGVLIQQVQMQKVDPPAQVIDSFRDVQAARADLERL 264

Query: 247 VEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRK 306
             E+  Y+NRV+  +RG A+ I +++  YK++ I EA+G++ RFL +Y  Y  AP + R+
Sbjct: 265 QNEAQTYANRVVPDSRGRAAQIVQNAQGYKEQAIAEAKGQSSRFLQVYQAYKEAPDVTRE 324

Query: 307 RIYLETMEGILKKAKKVIIDKKQS----VMPYLPLNEAFSR 343
           RIYLETME +L  A K+I D   S    ++PYLPL+E  SR
Sbjct: 325 RIYLETMEHVLGDADKLIYDPGSSSSGGIVPYLPLSELTSR 365


>gi|298293058|ref|YP_003694997.1| HflK protein [Starkeya novella DSM 506]
 gi|296929569|gb|ADH90378.1| HflK protein [Starkeya novella DSM 506]
          Length = 384

 Score =  202 bits (514), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 128/306 (41%), Positives = 173/306 (56%), Gaps = 34/306 (11%)

Query: 70  YIVHPDERAVELRFGKPKNDVFL----PGL-HMMFWPID-----QVEIVKVIERQQKIG- 118
           Y V PDE+ V LRFGK     F+    PGL + + +PI+     QV  V  I+   + G 
Sbjct: 75  YRVQPDEQGVVLRFGK-----FVGTTNPGLNYHLPYPIETVLTPQVTRVNRIDIGIRTGD 129

Query: 119 ----GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRL----------YLFNLENPGE 164
               G +    S   L+LTGD+NIV + F+V ++V               +LFN++NP  
Sbjct: 130 DPRRGAAMRDVSEESLMLTGDENIVDVDFAVFWMVKPAAPGSTEDIGAADFLFNVQNPEG 189

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           T+K V+ESAMREVVGR     I    RQ I   V+ L+Q T+D YKSGILI  + ++   
Sbjct: 190 TIKAVAESAMREVVGRTNIQPILTGARQNIETAVQELMQHTLDSYKSGILITQVQLQKVD 249

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V DAF +VQ A  D +R   E+  Y+NRV+  ARGEA+ I + +  YK+R I EA+
Sbjct: 250 PPSQVIDAFRDVQAARADAERLQNEAQAYANRVVPEARGEAARITQGAEGYKERAIIEAR 309

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS----VMPYLPLNEA 340
           G+A RFLS+  QY  AP + R+R+YLETME +     K+IID   S    V+PYLPL   
Sbjct: 310 GQASRFLSVLTQYQKAPDVTRQRLYLETMERVFGGMDKIIIDPAASGASGVVPYLPLGPI 369

Query: 341 FSRIQT 346
             R  T
Sbjct: 370 GGRPAT 375


>gi|197104344|ref|YP_002129721.1| protease subunit hflK [Phenylobacterium zucineum HLK1]
 gi|196477764|gb|ACG77292.1| protease subunit hflK [Phenylobacterium zucineum HLK1]
          Length = 381

 Score =  202 bits (513), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 107/276 (38%), Positives = 174/276 (63%), Gaps = 5/276 (1%)

Query: 63  FCAFQSIYIVHPDERAVELRFGK-PKNDVFLPGL-HMMFWPIDQVEIVKVIERQQ-KIGG 119
             A   IY+V P+E AV   FG   +N+   PGL + +  PI++V+ V V   Q+  +GG
Sbjct: 81  LWALSGIYVVQPNEEAVVTTFGAYSRNEG--PGLRYHLPAPIERVQKVPVTSLQRLDVGG 138

Query: 120 RSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVG 179
            +A       L+LTGD+NI+ L FSV + V D   ++F + +P  ++K V+ESAMREVVG
Sbjct: 139 AAAGAVPEESLMLTGDENIIDLQFSVTWRVADADRFVFTIRDPEGSVKAVAESAMREVVG 198

Query: 180 RRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRA 239
           R   +DI  + R Q+  +   L+Q+T+D + +G+ I+ + I  A+PP++V  AF +V  A
Sbjct: 199 RTNLLDILTTGRGQVQQQAAELMQRTLDSWGAGVRIDEVQIRSANPPQQVLAAFRDVVSA 258

Query: 240 EQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVN 299
           +QD++  V E+N Y NRV+  A+G+A+ I +++ AY+++ ++EA G+A RF +I  +Y  
Sbjct: 259 QQDQESAVNEANTYRNRVINEAKGDAARIVQAAQAYREQAVREATGDASRFNAILNEYRR 318

Query: 300 APTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYL 335
           AP   R RIY+ETM+ +L ++ KVI+D + +  P +
Sbjct: 319 APGATRDRIYIETMQRVLARSNKVIVDSEGASAPII 354


>gi|42520669|ref|NP_966584.1| hflK protein [Wolbachia endosymbiont of Drosophila melanogaster]
 gi|42410409|gb|AAS14518.1| hflK protein [Wolbachia endosymbiont of Drosophila melanogaster]
          Length = 344

 Score =  201 bits (512), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 116/292 (39%), Positives = 179/292 (61%), Gaps = 9/292 (3%)

Query: 54  YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE 112
           Y I+ +I  F A    YIVHP E ++EL FGK  N    PGL   F +PI +V  V V E
Sbjct: 49  YFIIFIILLFYACTGFYIVHPSEESIELTFGKYSN-TETPGLRYHFPYPIGKVFKVNVKE 107

Query: 113 RQQKIGGRSASVGSNS----GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN--PGETL 166
             ++  G S+S G ++    G++LTGD+NIV ++F V + V D + YLF + +  PG ++
Sbjct: 108 VNREEIGVSSSYGRDTDRGEGVMLTGDENIVNVNFEVQWRVRDAKDYLFKVRDYKPGFSV 167

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
           K  +ESAMRE++G+          R +I+ + R L+Q+ +D Y+ GI I ++ ++   PP
Sbjct: 168 KNAAESAMREIIGKNTISFALGQGRPEISRDTRILLQQILDGYQMGIEILSVQMKKIDPP 227

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            +V  +F +VQ A  D++R + E+  Y+N ++  A+GEA  I+  + AY++ II EA+G 
Sbjct: 228 EKVISSFRDVQSARADKERTINEAYAYNNDIIPRAKGEAIKIKLDAQAYENEIINEAKGN 287

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII-DKKQSVMPYLPL 337
           A+RFLS+Y +Y   P+L++ RIYLETME I  K  KV++ D  + +  YLPL
Sbjct: 288 ANRFLSLYEEYRQNPSLVKNRIYLETMENIFSKVDKVVVTDDLKGMFSYLPL 339


>gi|307824088|ref|ZP_07654315.1| HflK protein [Methylobacter tundripaludum SV96]
 gi|307734872|gb|EFO05722.1| HflK protein [Methylobacter tundripaludum SV96]
          Length = 399

 Score =  201 bits (512), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 125/344 (36%), Positives = 191/344 (55%), Gaps = 27/344 (7%)

Query: 19  NGNGDGLPPFDVEAIIRYIKDKFDL--------------IPFFKSYGSVYIILLLIGSFC 64
           +G GD   P D++  IR +++K                 IP  KS G V +  L +    
Sbjct: 15  SGRGDQKGPPDLDEAIRSLQEKLSGFFGGGKEGDGSSSGIPPLKSLGFVVVGALALWGLS 74

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKV-----IERQQKIG 118
            F   YIV      VE RFGK        GL+  F  PI++V IV V     IE   + G
Sbjct: 75  GF---YIVDEGTHGVETRFGK-YVATTQSGLNWHFPAPIERVNIVDVKQQRYIEVGYRSG 130

Query: 119 GRSASVGS--NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMRE 176
           G   ++GS     L+LT D+NIV +  +V Y V D + ++FN+ NP  TLKQV+ESA R 
Sbjct: 131 GSDQALGSVPKEALMLTKDENIVDVRLAVQYQVKDAKDFVFNVVNPAATLKQVTESAQRG 190

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
           VVG      +    R +I  +++  IQ  MD YKSGI + +++++DA PP +V +AF++ 
Sbjct: 191 VVGSSKMDFVLTEGRSEIVAQIKKEIQDVMDNYKSGIQVTSVNLQDAQPPEQVQNAFEDA 250

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
            +A +D+ R + E+  YSN V+  ARG A+   + +  YK+++I +A+GE++RF  +  +
Sbjct: 251 IKAREDQQRLINEAEAYSNDVVPKARGAAARKIQEAEGYKEQVIAQAEGESNRFSKLLTE 310

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
           Y  AP + RKR+Y+E+ME +L +   V++D K S  M YLPL++
Sbjct: 311 YTKAPDVTRKRLYIESMESVLAETNTVMVDVKGSNNMLYLPLDK 354


>gi|225677237|ref|ZP_03788229.1| hflK protein [Wolbachia endosymbiont of Muscidifurax uniraptor]
 gi|225590721|gb|EEH11956.1| hflK protein [Wolbachia endosymbiont of Muscidifurax uniraptor]
          Length = 344

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 115/292 (39%), Positives = 179/292 (61%), Gaps = 9/292 (3%)

Query: 54  YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE 112
           Y I+ +I  F A    YIVHP E ++EL FGK  N    PGL   F +PI +V  V V E
Sbjct: 49  YFIIFIILLFYACTGFYIVHPSEESIELTFGKYSN-TETPGLRYHFPYPIGKVFKVNVKE 107

Query: 113 RQQKIGGRSASVGSNS----GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN--PGETL 166
             ++  G S+S G ++    G++LTGD+NIV ++F V + V D + YLF + +  PG ++
Sbjct: 108 VNREEIGVSSSYGRDTDRGEGVMLTGDENIVNVNFEVQWRVRDAKDYLFKVRDYKPGFSV 167

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
           K  +ESAMRE++G+          R +I+ + R L+Q+ +D Y+ GI I ++ ++   PP
Sbjct: 168 KNAAESAMREIIGKNTISFALGQGRPEISRDTRILLQQILDGYQMGIEILSVQMKKIDPP 227

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            +V  +F +VQ A  D++R + E+  Y+N ++  A+GEA  I+  + AY++ +I EA+G 
Sbjct: 228 EKVISSFRDVQSARADKERTINEAYAYNNDIIPRAKGEAIKIKLDAQAYENEVINEAKGN 287

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII-DKKQSVMPYLPL 337
           A+RFLS+Y +Y   P+L++ RIYLETME I  K  KV++ D  + +  YLPL
Sbjct: 288 ANRFLSLYEEYRQNPSLVKNRIYLETMENIFSKVDKVVVTDDLKGMFSYLPL 339


>gi|167041872|gb|ABZ06612.1| putative SPFH domain / Band 7 family protein [uncultured marine
           microorganism HF4000_133G03]
          Length = 367

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 117/285 (41%), Positives = 167/285 (58%), Gaps = 13/285 (4%)

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE--------RQQ 115
           AF  +Y V PDE+ V LRFGK  +    PGL+    +P++ V   KV +        R  
Sbjct: 71  AFSGLYRVLPDEQGVVLRFGKFVSTT-QPGLNYHIPYPVETVLTPKVTKVHRVDIGFRAA 129

Query: 116 KIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESA 173
              GR++ VG      L+LTGD+NI  + FSV +V+ D   +LF +++P  T+K  +E+A
Sbjct: 130 SDSGRTSEVGDVPEESLMLTGDENIANIDFSVFWVIKDAGKFLFKIQSPVVTVKATAETA 189

Query: 174 MREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAF 233
           MREV+ R     I    R  I +E + ++Q  +D Y+SGI I  +  + A PP EV DAF
Sbjct: 190 MREVIARSKLQSILTKGRSNIEIETQEIMQSLLDEYESGIQITQVQTQKADPPDEVIDAF 249

Query: 234 DEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSI 293
            +VQ A  D +R   E+  Y N V+  ARG+A+ I + + AYK ++I  A+GEA RFL+I
Sbjct: 250 RDVQAARADMERSKNEAEGYQNDVIPRARGDAAKILQEAEAYKKKVIAMAEGEASRFLAI 309

Query: 294 YGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPL 337
           Y +Y  A  + ++R+YLETME +L    KVIIDK    V+PYLPL
Sbjct: 310 YNEYAKAKRVTQERMYLETMEKVLADIDKVIIDKNAGGVVPYLPL 354


>gi|119474820|ref|ZP_01615173.1| HflK protein [marine gamma proteobacterium HTCC2143]
 gi|119451023|gb|EAW32256.1| HflK protein [marine gamma proteobacterium HTCC2143]
          Length = 382

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 122/341 (35%), Positives = 197/341 (57%), Gaps = 29/341 (8%)

Query: 19  NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY--------------GSVYI-ILLLIGSF 63
           N N DG PP D++   + +++K  L   F                 GSV + +LL+I + 
Sbjct: 16  NSNKDGGPP-DLDEAYKKLQEK--LAGLFGGGGSKGGSGSGAPELSGSVIVLVLLIIAAI 72

Query: 64  CAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSAS 123
                IY V   +RAV +RFGK     + PGLH     +D   IV V E +Q        
Sbjct: 73  WGAMGIYQVDEKDRAVVMRFGK-YYQTYGPGLHWNPPMVDNKVIVNVTEERQY------- 124

Query: 124 VGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFA 183
              + GL+LT D+NIV L  +V Y + DP+ ++ N++NP  +L+Q S+SA+R VVG    
Sbjct: 125 --PSRGLMLTKDENIVELPLTVQYNIADPKAFVLNVKNPELSLQQASDSALRHVVGSSKL 182

Query: 184 VDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDE 243
            D+    R++I ++V+  +Q  +D Y++GI +  I+I +A PP EV DA+D+V +A +D+
Sbjct: 183 DDVVSIGREKIGVDVQVRLQTYLDNYQTGIQVVKINISEAKPPSEVKDAYDDVIKAREDQ 242

Query: 244 DRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTL 303
           +R + E+  YSN ++  ARG+A  I E +  YK ++I EA GEA RF ++ G+Y  AP +
Sbjct: 243 ERLINEAQAYSNGIIPEARGKAQRIIEEANGYKAKVIVEATGEAMRFENLLGEYQKAPEV 302

Query: 304 LRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSR 343
            R+R+YL+T+E ++ ++ KV++D +  + M YLPL++   +
Sbjct: 303 TRERLYLDTVEEVMSRSSKVLVDVEGGNNMLYLPLDKLMGQ 343


>gi|118602544|ref|YP_903759.1| HflK protein [Candidatus Ruthia magnifica str. Cm (Calyptogena
           magnifica)]
 gi|118567483|gb|ABL02288.1| protease FtsH subunit HflK [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 383

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 129/362 (35%), Positives = 204/362 (56%), Gaps = 35/362 (9%)

Query: 1   MSYDKNNSD-WRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK----------- 48
           M+++ NN + W     SGSN      PP ++E +I+  K+KFD +   K           
Sbjct: 1   MTWNDNNKNPW-----SGSNQ----TPP-ELEKVIKDFKNKFDGLFNNKKLSSAGTSKIP 50

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL-PGLHMMFWPIDQVEI 107
           S G    IL+L+        IYI+ P E+ V LRFG  + +    P  H+ + PI+ +  
Sbjct: 51  SRGGFKYILILVLLVWLLSGIYIIDPAEKGVVLRFGAFQEETSQGPHWHIPY-PIETLNR 109

Query: 108 VKVIE-RQQKIGGRS---------ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLF 157
           + V + R  +IG R+          +V S S L+LT D+N++   F++ Y + D + YLF
Sbjct: 110 INVEQVRTAEIGYRNVVNNNRRFGGNVSSES-LMLTKDENMIEAKFAIQYRINDVQAYLF 168

Query: 158 NLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINT 217
           N+ NP  TL+ VSESA+R+VVG+     I    R  IA  ++   Q  +D YK+G+LI T
Sbjct: 169 NVANPDTTLRHVSESAIRQVVGQNTMDYILTEGRANIADNIKEKSQNLLDKYKTGLLITT 228

Query: 218 ISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKD 277
           ++++DA PP +V  AF +  +A +D+ R + E+  Y+N +L  +RG+A+ + E S AYK 
Sbjct: 229 VNMQDAQPPEQVQSAFSDAVKAREDKQRLINEAQTYANDILPKSRGKAARMLEESKAYKS 288

Query: 278 RIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPL 337
            +I +++GEA RF  I  +Y  AP + R+R+Y ETME +L    KV++D K + M YLP+
Sbjct: 289 EMISKSEGEASRFKQILAEYEKAPKVTRERLYRETMENVLASTSKVVVDSKANSMMYLPI 348

Query: 338 NE 339
           ++
Sbjct: 349 DK 350


>gi|118590856|ref|ZP_01548256.1| putative membrane bound protease protein [Stappia aggregata IAM
           12614]
 gi|118436378|gb|EAV43019.1| putative membrane bound protease protein [Stappia aggregata IAM
           12614]
          Length = 395

 Score =  200 bits (509), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 122/299 (40%), Positives = 176/299 (58%), Gaps = 20/299 (6%)

Query: 63  FCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQKIGGRS 121
           + AF   Y+V   E  VEL  GK + D   PGL+  + +PI +V   KV  +++   G  
Sbjct: 88  WLAF-GFYVVDEGEVGVELVLGKVE-DQTPPGLNYNWPYPIGEVYTPKVELQRETTVGTE 145

Query: 122 ASVGSNS----------GLILTGDQNIVGLHFSVLYVVTDPRL----YLFNLENPGETLK 167
            +V S+            L+LTGD+NIV + F VL+ + +       YLFN+++P  T+K
Sbjct: 146 ENVSSSGVVRARDVQEESLMLTGDENIVDVGFKVLWRIRNTNQGISDYLFNIQDPEATVK 205

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
            V+ESAMREVVG      I    R  I  +V +L+QKT+D Y+SGI I  + ++   PP 
Sbjct: 206 AVAESAMREVVGGSKIDSILTENRVSIQNDVASLMQKTLDSYQSGIEIGEVQMQRVDPPA 265

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
           +V DAF +VQ A  DE+R   E+  Y+NRV+  ARGEA+ + E++ AYKD+ I EA G++
Sbjct: 266 QVIDAFRDVQAARADEERISNEAKAYANRVVPEARGEAARVLEAANAYKDQTIAEATGQS 325

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS---VMPYLPLNEAFSR 343
            RF  IY +Y  AP + R+R+YLET+E +L    K+IID   +   V+PYLPLN+   R
Sbjct: 326 QRFTKIYEEYRKAPDVTRERLYLETLEKVLGSNNKIIIDSDSTGSGVLPYLPLNDLNGR 384


>gi|269958488|ref|YP_003328275.1| hflK protein [Anaplasma centrale str. Israel]
 gi|269848317|gb|ACZ48961.1| hflK protein [Anaplasma centrale str. Israel]
          Length = 366

 Score =  199 bits (507), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 119/298 (39%), Positives = 180/298 (60%), Gaps = 17/298 (5%)

Query: 54  YIILLLIGSFCAFQS--IYIVHPDERAVELRFGKPKNDVFLPGLHMMFW---PIDQVEIV 108
           Y++ L++     + S   Y+V+P+E+AVEL FGK  N +  PGL   FW   P  +V  V
Sbjct: 59  YVLFLVLSIVLLYASSGFYVVNPEEKAVELLFGK-YNKITEPGLR--FWLPRPFGKVMKV 115

Query: 109 KV-IERQQKIGG---RSAS-VGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN-- 161
           KV I  +++IG    RS S +G   G++LTGD+NIV ++F V + VTD   YLF + +  
Sbjct: 116 KVEIVSKEEIGSAAYRSTSDLGHGEGIMLTGDENIVNINFDVQWKVTDAYKYLFCVRDSR 175

Query: 162 PGETLKQVSESAMREVVGRR-FAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
           PG T+K  +ESAMRE++G+   A  I    R  IA E + L+Q  +D Y  G+ + +I +
Sbjct: 176 PGATVKNAAESAMREIIGKSTLAFAIEGEGRASIAYETKKLLQSVLDQYNMGVEVLSIQL 235

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           +   PP +V  AF +VQ A  D++R + E++ Y N VL  A+GEA  I+  + AYK  +I
Sbjct: 236 KKVDPPEKVISAFRDVQSARADKERAINEAHAYRNEVLPKAKGEAIRIKLDAEAYKSEVI 295

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII-DKKQSVMPYLPL 337
             AQG+A +FL+++ +YVN P  +R R+Y+E ME +L    KV++ D  + +  YLPL
Sbjct: 296 NRAQGDAAKFLAVHKEYVNQPDAVRDRMYIEAMEEVLHNMNKVVVTDDVKGLFSYLPL 353


>gi|294084287|ref|YP_003551045.1| HflK protein [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292663860|gb|ADE38961.1| HflK [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 376

 Score =  199 bits (506), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 118/330 (35%), Positives = 189/330 (57%), Gaps = 18/330 (5%)

Query: 26  PPFDVEAIIRYIKDKFD-LIPFF-KSYGSVYIILLLI-GSFCAFQSIYIVHPDERAVELR 82
           PP D++ +++  +D    +IP   +S G  +I+LL+I     A    Y V+P ++ V LR
Sbjct: 41  PPQDIDELVQQGRDTLRRIIPGGGQSSGRSFILLLIIFAGIWAATGFYRVNPQQQGVVLR 100

Query: 83  FGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQ------KIGGRSAS---VGSNSGLIL 132
           FG+       PGLH    +P++ V   +V    +       +GG S+S   +   S +I 
Sbjct: 101 FGEWVR-TTAPGLHYHIPFPVETVLTPEVTRDNRIEIGYRDVGGSSSSRRDIADESQMI- 158

Query: 133 TGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQ 192
           TGD+NIV + F V + V+D   YLFNL  P ET+K  +E+ MRE++GR     +    RQ
Sbjct: 159 TGDENIVDIDFVVFWRVSDAGQYLFNLAEPDETIKVAAEAVMREIIGRTTIQTVLTEGRQ 218

Query: 193 QIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNK 252
           +I ++ R  +Q  +D YK+G+ +  + +    PP +V DAF+EVQRA QD D+   +++ 
Sbjct: 219 EIQVQARQQLQDLLDEYKAGVRVRDVQLLAVDPPADVIDAFNEVQRARQDRDKLKNQADA 278

Query: 253 YSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLET 312
           + N ++  ARGEA+ +   + AY+  ++  A+G+A RF  +Y  Y+    + ++RIY+ET
Sbjct: 279 FRNDIVPRARGEAAQLVAEAQAYEAEVVNRAKGDASRFDQVYKAYLQNKDVTKERIYIET 338

Query: 313 MEGILKKAKKVIIDKKQS---VMPYLPLNE 339
           +E IL    K+IID+  S   V+PYLPLNE
Sbjct: 339 IEKILSNVDKIIIDESSSGNGVVPYLPLNE 368


>gi|254292837|ref|YP_003058860.1| HflK protein [Hirschia baltica ATCC 49814]
 gi|254041368|gb|ACT58163.1| HflK protein [Hirschia baltica ATCC 49814]
          Length = 366

 Score =  199 bits (505), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 112/289 (38%), Positives = 175/289 (60%), Gaps = 10/289 (3%)

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW-PIDQVEIVKVI 111
           ++ ++ LIG       ++ V+  E+AV LRFG+  +    PG H+ F  PI+  EIV V 
Sbjct: 80  MFAVVGLIGWLAT--GVFQVNEQEQAVVLRFGE-FHSTRGPGFHVRFPDPIETHEIVLVN 136

Query: 112 ERQQ-KIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
           E Q+  IG      G++ G +LTGD+NIV + F V + V +P+ +LFN+  P  TLK ++
Sbjct: 137 EIQKLHIG-----TGASEGQMLTGDENIVDIDFVVHWKVNNPQDFLFNVNGPENTLKSIA 191

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
           ES+MREVVG+     I    R ++    R LIQ T+D Y +GI I  + ++ + PP  V 
Sbjct: 192 ESSMREVVGKMDFQSIISKGRDEVQTSTRELIQSTLDSYGAGIEITVVQLDKSQPPAVVN 251

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
           DAF +V  A QD+   + ++  Y+N V+  ARGEA  I + + AY+ ++I  A GEA+RF
Sbjct: 252 DAFLDVNNAAQDKVSTINQATAYANNVVPRARGEAEKILQEADAYRSKVIAAATGEAERF 311

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
             ++ +Y  AP + R+R+YLETME +L +++ +I+D     +PYLPL++
Sbjct: 312 RLVFEEYRKAPRVTRERMYLETMEEVLGRSETIILDNDAGAVPYLPLDQ 360


>gi|114799007|ref|YP_759199.1| HflK protein [Hyphomonas neptunium ATCC 15444]
 gi|114739181|gb|ABI77306.1| HflK protein [Hyphomonas neptunium ATCC 15444]
          Length = 388

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 105/289 (36%), Positives = 180/289 (62%), Gaps = 13/289 (4%)

Query: 56  ILLLIG-SFCAF--QSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVI 111
           +L+++G +  A+   S+ +V P ++A   RFGK + + + PGLH     P++   +++V 
Sbjct: 89  VLVIVGVALLAWLSTSVVVVDPTQQAAVFRFGKWQAN-YGPGLHFHLPAPLENHRLIQVE 147

Query: 112 ERQQ-KIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVV--TDPRLYLFNLENPGETLKQ 168
            R + +IG        +  L+LT D+NIV +HFS+++ V   +P  Y+ N+ +P  T+  
Sbjct: 148 TRNETRIGA-----TEDESLMLTQDENIVDIHFSIIWKVDTQNPENYVLNVRDPDSTVAM 202

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
           V ES MREVVG+    DI  +QR ++ L+V    Q  ++ Y++G+ I  + I  A PP+ 
Sbjct: 203 VGESVMREVVGKTRLQDIITTQRDEVQLQVVEQTQALLNEYRAGVQILQVQIGKADPPQP 262

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V +AF++V  AEQD +     + +++N ++  ARG AS +++ S AY+D+I+ +A GEA 
Sbjct: 263 VIEAFNDVNVAEQDAETLTNRATQFANEIVPQARGTASRLQQESEAYRDQIVADANGEAA 322

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPL 337
           RF  IY +Y+ AP + R+R+YLETME +L+++ K++ID+    +PYLP+
Sbjct: 323 RFDQIYAEYIKAPRVTRERMYLETMERVLERSDKLLIDQDSGAVPYLPI 371


>gi|90424753|ref|YP_533123.1| HflK protein [Rhodopseudomonas palustris BisB18]
 gi|90106767|gb|ABD88804.1| HflK protein [Rhodopseudomonas palustris BisB18]
          Length = 383

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 130/348 (37%), Positives = 195/348 (56%), Gaps = 23/348 (6%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFD-LIP--FFKSYGSVYIILLLIGSFCAFQSIYIVH 73
           GS     G  P D+E ++R  +D+   ++P     S G + ++L+   +       + V 
Sbjct: 20  GSGPQSTGPRPPDLEDLLRRGQDRLQQMLPGGHLSSMG-IALVLVAALAVWGLSGFFRVQ 78

Query: 74  PDERAVELRFGKPKNDVFLPGL-HMMFWPIDQVEIVKVIERQQ-KIG----------GRS 121
            +E  V LRFGK    V  PGL + + +PI+ V + K +      IG          G +
Sbjct: 79  SEELGVVLRFGKHVRTV-QPGLNYHLPYPIETVLLPKALRVSTISIGMTLVNDTARRGTA 137

Query: 122 ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRL--YLFNLENPGETLKQVSESAMREVVG 179
                   L+LTGD+NIV + F+VL+ ++   +  YLFN++NP  T+K V+ESAMREVVG
Sbjct: 138 MRDVPEESLMLTGDENIVDVDFTVLWRISPDGVGNYLFNIQNPEGTVKAVAESAMREVVG 197

Query: 180 RRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRA 239
           R     I    R      V++L+QKT+D Y +GIL+  + ++   PP +V DAF +VQ A
Sbjct: 198 RASIQPILTGARTTTEASVQDLMQKTLDGYGAGILVQQVQMQKVDPPAQVIDAFRDVQAA 257

Query: 240 EQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVN 299
             D +R   E+  Y+NRV+  ARG AS I + +  YK++ + EA+G++ RFL +Y +Y  
Sbjct: 258 RADLERLQNEAQTYANRVIPDARGRASQILQVAEGYKEQAVAEAKGQSARFLKVYDEYRK 317

Query: 300 APTLLRKRIYLETMEGILKKAKKVIID----KKQSVMPYLPLNEAFSR 343
           AP + R+RIYLETME IL  A K++ D      Q ++PYLPL+E  SR
Sbjct: 318 APDVTRQRIYLETMERILGGADKLVYDGGGAGSQGIVPYLPLSELSSR 365


>gi|225630543|ref|YP_002727334.1| hflK protein [Wolbachia sp. wRi]
 gi|225592524|gb|ACN95543.1| hflK protein [Wolbachia sp. wRi]
          Length = 344

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 117/298 (39%), Positives = 181/298 (60%), Gaps = 13/298 (4%)

Query: 48  KSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVE 106
           K Y  ++IILLL     A    YIVHP E  +EL FGK  N   + GL   F +PI +V 
Sbjct: 47  KPYFIIFIILLL----YACTGFYIVHPSEEGIELTFGKYSN-TEMSGLRYHFPYPIGKVF 101

Query: 107 IVKVIERQQKIGGRSASVGSNS----GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN- 161
            V V E  ++  G S+S G ++    G++LTGD+NIV ++F V + V D + YLF + + 
Sbjct: 102 KVNVKEVNREEIGVSSSYGRDTDRGEGVMLTGDENIVNVNFEVQWRVRDAKDYLFKVRDY 161

Query: 162 -PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
            PG ++K  +ESAMRE++G+          R +I+ + R L+Q+ +D Y+ GI I ++ +
Sbjct: 162 KPGFSVKNAAESAMREIIGKNTISFALGQGRPEISRDTRILLQQILDGYQMGIEILSVQM 221

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           +   PP +V  +F +VQ A  D++R + E+  Y+N ++  A+GEA  I+  + AY++ +I
Sbjct: 222 KKIDPPEKVISSFRDVQSARADKERTINEAYAYNNDIIPRAKGEAIKIKLDAQAYENEVI 281

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII-DKKQSVMPYLPL 337
            EA+G A+RFLS+Y +Y   P+L++ RIYLETME I  K  KV++ D  + +  YLPL
Sbjct: 282 NEAKGNANRFLSLYEEYRQNPSLVKNRIYLETMENIFSKVDKVVVTDDLKGMFSYLPL 339


>gi|163746071|ref|ZP_02153430.1| HflK protein [Oceanibulbus indolifex HEL-45]
 gi|161380816|gb|EDQ05226.1| HflK protein [Oceanibulbus indolifex HEL-45]
          Length = 419

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 112/309 (36%), Positives = 176/309 (56%), Gaps = 23/309 (7%)

Query: 52  SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI 111
           +V I LL   +   F S Y V P+++++EL  G+    +   GL+   WP+   E+  V 
Sbjct: 105 TVGIALLAGVALWGFASFYTVRPEQQSIELFLGEFSG-IGTEGLNFAPWPLVTAEVFDVT 163

Query: 112 -ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
             R +++G R  + G N GL+LT D+NIV + F V++ + + R + F+L +P  +++ +S
Sbjct: 164 TNRTEELGVRRGT-GGNEGLMLTTDENIVDIDFQVVWNIKNARDFKFSLRDPEASVRAIS 222

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE-- 228
           ESAMREV+ +     I    R  +A  V+ LIQ T+D   +GI I  +++    PP +  
Sbjct: 223 ESAMREVIAQSELAPILNRDRGAVADRVKELIQTTLDNRNTGINILRVNVNKVDPPSQTV 282

Query: 229 -------------VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAY 275
                        V DAF +VQ AEQ+ DR   +++ Y+NR    ARGE++ + E+S  Y
Sbjct: 283 QVTDANGNTTTQSVVDAFRDVQAAEQERDRVERQADAYANRRTAEARGESAQLLEASEGY 342

Query: 276 KDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-----KKQS 330
           + R++ +A GEA RF ++  +Y NAP + RKR+YLETME +L    K+I++       Q 
Sbjct: 343 RARVVNDAVGEASRFEAVLEEYRNAPEVTRKRLYLETMEKVLGDVDKIILENGSGQNGQG 402

Query: 331 VMPYLPLNE 339
           V+PYLPLNE
Sbjct: 403 VVPYLPLNE 411


>gi|83312588|ref|YP_422852.1| membrane protease subunit stomatin/prohibitin-like protein
           [Magnetospirillum magneticum AMB-1]
 gi|82947429|dbj|BAE52293.1| Membrane protease subunits, stomatin/prohibitin homolog
           [Magnetospirillum magneticum AMB-1]
          Length = 295

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 110/284 (38%), Positives = 170/284 (59%), Gaps = 10/284 (3%)

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQ-----KIG 118
           A   IY V PDE+ V +RFGK   D   PGLH    +PI+ V + KV +  Q     ++G
Sbjct: 5   AASGIYKVSPDEQGVVMRFGK-WVDTTEPGLHYRLPFPIEAVLLPKVTKVNQLLLGSRMG 63

Query: 119 G--RSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMRE 176
           G  R     ++   +LTGD+NIV    +V + + D   YLF + +P  T+K  +ESA+RE
Sbjct: 64  GDVRGGGRATDESRMLTGDENIVEAEAAVFWRIKDAGKYLFAVRDPELTVKVAAESALRE 123

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
           V+GR         +R+ IA++ +  +Q+ +D Y +GI +  + ++   PP  V DAF++V
Sbjct: 124 VIGRNPIQAALSDKRELIAIQAQEELQRLLDAYGAGIHVQQVQLQKVDPPSAVIDAFNDV 183

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
           QRA  D++R   E+  Y N ++  ARGEA  + + + AY+++++  AQG+A RFLS+YG 
Sbjct: 184 QRARADQERARNEAEAYRNDIIPRARGEAERLTQEAQAYREQVVDLAQGDAKRFLSLYGS 243

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNE 339
           Y  A  +  +R+Y+ETME +LK A KV+ID   + ++PYLPL E
Sbjct: 244 YKQAEDVTMRRLYIETMEDVLKGATKVVIDPSAKGLVPYLPLPE 287


>gi|58585025|ref|YP_198598.1| membrane protease subunit stomatin/prohibitin-like protein
           [Wolbachia endosymbiont strain TRS of Brugia malayi]
 gi|58419341|gb|AAW71356.1| Membrane protease subunit, stomatin/prohibitin homolog [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 345

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 115/293 (39%), Positives = 177/293 (60%), Gaps = 10/293 (3%)

Query: 54  YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE 112
           Y I+ +I  F      YIVHP E  +EL FGK  N    PGL   F +PI +V  V V E
Sbjct: 49  YFIIFIILLFYVCTGFYIVHPSEEGIELTFGKYSN-TETPGLRYHFPYPIGKVFKVNVKE 107

Query: 113 RQQKIGGRSASVGSNS----GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN--PGETL 166
             ++  G S+  G ++    G++LTGD+NIV ++F V + V D + YLF + +  PG ++
Sbjct: 108 VNREEIGISSPYGRDTDRGEGVMLTGDENIVNVNFEVQWRVRDAKDYLFKVRDYKPGFSV 167

Query: 167 KQVSESAMREVVGRRFAVDIFRSQ-RQQIALEVRNLIQKTMDYYKSGILINTISIEDASP 225
           K  +ESAMRE++G+         Q R +I+ + R L+Q+ +D Y+ GI I ++ ++   P
Sbjct: 168 KNAAESAMREIIGKNTISFALEGQGRAEISRDTRILLQQILDGYQMGIEILSVQMKKIDP 227

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           P +V  +F +VQ A  D++R + E+  YSN ++  A+GEA  I+  + AY++ II EA+G
Sbjct: 228 PEKVISSFRDVQSARADKERTINEAYAYSNDIIPRAKGEAIKIKLDAEAYENEIINEAKG 287

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPL 337
            A+RFLS+Y +Y   P+L++ RIYLETME I  K  KV++ +  + +  YLPL
Sbjct: 288 NANRFLSLYEEYKQNPSLVKNRIYLETMENIFNKVDKVVVTEDLKGMFSYLPL 340


>gi|83593538|ref|YP_427290.1| HflK [Rhodospirillum rubrum ATCC 11170]
 gi|83576452|gb|ABC23003.1| HflK [Rhodospirillum rubrum ATCC 11170]
          Length = 407

 Score =  196 bits (498), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 125/337 (37%), Positives = 189/337 (56%), Gaps = 26/337 (7%)

Query: 27  PFDVEAIIRYIKDKF-DLIPFF----KSYGSVYIILLLIGSFCAFQSIYIVHPDERAVEL 81
           P D+E ++R  +++F  ++P      K  G V I+ L +     F   Y V  DE+ V +
Sbjct: 42  PPDLEEMLRRSQERFRKMVPGGNLGNKGIGLVAILALAVWLLTGF---YRVGTDEQGVVM 98

Query: 82  RFGKPKNDVFLPGLHMMF-WPIDQVEIVKV-IERQQKIGGRSASVGSNS----------- 128
           RFG+  +    PGLH    +PI+ V + KV +E + ++G R   +G N+           
Sbjct: 99  RFGEFTHTT-PPGLHYHLPYPIEAVILPKVTVENRIELGFRG--IGENARGRTPSRDVLE 155

Query: 129 -GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIF 187
             L+LTGD+NI+ + FSV++V+ D   +LFNL +P  T+ + +ESAMREV+G+       
Sbjct: 156 ESLMLTGDENIIDIDFSVIWVIKDAGAFLFNLRDPEGTVNRAAESAMREVIGQTPIQVAL 215

Query: 188 RSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFV 247
              RQQI    + L+Q  MD Y +GI I  + +    PP +V DAF++VQR+  D +R  
Sbjct: 216 TEGRQQIEDRTKELLQAMMDEYNAGITIRRVQLLKVDPPAQVVDAFNDVQRSRADRERLR 275

Query: 248 EESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKR 307
            E+  Y N V+  ARG+A  + + + AY++ I+  AQG+  RF S+   Y     +  +R
Sbjct: 276 NEAEAYRNSVIPEARGQAEQLLQQAEAYREEIVNRAQGDVARFNSVLEGYRLNRDVTTQR 335

Query: 308 IYLETMEGILKKAKKVIIDKK-QSVMPYLPLNEAFSR 343
           IYLETME +L+   KVIIDK  Q V+PYLPL E  +R
Sbjct: 336 IYLETMEEVLRNVNKVIIDKNGQGVVPYLPLPEVRAR 372


>gi|91977818|ref|YP_570477.1| HflK protein [Rhodopseudomonas palustris BisB5]
 gi|91684274|gb|ABE40576.1| HflK protein [Rhodopseudomonas palustris BisB5]
          Length = 389

 Score =  196 bits (498), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 129/352 (36%), Positives = 197/352 (55%), Gaps = 25/352 (7%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFD-LIP--FFKSYGSVYIILLLIGSFCAFQSIYIVH 73
           GS     G  P D+E ++R  +D+   L+P  +F S G + I +L   +       + V 
Sbjct: 20  GSGPQTTGPRPPDIEDLLRRGQDRLQQLLPGGYFSSLG-IAIAVLGALTIWGLSGFFRVQ 78

Query: 74  PDERAVELRFGKPKNDVFLPGL-HMMFWPIDQVEIVKVIERQQ-KIGGRSASVGSNSG-- 129
            +E  V LRFGK    V  PGL + + +PI+ V + K +      IG    S  +  G  
Sbjct: 79  SEELGVVLRFGKHVRTV-QPGLNYHLPYPIETVLLPKALRVSTISIGMTLISDPARRGTT 137

Query: 130 --------LILTGDQNIVGLHFSVLYVVTDPRL--YLFNLENPGETLKQVSESAMREVVG 179
                   L+LTGD+NIV + F+VL+ +    +  +LFN++NP  T+K V+ESAMREV+G
Sbjct: 138 MRDVPEESLMLTGDENIVDVDFTVLWRIKPDGVGNFLFNIQNPEGTVKAVAESAMREVIG 197

Query: 180 RRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRA 239
           R     I    R  I   V+ L+QKT+D Y +G+L+  + ++   PP++V DAF +VQ A
Sbjct: 198 RSNIQPILTGARTLIENGVQELMQKTLDGYGAGVLVQQVQMQKVDPPQQVIDAFRDVQAA 257

Query: 240 EQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVN 299
             D +R   E+  Y+NRV+  A+G  + I +S+  YK + + EA+G++ RFL +Y +Y  
Sbjct: 258 RADLERLQNEAQTYANRVIPDAKGRGAQIIQSAEGYKGQAVAEAKGQSARFLDVYEEYRK 317

Query: 300 APTLLRKRIYLETMEGILKKAKKVIIDK------KQSVMPYLPLNEAFSRIQ 345
           AP + R+RIYLETME +L  A+K++ D        Q ++PYLPL+E   R Q
Sbjct: 318 APDVTRQRIYLETMERVLGPAEKLVYDSGAGAGAGQGIVPYLPLSELSPRRQ 369


>gi|56417109|ref|YP_154183.1| hflK protein [Anaplasma marginale str. St. Maries]
 gi|222475474|ref|YP_002563891.1| hflK protein [Anaplasma marginale str. Florida]
 gi|56388341|gb|AAV86928.1| hflK protein [Anaplasma marginale str. St. Maries]
 gi|222419612|gb|ACM49635.1| hflK protein [Anaplasma marginale str. Florida]
          Length = 370

 Score =  196 bits (498), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 115/286 (40%), Positives = 170/286 (59%), Gaps = 16/286 (5%)

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW---PIDQVEIVKV-IERQQKIG-- 118
           A    Y+V+P+E+AVEL FGK +  V  PGL   FW   P  +V  VKV I  +++IG  
Sbjct: 76  ACTGFYVVNPEEKAVELLFGKYRK-VTEPGLR--FWLPRPFGKVLKVKVEIVSKEEIGSG 132

Query: 119 ---GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN--PGETLKQVSESA 173
              G         G++LTGD+NIV ++F V + VTD   YLF + +  PG T+K  +ESA
Sbjct: 133 VYRGDGGEHSHGEGIMLTGDENIVNINFDVQWKVTDAYKYLFCVRDGRPGATVKNAAESA 192

Query: 174 MREVVGRR-FAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           MRE++G+   A  I    R  IA E + L+Q  +D+Y  G+ + +I ++   PP +V  A
Sbjct: 193 MREIIGKSTLAFAIEGEGRASIAYETKKLLQSVLDHYSMGVEVLSIQLKKVDPPEKVISA 252

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           F +VQ A  D++R + E++ Y N VL  A+GEA  I+  + AYK  +I  AQG+A +FL+
Sbjct: 253 FRDVQSARADKERAINEAHAYRNEVLPKAKGEAIRIKLDAEAYKSEVINRAQGDAAKFLA 312

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVII-DKKQSVMPYLPL 337
           +Y +YVN P  +R R+Y+E ME +L    KV++ D  + +  YLPL
Sbjct: 313 VYKEYVNQPAAVRDRMYIEAMEEVLNNMDKVVVTDDIKGLFSYLPL 358


>gi|254995283|ref|ZP_05277473.1| hflK protein [Anaplasma marginale str. Mississippi]
 gi|255003462|ref|ZP_05278426.1| hflK protein [Anaplasma marginale str. Puerto Rico]
 gi|255004588|ref|ZP_05279389.1| hflK protein [Anaplasma marginale str. Virginia]
          Length = 366

 Score =  196 bits (497), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 115/286 (40%), Positives = 170/286 (59%), Gaps = 16/286 (5%)

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW---PIDQVEIVKV-IERQQKIG-- 118
           A    Y+V+P+E+AVEL FGK +  V  PGL   FW   P  +V  VKV I  +++IG  
Sbjct: 72  ACTGFYVVNPEEKAVELLFGKYRK-VTEPGLR--FWLPRPFGKVLKVKVEIVSKEEIGSG 128

Query: 119 ---GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN--PGETLKQVSESA 173
              G         G++LTGD+NIV ++F V + VTD   YLF + +  PG T+K  +ESA
Sbjct: 129 VYRGDGGEHSHGEGIMLTGDENIVNINFDVQWKVTDAYKYLFCVRDGRPGATVKNAAESA 188

Query: 174 MREVVGRR-FAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           MRE++G+   A  I    R  IA E + L+Q  +D+Y  G+ + +I ++   PP +V  A
Sbjct: 189 MREIIGKSTLAFAIEGEGRASIAYETKKLLQSVLDHYSMGVEVLSIQLKKVDPPEKVISA 248

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           F +VQ A  D++R + E++ Y N VL  A+GEA  I+  + AYK  +I  AQG+A +FL+
Sbjct: 249 FRDVQSARADKERAINEAHAYRNEVLPKAKGEAIRIKLDAEAYKSEVINRAQGDAAKFLA 308

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVII-DKKQSVMPYLPL 337
           +Y +YVN P  +R R+Y+E ME +L    KV++ D  + +  YLPL
Sbjct: 309 VYKEYVNQPAAVRDRMYIEAMEEVLNNMDKVVVTDDIKGLFSYLPL 354


>gi|78485434|ref|YP_391359.1| HflK protein [Thiomicrospira crunogena XCL-2]
 gi|78363720|gb|ABB41685.1| HflK protein [Thiomicrospira crunogena XCL-2]
          Length = 405

 Score =  195 bits (496), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 113/305 (37%), Positives = 177/305 (58%), Gaps = 10/305 (3%)

Query: 46  FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQ 104
           F    GS  +++ LI        IY V   ER V  RFG   ++    GLH    WPI+ 
Sbjct: 55  FGGGKGSFLVVVALI-IIWLLSGIYTVDSPERGVVKRFGA-YSEQTTAGLHWHIPWPIET 112

Query: 105 VEIVKVIE-RQQKIGGRSASVGSNS-----GLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
           V IV V + R  +IG RS S   N       L+L+ D+NIV +  +V Y V+D + YLF+
Sbjct: 113 VTIVNVDQIRTAEIGYRSDSRNRNGSVPSEALMLSKDENIVDIRIAVQYKVSDAQKYLFD 172

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           +  P  TL+ V+ESA+REVVGR     +    R ++  +VR L Q+ +D Y +G++I ++
Sbjct: 173 VAVPDMTLRDVTESALREVVGRNTMDFVLTEGRDEVVNKVRTLTQEKLDNYNTGLMITSL 232

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
           +++DA PP +V DAF +V ++ +D +R + E+  YSN +L  ARG+A+   E + AY D+
Sbjct: 233 NLQDAQPPEQVQDAFADVVKSREDRERLINEAEAYSNDILPKARGQAARQIEEARAYHDQ 292

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPL 337
           +I  A G+A+RF+SI  +Y  AP + R+R+Y++ + G+L    KV +     S + YLPL
Sbjct: 293 VIARATGQANRFMSILSEYKKAPEVTRERLYIDAISGVLSATSKVFVGSDSGSNLLYLPL 352

Query: 338 NEAFS 342
           ++  +
Sbjct: 353 DKMVT 357


>gi|190571441|ref|YP_001975799.1| hflK protein [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
 gi|213018840|ref|ZP_03334648.1| hflK protein [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
 gi|190357713|emb|CAQ55162.1| hflK protein [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
 gi|212995791|gb|EEB56431.1| hflK protein [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
          Length = 341

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 116/293 (39%), Positives = 176/293 (60%), Gaps = 10/293 (3%)

Query: 54  YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE 112
           Y I+ ++  F      YIVHP E  +EL FGK  N     GL   F +PI +V  V V E
Sbjct: 45  YFIIFIVLLFYLCTGFYIVHPSEEGIELTFGKYSN-TETSGLRYHFPYPIGKVFKVNVKE 103

Query: 113 RQQKIGGRSASVGSNS----GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN--PGETL 166
             ++  G S+S G ++    G++LTGD+NIV ++F V + V D + YLF + +  PG ++
Sbjct: 104 VNREEIGISSSYGRDTDRGEGVMLTGDENIVNVNFEVQWRVRDAKDYLFKVRDYKPGFSV 163

Query: 167 KQVSESAMREVVGRRFAVDIFRSQ-RQQIALEVRNLIQKTMDYYKSGILINTISIEDASP 225
           K  +ESAMRE++G+         Q R +I+ + R L+Q+ +D Y+ GI I ++ ++   P
Sbjct: 164 KNAAESAMREIIGKNTISFALEGQGRAEISRDTRILLQQILDGYQMGIEILSVQMKKIDP 223

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           P +V  +F +VQ A  D++R + E+  YSN ++  A+GEA  I+  + AY++ II EA+G
Sbjct: 224 PEKVISSFRDVQSARADKERTINEAYAYSNDIIPRAKGEAIKIKLDAEAYENEIINEAKG 283

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKK-VIIDKKQSVMPYLPL 337
            A+RFLS+Y +Y   P+L++ RIYLETME I  K  K VI D  + +  YLPL
Sbjct: 284 NANRFLSLYEEYRQNPSLVKNRIYLETMENIFSKVDKFVITDDLKGMFSYLPL 336


>gi|90022310|ref|YP_528137.1| heat shock protein HslU [Saccharophagus degradans 2-40]
 gi|89951910|gb|ABD81925.1| HflK protein [Saccharophagus degradans 2-40]
          Length = 386

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 119/346 (34%), Positives = 193/346 (55%), Gaps = 28/346 (8%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY--------------GSVYII-LLLIG 61
           G N   DG P  D++ +IR  ++K   +   K                G++ I  L+++ 
Sbjct: 16  GGNRGNDGPP--DLDEVIRNFQNKISGLFGGKGGGNGTNNGRNEGGFNGTILIFALVVVA 73

Query: 62  SFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRS 121
               F  IY V   ERAV L  GK  ++   PGLH     ID V  V  +  Q+   G+ 
Sbjct: 74  IIYVFAGIYQVDQKERAVVLHLGK-YSETKGPGLHWNPPLIDSVSKVDSLSLQEWSTGQQ 132

Query: 122 ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRR 181
                    +LT D NIV +  SV Y   DP+ YL  + +P  +L+Q + SA+R VVG  
Sbjct: 133 ---------MLTKDLNIVDIRMSVQYSRIDPKAYLLEVRDPEMSLQQAANSALRHVVGSS 183

Query: 182 FAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQ 241
              ++    R+QIA+EVR L+Q  +D YK+GI ++ ++IE+A PP+EV  AFD+V +A +
Sbjct: 184 PMHNVLTEGREQIAVEVRELLQLYLDNYKTGINVDKVNIEEADPPKEVQSAFDDVSKARE 243

Query: 242 DEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAP 301
           DE+R   E+  Y+N ++  ARGEA  + E + AYK+++I +A+GEA RF  +  +Y  AP
Sbjct: 244 DEERLQNEAQTYANGIIPKARGEAQRVIEQATAYKEQVIAQAEGEAKRFEYLLAEYKKAP 303

Query: 302 TLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQT 346
            + R+R+Y++T++ +++ + KV++D +  + M Y+PL++     +T
Sbjct: 304 EVTRRRLYIDTVQEVMENSSKVMVDVEGGNNMFYMPLDQIVKATRT 349


>gi|254470111|ref|ZP_05083515.1| HflK protein [Pseudovibrio sp. JE062]
 gi|211960422|gb|EEA95618.1| HflK protein [Pseudovibrio sp. JE062]
          Length = 388

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 120/308 (38%), Positives = 181/308 (58%), Gaps = 19/308 (6%)

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVI 111
           ++ IL+ +  + A   +Y V      V + FGK       PGL+  + +PI  VE   V 
Sbjct: 78  LFAILVAVLIWMA-TGLYRVDEGYVGVPMVFGKVVGQTG-PGLNYNWPYPIGSVETPNVQ 135

Query: 112 E-RQQKIG-----GRSASVGSN---SGLILTGDQNIVGLHFSVLYVV----TDPRLYLFN 158
             R+  IG     GRSA    +     L+LTGD+NIV + F V +V+    T  + +LFN
Sbjct: 136 GVRETTIGLQQFSGRSAVSTRDVPEESLMLTGDENIVDVDFKVQWVIQNTPTGVQEFLFN 195

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           ++NP  T+K V+ESAMREVVG      I    R  I   V+ L+Q+T+D YKSGI I  +
Sbjct: 196 IQNPEGTVKAVAESAMREVVGSSQIDAILTESRTPIQQAVQKLMQETLDNYKSGIQITNV 255

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
            ++   PP +V +AF +VQ A  D++R   E+  Y+NR++  ARG A+ + E++  Y+D+
Sbjct: 256 QMQKVDPPAQVIEAFRDVQAARADQERVQNEAQAYANRIVPEARGSAARVSEAAQGYRDK 315

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID---KKQSVMPYL 335
            + EA+G+ADRF  IY +Y  +P ++R+R+YLETME +L K  K+IID   ++  V+PYL
Sbjct: 316 TVAEAKGQADRFTKIYEEYAKSPDVIRQRLYLETMEEVLSKNPKIIIDGNGQQNGVVPYL 375

Query: 336 PLNEAFSR 343
           PL++   R
Sbjct: 376 PLDQLNKR 383


>gi|148244639|ref|YP_001219333.1| membrane protease subunit HflK [Candidatus Vesicomyosocius okutanii
           HA]
 gi|146326466|dbj|BAF61609.1| membrane protease subunit HflK [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 389

 Score =  193 bits (491), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 119/350 (34%), Positives = 197/350 (56%), Gaps = 22/350 (6%)

Query: 27  PFDVEAIIRYIKDKFD-----------LIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPD 75
           P ++E +I+ +K+KFD           + P   S G++  IL+LI        IYI+ P 
Sbjct: 19  PPELEKVIKDMKNKFDGFLNGKKSSNTITPKIPSNGNLKYILILILFIWLLSGIYIIDPA 78

Query: 76  ERAVELRFGKPKNDVFL-PGLHMMFWPIDQVEIVKVIE-RQQKIGGRSA-----SVGSN- 127
           E+ V LRFG  + +    P  H+ + PI+ +  + V + R  +IG R+        GSN 
Sbjct: 79  EKGVILRFGAFQEETSQGPHWHIPY-PIETLNRINVEQIRTSEIGYRNTVNNNRRFGSNV 137

Query: 128 --SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVD 185
               L+LT D+N++   F+V Y + + + YLFN+  P  TL+ VSESA+R++VG+     
Sbjct: 138 SSESLMLTKDENMIEAKFAVQYKINNVQDYLFNVVKPDTTLRHVSESAIRQIVGQNTMDY 197

Query: 186 IFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDR 245
           I    R  IA +++   Q  +D YK+G+LI T++++DA PP +V  AF +  +A +D+ R
Sbjct: 198 ILTEGRVNIADDIKIKSQSLLDKYKTGLLITTVNMQDAQPPEQVQSAFSDAVKAREDKQR 257

Query: 246 FVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLR 305
            + E+  Y+N +L  +RG+A  + E S AYK  I+ +++GE  RF  I  +Y  AP + +
Sbjct: 258 LINEAQTYANDILPKSRGKAVRMLEESKAYKSEIVSKSEGETSRFKQILAEYEKAPKVTK 317

Query: 306 KRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTKREIRWYQS 355
           +R+Y ETME +L    KV++D K + M YLP+++  +  Q   ++   +S
Sbjct: 318 ERLYRETMENVLATTSKVMVDSKTNNMMYLPIDKLINAKQANAQVTIQES 367


>gi|291287113|ref|YP_003503929.1| HflK protein [Denitrovibrio acetiphilus DSM 12809]
 gi|290884273|gb|ADD67973.1| HflK protein [Denitrovibrio acetiphilus DSM 12809]
          Length = 331

 Score =  193 bits (490), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 118/336 (35%), Positives = 191/336 (56%), Gaps = 21/336 (6%)

Query: 18  SNGNGDGLPPFDVEAIIRYIKDKFDL---IP--FFKSYGSVYIILLLIGSFCAFQSIYIV 72
           +NGNG   P  D         DKFDL   +P   F + G+  I +++I ++ A    +IV
Sbjct: 2   NNGNGGQSPWGD---------DKFDLKDKLPKMNFNAPGASVITIVVIVAWLA-SGFFIV 51

Query: 73  HPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQ-KIGGRSASVGSNS--- 128
            P E+AV  RFG     V     + + +PID V+  +V +  + ++G R+   G+ S   
Sbjct: 52  KPSEQAVVKRFGTVVKVVGSGPSYHLPYPIDSVDKAEVTKVHRLEVGFRTTRSGTKSLPQ 111

Query: 129 -GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIF 187
             L+LTGD+NIV ++ SV Y +TD   YL+N+ +  + +  ++ESA+REV GR    DI 
Sbjct: 112 ESLMLTGDENIVSINLSVQYKITDITKYLYNVHDVEDAILDITESAIREVAGREKIDDIL 171

Query: 188 RSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFV 247
            S + +I  E +  IQ  ++ Y++GI I  + ++D  PP+EV +AF +V  A +D++R++
Sbjct: 172 TSGKNRIQTETQKEIQAILNKYEAGIQITAVQLQDVEPPQEVVNAFKDVASAREDKNRYI 231

Query: 248 EESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKR 307
            E+  Y N V+  AR EA+ + + +  Y+   +  A+GE +RF S+   Y  AP + +KR
Sbjct: 232 NEAEAYQNEVIPRARAEAATMLQQAEGYQQEKVARAEGETNRFESVLKSYRAAPAVTKKR 291

Query: 308 IYLETMEGILKKAKKVIIDKK-QSVMPYLPLNEAFS 342
           +YLETME +L K+ K I D   + + P L L++A S
Sbjct: 292 LYLETMEKVLAKSDKKIFDSNIKEITPILGLDKAMS 327


>gi|303249156|ref|ZP_07335395.1| HflK protein [Desulfovibrio fructosovorans JJ]
 gi|302489429|gb|EFL49377.1| HflK protein [Desulfovibrio fructosovorans JJ]
          Length = 375

 Score =  192 bits (489), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 113/304 (37%), Positives = 172/304 (56%), Gaps = 17/304 (5%)

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVK 109
           G   I+++++        IYIV PDE  V  RFG        PG H    +P++ V+  K
Sbjct: 42  GGPKIVIIVVAILWIASGIYIVEPDEAGVVQRFGAYAYTTG-PGPHYHLPFPVETVKTPK 100

Query: 110 VIE-RQQKIG-----GRSASVGSN-----SGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
           V + R+ +IG     GR      N       L+LTGD+NIV + FSV Y + +P  YLF 
Sbjct: 101 VSQVRRVEIGFRSVYGRQGESLQNRRVPEESLMLTGDENIVDVQFSVQYQIGNPVDYLFK 160

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           +  P ETLK  +E+AMREV+G+     +  S + ++  + ++L+Q  +D Y SGI +  +
Sbjct: 161 IAQPDETLKSAAEAAMREVMGKAKIDSVLTSGKLKVQADTKDLLQYMLDRYDSGIEVTAV 220

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
            ++D  PPREV DAF +V  A +D+ R + E++ YSN +L  ARG A+ I   + AYK++
Sbjct: 221 QLQDVHPPREVVDAFKDVASAREDKSRLINEADAYSNDILPKARGRAAGIINEAAAYKEQ 280

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKK--AKKVII--DKKQSVMPY 334
            I+ A+G ADRF ++   Y  A  + R+R+Y+ETME +      +K+I+  D    V+PY
Sbjct: 281 TIRRAKGGADRFAALRDAYEKAKDVTRERLYIETMESVFDSPGVEKIILGSDAAGKVLPY 340

Query: 335 LPLN 338
           LPL 
Sbjct: 341 LPLG 344


>gi|146342416|ref|YP_001207464.1| protease activity modulator HflK [Bradyrhizobium sp. ORS278]
 gi|146195222|emb|CAL79247.1| Protease activity modulator HflK [Bradyrhizobium sp. ORS278]
          Length = 376

 Score =  192 bits (489), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 121/337 (35%), Positives = 189/337 (56%), Gaps = 18/337 (5%)

Query: 27  PFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAF--QSIYIVHPDERAVELRFG 84
           P D+E ++R  +D+         +GSV ++L+++G+   +     Y V  +E  V LRFG
Sbjct: 30  PPDLEDLLRRGQDRLQQFIPGGGFGSVGVLLIVLGAIVIWLLSGFYRVQSEELGVVLRFG 89

Query: 85  KPKNDVFLPGL-HMMFWPIDQVEIVKVIERQQ-KIG----------GRSASVGSNSGLIL 132
           K   D   PGL + + +PI+ V + K +      IG          GRS        L+L
Sbjct: 90  KYVRD-EQPGLRYHLPYPIETVLLPKALRVNSISIGFTANDDPGRRGRSGRDVPEESLML 148

Query: 133 TGDQNIVGLHFSVLYVVTDPRL--YLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQ 190
           TGD+NIV +  +VL+ +       +LFN++NP  T+K V+ESAMREV+GR     +    
Sbjct: 149 TGDENIVDVDLTVLWRIKPKGAADFLFNIQNPEGTVKAVAESAMREVIGRSNIQPVLTGA 208

Query: 191 RQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEES 250
           R QI   V  L+QKT+D Y SGI ++ + ++   PP +V  AF +VQ A  D ++   E+
Sbjct: 209 RTQIEQSVLELMQKTLDNYGSGIQVDNVQMQKVDPPAQVIAAFRDVQAARADLEKAQNEA 268

Query: 251 NKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYL 310
             Y+N+V+  ARG A+ I + +  YK++ I EA+G++ RFL +Y +Y  AP + R+RIYL
Sbjct: 269 QTYANKVVPDARGRAAQILQVAEGYKEQAIAEAKGQSARFLKVYEEYKKAPDVTRERIYL 328

Query: 311 ETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQT 346
           ETME +L  ++K+++D      +P LPL +   R Q 
Sbjct: 329 ETMERVLSGSEKLVLDGGPGGPVPLLPLGDLAPRRQA 365


>gi|317486135|ref|ZP_07944980.1| HflK protein [Bilophila wadsworthia 3_1_6]
 gi|316922620|gb|EFV43861.1| HflK protein [Bilophila wadsworthia 3_1_6]
          Length = 407

 Score =  192 bits (489), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 114/317 (35%), Positives = 180/317 (56%), Gaps = 18/317 (5%)

Query: 39  DKFDLIPFFKSY--GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLH 96
           D F  +P   +   G V  IL+ + +      IYIV+PDE  V LRFGK    V     +
Sbjct: 58  DAFKRLPHLSAPAGGKVKWILVALVAVWLLSGIYIVNPDEEGVVLRFGKYDRTVGAGPHY 117

Query: 97  MMFWPIDQVEIVKVIERQQ-KIG------GRSASVGSNSGL-----ILTGDQNIVGLHFS 144
            + +PI+ V   KV + Q+ ++G      GR+   G+N  L     +LTGD+NIV + FS
Sbjct: 118 ALPFPIETVYKPKVTQVQRVEVGFRSVGQGRTFQQGANRSLPEESGMLTGDENIVNVQFS 177

Query: 145 VLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQK 204
           V Y + +P  YLFN+ +    +K  +E+AMREV+G           + QI  E   L+Q+
Sbjct: 178 VQYQIKNPVEYLFNVTDQAAVVKNAAEAAMREVIGNSLIDSALTDGKLQIQTEATQLLQE 237

Query: 205 TMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGE 264
            +D YK G+ +  + ++D  PP+EV+DAF +V  A +D+ R + E+  Y N ++  ARG 
Sbjct: 238 ILDRYKVGVRVIAVQLQDVHPPKEVSDAFKDVASAREDKSRIINEAEAYRNELIPKARGL 297

Query: 265 ASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKA--KK 322
           A+ +   + AYK+  I+ A+GEA+RFL++  +Y  A  + ++R+YLETME IL +   +K
Sbjct: 298 AAEVENQAQAYKETRIRNAEGEANRFLALLKEYEQAKDVTKQRMYLETMEEILSRPGMEK 357

Query: 323 VIIDKKQS--VMPYLPL 337
           +++ K  +  V+P LPL
Sbjct: 358 LVLPKDAADRVLPLLPL 374


>gi|144899068|emb|CAM75932.1| Band 7 protein [Magnetospirillum gryphiswaldense MSR-1]
          Length = 384

 Score =  192 bits (488), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 109/290 (37%), Positives = 176/290 (60%), Gaps = 16/290 (5%)

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGL-HMMFWPIDQVEIVKVIE-RQQKIGGRS- 121
           A   IY V PD++ V LRFG+   D   PGL + + +P++ V + +V +  Q ++G R+ 
Sbjct: 89  AATGIYRVQPDQQGVVLRFGQ-WVDTTEPGLRYHLPYPMESVLLPQVTKINQLQLGFRAV 147

Query: 122 --ASVGSNSGL-------ILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
             +    NSG        +LTGD+NIV   F+V + + D   YLFN+ +P  T+K  +ES
Sbjct: 148 GDSRFERNSGRDVPEESRMLTGDENIVEADFTVFWQIKDAGKYLFNIRDPEGTVKVAAES 207

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           AMR+++GR         +RQ IA   +  +Q+ +D Y +GILI  + ++   PP  V DA
Sbjct: 208 AMRDMIGRNPIQAALSDKRQPIADAAKVELQRLLDSYDAGILITQVQLQKVEPPAAVIDA 267

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           F++VQRA  D++R   ES  Y N ++  ARGEA  + + + AYK++++ +AQG+  RF++
Sbjct: 268 FNDVQRARADQERARNESEAYRNDIIPRARGEAEKMVQDAEAYKEQVLNQAQGQTKRFMA 327

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK---QSVMPYLPLNE 339
           ++  +  +P +  +R+YLETME ++K + K+IID+    Q V+PYLPLN+
Sbjct: 328 LFDAWKQSPEVTERRLYLETMEDVMKGSHKIIIDQSKNGQGVVPYLPLND 377


>gi|88606975|ref|YP_505688.1| HflK protein [Anaplasma phagocytophilum HZ]
 gi|88598038|gb|ABD43508.1| HflK protein [Anaplasma phagocytophilum HZ]
          Length = 368

 Score =  192 bits (487), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 123/326 (37%), Positives = 187/326 (57%), Gaps = 17/326 (5%)

Query: 26  PPFDVEAIIRYIKDKFDLIP--FFKSYGSVYIILLLIGS---FCAFQSIYIVHPDERAVE 80
           P FD  A+   I+  F   P    KS  S   +  LIG+     A    Y V+ +E+AVE
Sbjct: 28  PQFD--ALFVGIRTAFSGFPEGGGKSSLSKIHLFFLIGAALLLYACTGFYTVNTEEKAVE 85

Query: 81  LRFGKPKNDVFLPGLHMMF-WPIDQVEIVKV-IERQQKIGG---RSASVGSNSGLILTGD 135
           L FGK  + +  PGL   F  P  QV  V+V +  ++++GG   +S   G+N G++LTGD
Sbjct: 86  LLFGK-YSGIQEPGLRYWFPKPFGQVLKVRVEMVSKEEVGGISFKSNPSGNNDGVMLTGD 144

Query: 136 QNIVGLHFSVLYVVTDPRLYLFNLEN--PGETLKQVSESAMREVVGRR-FAVDIFRSQRQ 192
           +NIV ++F + + V+D   YLFN+ +  PG T+K  +ESAMRE++G+   A  I    R 
Sbjct: 145 ENIVNINFDIQWKVSDAYNYLFNVRDARPGATVKNAAESAMREIIGKSTLAFAIEGEGRA 204

Query: 193 QIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNK 252
            IA E + L+Q  +D Y  GI + +I ++   PP +V  +F +VQ A  D++R + E+  
Sbjct: 205 AIAYETKKLLQNILDRYHMGIEVLSIQLKKVDPPEKVISSFRDVQSARADKERSINEAFA 264

Query: 253 YSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLET 312
           Y N VL  A+GEA  I+  + AYK  ++  AQG++ +F +IY +Y+N P  +R R+Y+E 
Sbjct: 265 YRNEVLPKAKGEAIRIKLDAEAYKSEVVNRAQGDSSKFQAIYKEYINQPLPVRSRMYIEA 324

Query: 313 MEGILKKAKKVII-DKKQSVMPYLPL 337
           ME +L    KVI+ D  + +  YLPL
Sbjct: 325 MEEVLSNMDKVIVTDDMKGLFSYLPL 350


>gi|288958200|ref|YP_003448541.1| membrane protease subunit [Azospirillum sp. B510]
 gi|288910508|dbj|BAI71997.1| membrane protease subunit [Azospirillum sp. B510]
          Length = 421

 Score =  192 bits (487), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 119/323 (36%), Positives = 185/323 (57%), Gaps = 13/323 (4%)

Query: 29  DVEAIIRYIKDKF--DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKP 86
           D+E ++R  +D+    +   F S   V +++ ++G       IY V  DE+ V +RFG+ 
Sbjct: 47  DLEDLLRRSQDRLRRAMPGGFGSGRGVALVVGVLGLIWLASGIYRVEADEQGVVMRFGQ- 105

Query: 87  KNDVFLPGL-HMMFWPIDQVEIVKVIE--------RQQKIGGRSASVGSNSGLILTGDQN 137
                 PGL + +  PI+ V + KV          R    GGR+     +  L+LTGD+N
Sbjct: 106 WTRTEQPGLRYRLPSPIETVLLPKVTRVNRIEVGYRSSVGGGRNDRDVPDESLMLTGDEN 165

Query: 138 IVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALE 197
           I+ + F+V +V+ D   +LF +  P  T+K+ +ESAMREV+GR          RQQI   
Sbjct: 166 IIDIDFTVFWVIKDAGNFLFKIREPEVTVKKAAESAMREVIGRTDLQPALTEARQQIETS 225

Query: 198 VRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRV 257
            R L+Q  +D Y++GI I  + ++ A PP+ V DAF++VQRA  D +R   E+  Y N +
Sbjct: 226 TRQLLQTMLDEYQAGIEITQVQLQKADPPQPVIDAFNDVQRARADRERARNEAEAYRNDI 285

Query: 258 LGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGIL 317
           +  ARGEA  + + + AY+++++  AQG+ADRF  +Y  Y  +  +  KR+YLETME IL
Sbjct: 286 IPRARGEAERLVQEASAYREQVVSLAQGDADRFRKVYEAYALSKEVTAKRMYLETMEEIL 345

Query: 318 KKAKKVIID-KKQSVMPYLPLNE 339
           +   K+I+D   Q+V+PYLPLN+
Sbjct: 346 RGRNKIIVDGSAQNVVPYLPLNQ 368


>gi|254488442|ref|ZP_05101647.1| HflK protein [Roseobacter sp. GAI101]
 gi|214045311|gb|EEB85949.1| HflK protein [Roseobacter sp. GAI101]
          Length = 406

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 106/311 (34%), Positives = 171/311 (54%), Gaps = 21/311 (6%)

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIV 108
           + G++ +  L         S Y V P+++++EL  GK  + +   GL+   WP    E+ 
Sbjct: 88  TRGTIGLGALAAVVVWGMASFYTVRPEQQSIELFLGK-FSSIGTEGLNFAPWPFVTAEVF 146

Query: 109 KVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
            V   + +  G   S G N GL+LT D+NIV + F V++ V + R + F+L +P  +++ 
Sbjct: 147 DVTTNRAETIGAGRSGGDNEGLMLTTDENIVDIDFQVVWNVKNARDFKFSLRDPNASVRA 206

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
           +SESAMRE++ +     I    R  I    R LIQ T+D  ++GI I  ++     PPR+
Sbjct: 207 ISESAMREIIAQSELAPILNRDRATIEATARELIQTTLDNRQTGINIIRVNFNKVDPPRQ 266

Query: 229 ---------------VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
                          V DAF +VQ AEQ+ DR   +++ Y+N+    ARGE++ + E++ 
Sbjct: 267 TVTVTDAQGNTSQESVIDAFRDVQAAEQERDRVERQADAYANQRTAEARGESARLLEAAE 326

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK----- 328
            Y+ R++ +A GEA RF ++  +Y +AP + RKR+Y+ETME +L    K+I++       
Sbjct: 327 GYRARVVNDAVGEASRFEAVLREYASAPDVTRKRLYIETMEKVLGDVDKIILENSSEGGG 386

Query: 329 QSVMPYLPLNE 339
           Q V+PYLPLNE
Sbjct: 387 QGVVPYLPLNE 397


>gi|114775550|ref|ZP_01451118.1| HflK-like protein [Mariprofundus ferrooxydans PV-1]
 gi|114553661|gb|EAU56042.1| HflK-like protein [Mariprofundus ferrooxydans PV-1]
          Length = 373

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 107/309 (34%), Positives = 176/309 (56%), Gaps = 10/309 (3%)

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEI 107
           S G +   L L+         Y V  DE A+ LRFG+       PGL+    +P++ V+ 
Sbjct: 66  SKGMITGFLALVMLVWGVSGFYKVAADEEAIVLRFGQ-HVATKGPGLNWHIPYPVETVQK 124

Query: 108 VKVIERQ-QKIGGRSASVGS-----NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
           + V   Q Q+IG R  + G+     N  L+LT D+NIV + F V Y +     YLFN++N
Sbjct: 125 LPVTSIQRQEIGFRHFADGTLRKRTNESLMLTKDENIVDISFIVQYKIKSAEDYLFNIDN 184

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P +T++  +ESA+REV+GR    D+  +++ ++ +E   LIQ  +D Y +GI + T+ ++
Sbjct: 185 PEKTVRDAAESAIREVIGRTLIDDVLTTKKAEVEVETEQLIQSILDSYSAGISVTTVKLQ 244

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
           D  PP  V   F +V  A +D++R   E+  Y+N +   +RGEA  I   +  Y   +++
Sbjct: 245 DVQPPERVIKEFKDVASAREDKERAKNEAQAYANDITPKSRGEAKKIVLEAQGYAKEVVE 304

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
           +A+GEA RF S+   Y  AP + RKR+YL+TM+ ++  A KVI+D    ++V+PYLPL++
Sbjct: 305 KAKGEASRFDSLLAAYRQAPEVTRKRLYLDTMQEVMTNADKVIVDGSVAKNVLPYLPLDK 364

Query: 340 AFSRIQTKR 348
             ++ +  +
Sbjct: 365 QPAKAEVTK 373


>gi|27381620|ref|NP_773149.1| membrane bound protease protein [Bradyrhizobium japonicum USDA 110]
 gi|27354788|dbj|BAC51774.1| bll6509 [Bradyrhizobium japonicum USDA 110]
          Length = 380

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 133/354 (37%), Positives = 199/354 (56%), Gaps = 28/354 (7%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFD-LIP--FFKSYGSVYIILLLIGSFCAFQSIYIVH 73
           GS     G  P D+E ++R  +D+   ++P  +F   G   IIL++I +F      + V 
Sbjct: 20  GSGPQPVGPRPPDLEDLLRRGQDRLQQIMPGGYFSGVGITLIILIII-AFWLLSGFFRVQ 78

Query: 74  PDERAVELRFGKPKNDVFLPGL-HMMFWPIDQVEIVKVIERQQ-KIG----------GRS 121
            +ER V LRFGK    V  PGL + + +PI+ V + K +      IG          GRS
Sbjct: 79  SEERGVVLRFGKHVRTVD-PGLNYHLPYPIETVLLPKALRVNTISIGMTLIDDPARRGRS 137

Query: 122 ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRL----YLFNLENPGETLKQVSESAMREV 177
                   L+LTGD+NIV + F+VL+ +         +LFN++NP  T+K V+ESAMREV
Sbjct: 138 IRDVPEESLMLTGDENIVDVDFTVLWRIKPDTGGVGDFLFNIQNPEGTVKAVAESAMREV 197

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           +GR     I    R      V+ LIQKT+D Y +GI I+ + ++   PP +V DAF +VQ
Sbjct: 198 IGRSQIQPILTGARNVTEQGVQELIQKTLDSYGAGIQISQVQMQKVDPPAQVIDAFRDVQ 257

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
            A  + ++   E+  Y+N+V+  ARG A+ I +++  YK++ + EA+G++ RFL +Y +Y
Sbjct: 258 AARANLEQLQNEAQTYANQVVPQARGRAAQIMQAAEGYKEQAVAEAKGQSSRFLKVYEEY 317

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVIID---KKQSVMPYLPLNEAFSRIQTKR 348
             AP + R+RIYLETME +L  A K++ D     Q V+PYLPL E    + TKR
Sbjct: 318 KKAPEVTRERIYLETMERVLGGADKLVYDGGPSGQGVVPYLPLGE----LTTKR 367


>gi|323699199|ref|ZP_08111111.1| HflK protein [Desulfovibrio sp. ND132]
 gi|323459131|gb|EGB14996.1| HflK protein [Desulfovibrio desulfuricans ND132]
          Length = 375

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 121/352 (34%), Positives = 196/352 (55%), Gaps = 28/352 (7%)

Query: 7   NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAF 66
           N DW   +       G   P FD        +D+ + +  FK  G  ++I + I  + A 
Sbjct: 22  NWDWDKLQKQQQGRPGGKPPSFDD------FQDQLEKLKKFKLPGWKFVIPIFILLWIA- 74

Query: 67  QSIYIVHPDERAVELRFGK-PKNDVFLPGLHMMFWPIDQVEIVKVIE-RQQKIGGRSASV 124
              YIV PDE  V  +FGK  +     P  H+ + P++ V   KV + R+ + G RS   
Sbjct: 75  SGFYIVEPDEVGVVKQFGKFNRVTTAGPNYHIPY-PVESVLTPKVTQIRRIEFGFRSVGP 133

Query: 125 GSNS------------GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
            + S             L+LTGD+NIV + F V Y++ D + YLFN+ +P +TL    E+
Sbjct: 134 VTQSFQQGSSREVKEESLMLTGDENIVSVQFIVQYMIKDAQNYLFNVNDPEQTLAHAGEA 193

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           AMREV+G     D   + +Q+I ++ R L+Q+ +D YK+G+ +  + +++  PP EV +A
Sbjct: 194 AMREVIGNGKIDDALTTGKQEIQVQTRELMQRILDNYKTGLSVVAVQMQNVHPPDEVIEA 253

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           F +V  A +D+ R++ E+  Y   +L  ARGEA+ I  ++ AYK+  +++++G+A RFLS
Sbjct: 254 FKDVASAREDKSRYINEAEAYQRDILPKARGEAARITNAAQAYKEAKVRKSEGDAARFLS 313

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKK--AKKVIIDK---KQSVMPYLPLNE 339
           +  +Y  A  + R+R+YLETME IL     +K+++ +   KQSV PYLPL++
Sbjct: 314 VLREYEKAKDITRERLYLETMEAILANPDTEKLVMSEDALKQSV-PYLPLDK 364


>gi|86749160|ref|YP_485656.1| HflK protein [Rhodopseudomonas palustris HaA2]
 gi|86572188|gb|ABD06745.1| HflK protein [Rhodopseudomonas palustris HaA2]
          Length = 390

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 123/340 (36%), Positives = 190/340 (55%), Gaps = 25/340 (7%)

Query: 27  PFDVEAIIRYIKDKFD-LIP--FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRF 83
           P D+E ++R  +D+   L+P  +F   G + I +L   +       + V  +E  V LRF
Sbjct: 32  PPDLEDLLRRGQDRLQQLLPGGYFSGLG-IAIAVLGALTIWGLSGFFRVQSEELGVVLRF 90

Query: 84  GKPKNDVFLPGL-HMMFWPIDQVEIVKVIERQQ-KIG----------GRSASVGSNSGLI 131
           GK    V  PGL + + +PI+ V + K +      IG          G +        L+
Sbjct: 91  GKHVRTV-QPGLNYHLPYPIETVLLPKALRVSTISIGMTMINDPARRGTTVRDVPEESLM 149

Query: 132 LTGDQNIVGLHFSVLYVVTDPRL--YLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           LTGD+NIV + F+VL+ +    +  +LFN++NP  T+K V+ESAMREV+GR     I   
Sbjct: 150 LTGDENIVDVDFAVLWRIKPDGVGNFLFNIQNPEGTVKAVAESAMREVIGRSNIQPILTG 209

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I   V+ L+QKT+D Y +G+LI  + ++   PP +V DAF +VQ A  D +R   E
Sbjct: 210 ARTTIEGGVQELMQKTLDGYGAGVLIQQVQMQKVDPPLQVIDAFRDVQAARADLERLQNE 269

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+NRV+  A+G  + I +++  YK + + EA+G++ RFL +Y +Y  AP + R+RIY
Sbjct: 270 AQTYANRVIPDAKGRGAQIIQAAEGYKGQAVAEAKGQSARFLDVYEEYRKAPDVTRQRIY 329

Query: 310 LETMEGILKKAKKVIID------KKQSVMPYLPLNEAFSR 343
           LETME +L  A+K++ D        Q ++PYLPL+E   R
Sbjct: 330 LETMERVLGPAEKLVYDSGSGPGGGQGIVPYLPLSELSPR 369


>gi|254495926|ref|ZP_05108834.1| protease subunit HflK [Legionella drancourtii LLAP12]
 gi|254354804|gb|EET13431.1| protease subunit HflK [Legionella drancourtii LLAP12]
          Length = 379

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 120/349 (34%), Positives = 189/349 (54%), Gaps = 34/349 (9%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI-----------PFFKSYGS 52
           DK    W+          G   PP D++  ++ I DK   I           P   S G 
Sbjct: 7   DKGKEPWK----------GKNQPP-DLDEALKRINDKLKKILFGGSGKSGNEPSKTSNGG 55

Query: 53  VYIILLLIGSFC--AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
           +  I++++ +F       I+IV P E+AV LRFG+    V  PG H   W I ++   K+
Sbjct: 56  LVAIMVILSAFLLWVLSGIFIVDPAEQAVILRFGEYVETVG-PGPH---W-IPRIISSKI 110

Query: 111 IERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
           I    ++   S S       +LT D+N+V +  +V Y + D + YLFN+ NP E+L+Q +
Sbjct: 111 IMNVDRVLDHSYS-----AQMLTSDENLVAVSLAVQYRIGDLQQYLFNVANPEESLQQAT 165

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
            SA+R+VVG      I    R+    +V+  + KT+D YK+GI+I  +S + A  P  V 
Sbjct: 166 SSALRQVVGTTTLDQIITEGREVWGNQVQETLVKTLDLYKTGIVIVNVSPQPARAPESVQ 225

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
           DAFD+  +A++DE RF E++  Y+ +V+  A G AS I++ + A+  +++  AQGE   F
Sbjct: 226 DAFDDAIKAQEDEKRFKEQAYAYAAKVVPIAEGNASRIQQEAEAFSKQVVLRAQGEVAEF 285

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           L++  QY  AP +  +R+YLETM+ +L K+ K+I+D K S + YLPL +
Sbjct: 286 LALLPQYTAAPAITAQRMYLETMQTVLNKSSKIIVDSKSSNLMYLPLGK 334


>gi|34498767|ref|NP_902982.1| transmembrane protein HflK [Chromobacterium violaceum ATCC 12472]
 gi|34104618|gb|AAQ60976.1| probable transmembrane protein HflK [Chromobacterium violaceum ATCC
           12472]
          Length = 341

 Score =  189 bits (481), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 112/300 (37%), Positives = 167/300 (55%), Gaps = 19/300 (6%)

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVK 109
           G + I+ L  G       IY V PDE+ V  RFG+   D    GLH    WP++ +++ K
Sbjct: 41  GMIAILWLASG-------IYRVEPDEQGVVQRFGR-WTDTTAAGLHYHLPWPMETIQLPK 92

Query: 110 VIE-RQQKIG-----GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           V + +Q K+      G   +       +LTGD+NI+    +V + + D   +LF    P 
Sbjct: 93  VTQIKQLKLANLYESGPPDAADPREKQMLTGDENIIEADCAVFWRIKDAGRFLFRANKPE 152

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           E L+  +E A+REV+ R        ++RQQ+A E R LIQ+ +D  ++GILI  + ++  
Sbjct: 153 EALRITAEGALREVISRTPIQAAMSNRRQQVAEEARELIQQRLDAQQAGILITQVQLQRV 212

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP  V DAF++VQRA  D++R   E+  YSN +L  ARGEA  IR+ + AY+ +++  A
Sbjct: 213 DPPAAVIDAFNDVQRARADQERARNEAQAYSNDILPKARGEAERIRQEAEAYRSQVVNLA 272

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID----KKQSVMPYLPLNE 339
           QGEA RF S+Y  Y  A  +   R+YLE+M+ +LKKA KV+ID        V+P L L +
Sbjct: 273 QGEARRFDSVYQTYAQAKDVTAWRLYLESMDDMLKKASKVVIDGSGKSGAGVLPLLQLQD 332


>gi|294340460|emb|CAZ88841.1| Protein hflK [Thiomonas sp. 3As]
          Length = 439

 Score =  189 bits (480), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 115/327 (35%), Positives = 185/327 (56%), Gaps = 18/327 (5%)

Query: 19  NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAFQS-IYIVHPDER 77
           +GNG G PP            + DL P  K  G   IIL++IG      S  +IV   ++
Sbjct: 59  SGNGGGTPP-----------QRPDLYPSAKGMGVGVIILVVIGVLGWLSSGFFIVQEGQQ 107

Query: 78  AVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE-RQQKIG--GRSASVGSNSGLILT 133
           A   RFGK    +   G H    +P +  EIV V + R  ++G  G   + G     +LT
Sbjct: 108 AAVTRFGKLAY-ITDAGFHWRLPYPFEADEIVNVSQVRSVEVGRGGEVKATGLPESAMLT 166

Query: 134 GDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQ 193
            D+NIV + F+V Y + +   YL+N  +P + + Q +E+A+REVVG +    +    R+Q
Sbjct: 167 KDENIVDVRFAVQYRIDNVVDYLYNNRSPDDAVSQAAETAVREVVGNKTLDYVLYEGREQ 226

Query: 194 IALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKY 253
           +A +V+ L QK +D YK+GI+I T+++++  PP +V  AFD+  +A QD +R   E+  Y
Sbjct: 227 VASDVQVLTQKILDRYKTGIIITTVTLQNVQPPEQVQAAFDDAIKAGQDRERLKNEAQAY 286

Query: 254 SNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETM 313
           +N V+  A+G AS + + + AYK +++ +AQG+  RF  I  QY  AP + R+R+YL+TM
Sbjct: 287 ANNVIPRAQGTASRLIQDAEAYKAQVVAQAQGDTSRFDQILQQYEKAPQVTRERMYLQTM 346

Query: 314 EGILKKAKKVIID-KKQSVMPYLPLNE 339
           + IL    KV++D +  + + Y+PL++
Sbjct: 347 QDILSSVSKVMVDSRNNNNLLYMPLDK 373


>gi|218677845|ref|ZP_03525742.1| HflK protein [Rhizobium etli CIAT 894]
          Length = 163

 Score =  189 bits (480), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 84/153 (54%), Positives = 122/153 (79%)

Query: 187 FRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRF 246
           FRS RQ I ++V N++Q TM+ Y +G+ +  ++I++ +PPREVADAF+EVQRA +D D  
Sbjct: 2   FRSNRQPIEVDVLNIVQDTMNRYGAGVTVTGVTIQNVAPPREVADAFEEVQRAGRDRDST 61

Query: 247 VEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRK 306
           +E++N+Y+N+ LG ARG+A+ IRE + AYKDR+++EA+GEA RF +I  +Y  AP + RK
Sbjct: 62  IEDANRYTNQKLGQARGDAARIREDAAAYKDRVVKEAEGEAQRFTAINDEYSKAPEVTRK 121

Query: 307 RIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           R+++ETME +LK +KKVIID+KQ V+PYLPLNE
Sbjct: 122 RLFIETMEQVLKNSKKVIIDEKQGVLPYLPLNE 154


>gi|325982760|ref|YP_004295162.1| HflK protein [Nitrosomonas sp. AL212]
 gi|325532279|gb|ADZ27000.1| HflK protein [Nitrosomonas sp. AL212]
          Length = 392

 Score =  189 bits (479), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 109/297 (36%), Positives = 176/297 (59%), Gaps = 6/297 (2%)

Query: 48  KSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVE 106
           +S GS+ +IL L+         YIV    R V LRFG+   D    GL   F +P+++VE
Sbjct: 55  QSSGSIILILGLLVVVWLGSGFYIVDEGHRGVVLRFGQ-YVDTSSAGLRWHFPYPVERVE 113

Query: 107 IVKVIE-RQQKIGGRSA--SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           +V V + R  +IG R+   S      L+LT D+NI+ + F+V Y++ DP  +LFN  NP 
Sbjct: 114 VVNVSQVRTVEIGYRNNVRSKVLREALMLTDDENIIDIQFAVQYILNDPEDFLFNNRNPD 173

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           E + Q +E+A+R+V+G+     +    R+Q+A     L+QK +D Y+ GILI+ +++++A
Sbjct: 174 EAVLQAAETAIRQVIGKSKMDFVLYEGREQVAANATQLMQKILDRYEIGILISRVTMQNA 233

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP +V  AFD+  +A QD +R   E   Y+N V+  A G A+ + + S  YK R+I  A
Sbjct: 234 QPPEQVQAAFDDAVKAGQDRERQKNEGQAYANDVIPRAAGNAARLIQESEGYKQRVIVSA 293

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNE 339
           +G+A RF  I  +Y  AP + R+R+YL+ M+ +L    K+++D+K  + + YLPL++
Sbjct: 294 EGDASRFEQILTEYSKAPNVTRERLYLDMMQQVLSNTSKIVVDQKNGNNLLYLPLDK 350


>gi|114570574|ref|YP_757254.1| HflK protein [Maricaulis maris MCS10]
 gi|114341036|gb|ABI66316.1| protease FtsH subunit HflK [Maricaulis maris MCS10]
          Length = 379

 Score =  189 bits (479), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 110/292 (37%), Positives = 173/292 (59%), Gaps = 14/292 (4%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIER 113
           I+L+L+G + A    Y V  ++  V LRFG+       PG H     PI+ VE+ +V   
Sbjct: 82  IVLILVGIWFATTGWYQVGANQAGVVLRFGEYTRTTS-PGFHFKLPSPIETVELPEVTTT 140

Query: 114 QQKIGGRSASVGSN-SGLILTGDQNIVGLHFSVLYVV-----TDPRLYLFNLENPGETLK 167
                  S ++G   +G +LT D+NIV + F+V + V        R +LFN+ NP  T+ 
Sbjct: 141 N------SITIGQGPAGQMLTRDENIVDIDFAVQWRVDLGYQEGVRDFLFNVRNPEGTVA 194

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
            V+ESAMREVVG      I    R +++   R ++Q T++ Y +GI I  +++ +A PP 
Sbjct: 195 AVAESAMREVVGTSDLQFIITEGRAEVSRRTREILQATLNEYDAGIEILQVNLRNAEPPE 254

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
            V DAF  V  A+Q+ +R   ++  ++NRV+  ARG A+ + + + AY+D +I EAQG+A
Sbjct: 255 RVIDAFRGVDIAQQEAERAQLDATAHANRVIPEARGVAAQLTQEAQAYRDNVIAEAQGDA 314

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           DRF++IY +YV AP + R+R+YLETME +L ++  +I+D     +PYLPL++
Sbjct: 315 DRFVAIYEEYVQAPDVTRRRMYLETMERVLGESDLMILDGDAGALPYLPLDQ 366


>gi|88810494|ref|ZP_01125751.1| hflK protein [Nitrococcus mobilis Nb-231]
 gi|88792124|gb|EAR23234.1| hflK protein [Nitrococcus mobilis Nb-231]
          Length = 411

 Score =  189 bits (479), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 107/294 (36%), Positives = 168/294 (57%), Gaps = 12/294 (4%)

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQ-KIG----- 118
               YIV    R +  RFGK      LPG H    +PI+QV  V   +R++  IG     
Sbjct: 80  LSGFYIVDQGWRGLVTRFGK-YTATTLPGPHWHLPYPIEQVSQVNAEQRRRLTIGYGVIG 138

Query: 119 -GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
            GR+  V S + L+LT D+NIV +  +V Y V+DP  Y+FN  +  +TLK V+ESA+REV
Sbjct: 139 PGRARPVLSEA-LMLTEDENIVNVQLAVQYHVSDPAKYVFNFSDADQTLKDVTESALREV 197

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           +G+     +    R ++A E +++I+  +D Y+ G+ + T++I+D  PP +V  AF +V 
Sbjct: 198 IGKHDMDFVLTRGRAEVAAETQSMIESIIDRYELGLEVVTVAIQDIRPPEQVQSAFSDVN 257

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           +A +DE R + ++  Y N VL  A+GEA+ I E +  Y+   I  A+G+  RF  I  +Y
Sbjct: 258 KAREDEQRLINQAQSYRNAVLPKAQGEAARISEQAAGYRAEAIARAEGDTSRFSQIASEY 317

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMP--YLPLNEAFSRIQTKRE 349
             AP + R+R+YLETMEG+     KV++   +   P  YLPL+    R +++++
Sbjct: 318 AKAPEITRERLYLETMEGVFSSVGKVVVSDTKGGQPFMYLPLDRMLERARSQQQ 371


>gi|163856338|ref|YP_001630636.1| hypothetical protein Bpet2027 [Bordetella petrii DSM 12804]
 gi|163260066|emb|CAP42367.1| putative membrane protein [Bordetella petrii]
          Length = 425

 Score =  188 bits (478), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 109/282 (38%), Positives = 175/282 (62%), Gaps = 18/282 (6%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHM-MFWPIDQVEIVKVIE-RQQKIGGRSASVGS- 126
           +IV   + AV  +FGK K+    PG    + +PI   E V + + R  ++G R +S    
Sbjct: 96  FIVQEGQVAVVTQFGKYKSTA-APGFQWRLPYPIQNAETVNISQLRTFEVGFRGSSRNKV 154

Query: 127 -NSGLILTGDQNIVGLHFSVLYVVTDPRL-------YLFNLENPGETLKQVSESAMREVV 178
               L+LT D+NIV + F V Y     RL       YLFN+ +P E+++Q +E+AMRE+V
Sbjct: 155 LPEALMLTTDENIVDMQFVVQY-----RLRADGAPDYLFNMRDPDESVRQAAETAMREIV 209

Query: 179 GRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQR 238
           G++    +    R ++A+EV+NL+Q+ +D Y+SGI ++T++I++  PP +V  AFD+  +
Sbjct: 210 GKKPMDFVLYEGRTEVAVEVQNLMQQILDRYQSGIQVSTVAIQNVQPPEQVQAAFDDAVK 269

Query: 239 AEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYV 298
           A QD +R + E   Y+N+V+  A G+AS + E +  YK ++I +A+G+A RF SI  +Y 
Sbjct: 270 AGQDRERQINEGQAYANQVIPMAGGQASRMLEQAEGYKAKVIGDARGDAARFTSILAEYE 329

Query: 299 NAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
            AP ++R+R+YLETM+ I  +A KV++D K S  M YLPL++
Sbjct: 330 KAPKIMRERMYLETMQQIFSRASKVMVDTKNSNNMLYLPLDK 371


>gi|163793364|ref|ZP_02187339.1| HflK [alpha proteobacterium BAL199]
 gi|159181166|gb|EDP65681.1| HflK [alpha proteobacterium BAL199]
          Length = 346

 Score =  188 bits (478), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 115/309 (37%), Positives = 172/309 (55%), Gaps = 19/309 (6%)

Query: 55  IILLLIGSFCA---FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKV 110
           II+L I +  A   F  +Y V P+++ V L FGK       PGLH  +  PI  V +  V
Sbjct: 22  IIILGIAALLAVWLFSGLYRVQPNQQGVALVFGKFNGVPTEPGLHWNWPSPIGDVFLPNV 81

Query: 111 -IERQQKIGGRSASVGSN-----------SGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
            +E + +IG RS   GS+              ++TGD+N+V + F V + ++D   YLF 
Sbjct: 82  TLENRIEIGFRSTGDGSSRTSSSVRDVPEESQMITGDENLVDIDFVVFWRISDASKYLFA 141

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           +  P +T+K  +E+ MR+++G     D    +R  I  + + L+QK +D Y +GI I  +
Sbjct: 142 MREPDQTVKVAAEAVMRDIIGGTRIQDALTDRRGPIETDAQILLQKLVDEYGAGIEIRQV 201

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
            + +  PP +V DAF+EV RA+QD +R   E+  Y N V+  ARGE + I E + AY+  
Sbjct: 202 QLLEVDPPGQVIDAFNEVSRAKQDLERMKNEAEAYRNDVVPRARGEGAQIVEQADAYRQE 261

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS---VMPYL 335
           ++  AQG+ +RF S+Y  Y  +  +  KRIYLET+E +LK   KVIID   S   V+PYL
Sbjct: 262 VVNRAQGDGNRFDSVYQAYTQSKDITTKRIYLETLEEVLKNVNKVIIDDSASGSGVVPYL 321

Query: 336 PLNEAFSRI 344
           PL E   R+
Sbjct: 322 PLPEVQRRM 330


>gi|152996643|ref|YP_001341478.1| HflK protein [Marinomonas sp. MWYL1]
 gi|150837567|gb|ABR71543.1| HflK protein [Marinomonas sp. MWYL1]
          Length = 414

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 109/276 (39%), Positives = 159/276 (57%), Gaps = 17/276 (6%)

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLHM---MFWPIDQVEIVKVIERQQKIGGRSASV 124
            +Y V   ER V LR GK  + V +PGLH    M   + +V + KV     K        
Sbjct: 107 GVYQVDQQERGVVLRLGKYHSTV-MPGLHWNPPMIDSVSKVNVTKVRSHDHK-------- 157

Query: 125 GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAV 184
                L+LT D  IV +  SV Y V DP+ +L N+ NP E+L QV+ESA+R VVG     
Sbjct: 158 ----ALMLTVDDAIVEVGVSVQYSVQDPKDFLLNVRNPEESLAQVTESALRHVVGSSEMD 213

Query: 185 DIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDED 244
            I    R+ +A EV+  IQ   D Y +G+LI+ +++E+   P +V +AFD+V +A++DE 
Sbjct: 214 QILTEGRELLATEVKARIQDYSDAYGTGLLISKVNVENTQAPTQVQEAFDDVIKAKEDEL 273

Query: 245 RFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLL 304
           R   E+  Y+N ++  ARG A  IRE + AY+  I+  A G+ADRF  +Y +Y  AP + 
Sbjct: 274 RVRNEAESYANGIIPEARGRAQRIREEAEAYRSEIVARASGQADRFDRLYREYTKAPDVT 333

Query: 305 RKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNE 339
           R+R+Y+ETME + K   KV++D K  + M YLPL++
Sbjct: 334 RRRLYIETMESVYKDVNKVVVDTKGGNNMMYLPLDQ 369


>gi|94987117|ref|YP_595050.1| membrane protease subunits, stomatin/prohibitin homologs [Lawsonia
           intracellularis PHE/MN1-00]
 gi|94731366|emb|CAJ54729.1| membrane protease subunits, stomatin/prohibitin homologs [Lawsonia
           intracellularis PHE/MN1-00]
          Length = 383

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 107/287 (37%), Positives = 167/287 (58%), Gaps = 16/287 (5%)

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE-RQQKIGGRSASVGSN 127
           IYIV+PDE+ V L+FGK    V     + + +PI+ V   KV + R+ ++G RS S+G  
Sbjct: 80  IYIVNPDEQGVVLQFGKYNRTVDAGPHYALPYPIETVYKPKVTQVRRVEVGFRSTSLGGT 139

Query: 128 -----------SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMRE 176
                         +LTGD+NIV + FSV Y + +P  YLFN+ NP   +K  +E+AMRE
Sbjct: 140 FQQGATRTLPEEASMLTGDENIVNVQFSVQYQINNPVEYLFNVTNPTAVIKSAAEAAMRE 199

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
           V+G           + QI  E   L+Q+ +D YK GI +  + ++D  PP+EV+D+F +V
Sbjct: 200 VIGNSMIDSALTDGKLQIQNEATELLQEILDRYKVGIHVLAVQLQDVHPPKEVSDSFKDV 259

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
             A +D+ R + E+  Y N ++  ARG A+ I   + AYK+  I+ A+GE  +F ++  +
Sbjct: 260 ASAREDKSRIINEAEAYRNELIPKARGLATEIENKAQAYKETRIRNAKGETAKFQALLLE 319

Query: 297 YVNAPTLLRKRIYLETMEGILKKA--KKVIIDKKQS--VMPYLPLNE 339
           Y  A  + +KR+YLE MEGIL +   +K+I+D K +   +P LPL++
Sbjct: 320 YNQAKEITKKRMYLEAMEGILSQPGIEKIILDNKVAGKALPLLPLSQ 366


>gi|307945912|ref|ZP_07661248.1| HflK protein [Roseibium sp. TrichSKD4]
 gi|307771785|gb|EFO31010.1| HflK protein [Roseibium sp. TrichSKD4]
          Length = 394

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 119/313 (38%), Positives = 178/313 (56%), Gaps = 23/313 (7%)

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVK-VIERQ 114
           I+ ++G+       Y V   E  VEL  G+   D   PGL+   WP    E+ K  ++R 
Sbjct: 80  IIAVVGAVWLASGFYRVDEGEVGVELVLGE-VTDQTTPGLNYN-WPYPIGEVYKPTVQRL 137

Query: 115 QKI---------GG--RSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRL----YLFNL 159
           +++         GG  R+  V   S L+LTGD+NIV + F V + + + R     +LFN+
Sbjct: 138 RELTVGVEEFVTGGAIRTRDVPQES-LMLTGDENIVDVGFKVQWRIKNTREGISNFLFNI 196

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
           +NP  T+K V+ESAMREVVG      I    R  I  +V  L+Q+T+D Y +GI I  + 
Sbjct: 197 QNPEGTVKAVAESAMREVVGSSNIDSILTENRVAIQNDVDQLMQETLDSYLAGIEITEVQ 256

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
           ++   PP +V DAF +VQ A  D++R   E+  Y+NR +  ARGEA+ + E++ AY+++ 
Sbjct: 257 MQKVDPPSQVIDAFRDVQAARADQERIQNEAQAYANRRVPEARGEAARVLEAANAYREQT 316

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK----KQSVMPYL 335
           I EA G++ RF  IY QY  AP + R+R+YLET+E +L    K+IID     +Q V+P+L
Sbjct: 317 IAEATGQSQRFTKIYEQYEKAPEVTRERLYLETLEKVLGANNKIIIDSQAGGQQGVLPFL 376

Query: 336 PLNEAFSRIQTKR 348
           PLN+   R  + R
Sbjct: 377 PLNDFAPRGTSAR 389


>gi|254440743|ref|ZP_05054236.1| HflK protein [Octadecabacter antarcticus 307]
 gi|198250821|gb|EDY75136.1| HflK protein [Octadecabacter antarcticus 307]
          Length = 412

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 118/322 (36%), Positives = 182/322 (56%), Gaps = 33/322 (10%)

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIV 108
           + G V + LL   +   F S+Y V P++R+VEL  G+  + +   GL+   WPI   EIV
Sbjct: 83  TRGMVGLGLLAAVALWLFTSVYTVRPEQRSVELFLGE-FSAIGESGLNFAPWPIVTYEIV 141

Query: 109 KVI-ERQQKIG--------GRSASVGS----NSGLILTGDQNIVGLHFSVLYVVTDPRLY 155
            V  ER  +IG        G S +V S    + GL+LTGD+NIV + F V++ + +P  +
Sbjct: 142 NVSQERVIEIGEEEVPAQLGDSRAVQSQLEADIGLMLTGDENIVDIDFQVVWNIPEPDKF 201

Query: 156 LFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILI 215
           LFNL +P  T+  V+ESAMRE++       + R +R  I   ++ L Q T++ Y SG+ I
Sbjct: 202 LFNLADPETTITAVAESAMREIIATSELASLNR-ERAVIRERLQELTQSTLNSYDSGVNI 260

Query: 216 NTISIEDASPPREVA---------------DAFDEVQRAEQDEDRFVEESNKYSNRVLGS 260
             I++++A PP                   DAF +VQ AEQ+  +   +++ Y+NRV   
Sbjct: 261 VRINLDEADPPATQVQVIDIDGNQRLTSPLDAFRDVQDAEQERIQLQNQADAYANRVTAG 320

Query: 261 ARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKA 320
           ARG A+ I E++  Y+ R++ EA+GEA RFL++  +Y  AP + R+R+YLET+E I   A
Sbjct: 321 ARGNAAQIVEAAEGYRARVVNEAEGEASRFLAVLNEYSKAPEVTRQRLYLETVEAIFGSA 380

Query: 321 KKVIIDKKQ---SVMPYLPLNE 339
             +++D       V+PYLPL+E
Sbjct: 381 DIILLDDNAGGGGVVPYLPLDE 402


>gi|56476103|ref|YP_157692.1| Band 7 protein [Aromatoleum aromaticum EbN1]
 gi|56312146|emb|CAI06791.1| Band 7 protein [Aromatoleum aromaticum EbN1]
          Length = 419

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 109/293 (37%), Positives = 168/293 (57%), Gaps = 13/293 (4%)

Query: 44  IPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFL----PGLHMMF 99
           I F +  G +  +L LI         YIV  ++R V LRFG      F+    PGL    
Sbjct: 70  ISFRQFGGGIGALLALIFIVWLASGFYIVDANQRGVVLRFGN-----FVQTTDPGLRWRL 124

Query: 100 -WPIDQVEIVKVIE-RQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVVTDPRLY 155
            +PI+  EIV +   R  ++G R           L+LT D+NI+ + F+V YV++ P  Y
Sbjct: 125 PYPIESNEIVDLTGVRTVEVGYRGTERNKVLRESLMLTDDENIINIQFAVQYVLSSPENY 184

Query: 156 LFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILI 215
           LFN   P E++ Q +ESAMRE+VGR     +    R+QIA     LIQK +D Y++GI +
Sbjct: 185 LFNNRFPDESVIQAAESAMREIVGRSKMDFVLYEGREQIAASAHELIQKILDRYETGIQV 244

Query: 216 NTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAY 275
           + +++++A PP +V  AFD+  +A QD +R   E   Y+N V+  ARG AS + E + AY
Sbjct: 245 SRVTMQNAQPPEQVQAAFDDAVKAGQDRERARNEGEAYANDVIPRARGTASRLIEEANAY 304

Query: 276 KDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK 328
           ++R++  A+GEA RF  +  +Y  AP + R+R+YL+TM+ ++  + KV++D K
Sbjct: 305 RERVVANAEGEASRFTQVLEEYRRAPEVTRERMYLDTMQHVMSNSSKVMVDAK 357


>gi|330939872|gb|EGH43100.1| HflK [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 346

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 98/285 (34%), Positives = 176/285 (61%), Gaps = 12/285 (4%)

Query: 57  LLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQK 116
           L+++ +F  + +IY+V   E+AV LRFG+  ++   PGL++ F P D+ + ++ + R++ 
Sbjct: 23  LVVLVAFWLYSAIYVVDEQEQAVVLRFGQ-YHETVGPGLNIYFPPFDR-KYMENVTRERA 80

Query: 117 IGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMRE 176
                    S  G +LT D+NIV +  +V Y ++D + ++ N++ P  +L+  +ESA+R 
Sbjct: 81  Y--------SKQGQMLTEDENIVEVPLTVQYKISDLQAFVLNVDQPEISLQHATESALRH 132

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
           VVG      +    R+ +A E++  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V
Sbjct: 133 VVGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSAAAPREVQEAFDDV 192

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
            RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A+GEADRF  +  +
Sbjct: 193 IRAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEVVSRAKGEADRFTKLVAE 252

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
           Y  AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 253 YRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 297


>gi|23015794|ref|ZP_00055561.1| COG0330: Membrane protease subunits, stomatin/prohibitin homologs
           [Magnetospirillum magnetotacticum MS-1]
          Length = 377

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 104/281 (37%), Positives = 166/281 (59%), Gaps = 10/281 (3%)

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQKIGG------- 119
            +Y V PDE+ V +RFG+   D   PGLH    +PI+ V + KV +  Q + G       
Sbjct: 90  GVYKVSPDEQGVVMRFGQ-WVDTTEPGLHYRLPYPIETVLLPKVTKVNQLLLGSRAGADL 148

Query: 120 RSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVG 179
           R     ++   +LTGD+NIV    +V + + D   YLF + +P  T+K  +ESA+REV+G
Sbjct: 149 RGGGRATDESRMLTGDENIVEAEAAVFWRIKDAGKYLFAVRDPELTVKVAAESALREVIG 208

Query: 180 RRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRA 239
           R         +R+ IA++ +  +Q+ +D Y +GI +  + ++   PP  V DAF++VQRA
Sbjct: 209 RNPIQAALSDKRELIAIQAQEELQRLLDAYGAGIHVQQVQLQKVDPPSAVIDAFNDVQRA 268

Query: 240 EQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVN 299
             D++R   E+  Y N ++  ARGEA  + + + AY+++++  AQG+A RFLS+Y  Y  
Sbjct: 269 RADQERARNEAEAYRNDIIPRARGEAERLTQEAQAYREQVVDLAQGDAKRFLSLYNSYKL 328

Query: 300 APTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNE 339
           +  +  +R+Y+ETME +LK A KV+ID   + ++PYLPL E
Sbjct: 329 SEDVTARRLYIETMEEVLKGATKVVIDPSARGLVPYLPLPE 369


>gi|74316621|ref|YP_314361.1| HflK [Thiobacillus denitrificans ATCC 25259]
 gi|74056116|gb|AAZ96556.1| HflK [Thiobacillus denitrificans ATCC 25259]
          Length = 395

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 114/302 (37%), Positives = 174/302 (57%), Gaps = 19/302 (6%)

Query: 51  GSVYIILLLIGSFCAF---QSIYIVHPDERAVELRFGK------PKNDVFLPGLHMMFWP 101
           G    + LLIG+          YIV   +R V LRFGK      P     LP      WP
Sbjct: 57  GGGNFVGLLIGALVMIWIASGFYIVDTGQRGVVLRFGKYVETTDPGPRWHLP------WP 110

Query: 102 IDQVEIVKVIE-RQQKIGGRSA--SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
           I+  E+V V + R  +IG R+   S      L+LT D+NI+ L F+V Y++ DP+ +LF 
Sbjct: 111 IESREMVNVDQVRTVEIGYRNNVRSKVLKESLMLTDDENIIDLQFAVQYILKDPQDFLFI 170

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
              P +T+ QV+E+AMRE+VG+     +    R  IA   + L+Q+ +D YK+GI I+ +
Sbjct: 171 NRAPEDTVLQVAETAMREIVGKNKMDYVLYEGRADIAARAKLLMQQILDRYKTGISISQV 230

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
           ++++  PP +V  AFD+  +A QD +R   E+  YSN V+  ARG AS ++E +  YK  
Sbjct: 231 TLQNIQPPEQVQAAFDDAVKAGQDRERLKNEAEAYSNDVVPRARGLASRLKEEAEGYKLA 290

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPL 337
           +I  AQGEA RF  I  +Y  AP + R+R+YL+TM+ ++  + KV++D+K  + + YLPL
Sbjct: 291 VIANAQGEASRFAQILDEYQKAPQVTRQRLYLDTMQTVMNNSSKVLVDQKGGNSLLYLPL 350

Query: 338 NE 339
           ++
Sbjct: 351 DK 352


>gi|154252900|ref|YP_001413724.1| HflK protein [Parvibaculum lavamentivorans DS-1]
 gi|154156850|gb|ABS64067.1| HflK protein [Parvibaculum lavamentivorans DS-1]
          Length = 398

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 111/299 (37%), Positives = 177/299 (59%), Gaps = 16/299 (5%)

Query: 54  YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQV------E 106
           ++I  +     A+ S + V+ ++  + LRFG+    V  PGLH  F +PI+ V       
Sbjct: 75  FLIAFIFLGLVAYSSFFRVNTNQEGIVLRFGEHVRTV-APGLHFKFPYPIETVLTPAVTN 133

Query: 107 IVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRL--YLFNLENPGE 164
           I  V    ++ GG   +V   S L+LTGD+NIV + FSV + +       +LFN+EN   
Sbjct: 134 ISSVDIGMRQSGGTPIAVPEES-LMLTGDENIVDISFSVQWRIKPGHAADFLFNVENTDL 192

Query: 165 TLKQVSESAMREVVGRRFAVDIFRS-QRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
            +K V+ES MRE VG+   +++ ++  R ++  +VR  +Q T+D Y +GI I  + ++  
Sbjct: 193 AIKAVAESMMREAVGQS-KIEVLQTVGRNEVQNQVREGLQATLDSYGAGIEITEVKLQKV 251

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP +V DAF +VQ A  D++R   ++  Y+N V+  ARG+A+ I +S+ AY+++I+ EA
Sbjct: 252 DPPAQVLDAFRDVQAARADQERLRNQAQTYANTVIPRARGDAAQITQSAEAYREQIVAEA 311

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS---VMPYLPLNE 339
           +G A RF SIY +Y  A  + R+RIYLETM+ +     KV++D+  +   V+PYLPLNE
Sbjct: 312 EGNAKRFTSIYNEYKKAEAVTRRRIYLETMQDVFGGMNKVLMDQSGAGAGVLPYLPLNE 370


>gi|73667456|ref|YP_303472.1| HflK [Ehrlichia canis str. Jake]
 gi|72394597|gb|AAZ68874.1| protease FtsH subunit HflK [Ehrlichia canis str. Jake]
          Length = 355

 Score =  186 bits (473), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 114/303 (37%), Positives = 180/303 (59%), Gaps = 18/303 (5%)

Query: 49  SYGSVYIIL--LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQV 105
           SYG +  I+  L+I S       Y+V P+E AVEL FGK  N V  PGL   F  PI Q+
Sbjct: 50  SYGKIQFIVAFLVIISLYMASGFYMVEPEEEAVELLFGKYHNTVG-PGLRYHFPSPIGQI 108

Query: 106 EIVKV--IERQQKIGGR---SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
             +KV  I R++ IG +    ++     G++LTGD+NIV ++F V + + +   YLF + 
Sbjct: 109 IKLKVKTINREE-IGSKLYTDSTSDHGEGVMLTGDENIVNINFDVHWRINNAYNYLFKVR 167

Query: 161 NP--GETLKQVSESAMREVVGRR---FAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILI 215
           +   G+T+K  +ESAMREV+G+    FA++     R  I+ E + L+Q  +D+Y+ G+ +
Sbjct: 168 DNQVGDTVKNAAESAMREVIGKSSISFAIE--GKGRAVISQETKTLLQNILDHYEMGVEV 225

Query: 216 NTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAY 275
            +I ++   PP +V  +F +VQ A  D+++ + E+  Y N+VL  A+GEA  I+  + AY
Sbjct: 226 LSIQLKKVDPPEKVISSFRDVQSARADKEKLINEAYAYRNQVLPRAKGEAIKIKLDAEAY 285

Query: 276 KDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII-DKKQSVMPY 334
           +  ++  A+G A RF ++Y +YV  P  +R R+YLETME IL K  KV++ D  + ++ Y
Sbjct: 286 ESEVVNTAEGNAKRFTALYNEYVQQPDAVRNRLYLETMEEILNKNDKVVVSDDLKGMLSY 345

Query: 335 LPL 337
            PL
Sbjct: 346 FPL 348


>gi|296136225|ref|YP_003643467.1| HflK protein [Thiomonas intermedia K12]
 gi|295796347|gb|ADG31137.1| HflK protein [Thiomonas intermedia K12]
          Length = 439

 Score =  186 bits (472), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 114/327 (34%), Positives = 184/327 (56%), Gaps = 18/327 (5%)

Query: 19  NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAFQS-IYIVHPDER 77
           +GNG   PP            + DL P  K  G   IIL++IG      S  +IV   ++
Sbjct: 59  SGNGGSTPP-----------QRPDLYPSAKGMGVGVIILVVIGVLGWLSSGFFIVQEGQQ 107

Query: 78  AVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE-RQQKIG--GRSASVGSNSGLILT 133
           A   RFGK    +   G H    +P +  EIV V + R  ++G  G   + G     +LT
Sbjct: 108 AAVTRFGKLAY-ITDAGFHWRLPYPFEADEIVNVSQVRSVEVGRGGEVKATGLPESAMLT 166

Query: 134 GDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQ 193
            D+NIV + F+V Y + +   YL+N  +P + + Q +E+A+REVVG +    +    R+Q
Sbjct: 167 EDENIVDVRFAVQYRIDNVVDYLYNNRSPDDAVSQAAETAVREVVGNKTLDYVLYEGREQ 226

Query: 194 IALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKY 253
           +A +V+ L QK +D YK+GI+I T+++++  PP +V  AFD+  +A QD +R   E+  Y
Sbjct: 227 VASDVQVLTQKILDRYKTGIVITTVTLQNVQPPEQVQAAFDDAIKAGQDRERLKNEAQAY 286

Query: 254 SNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETM 313
           +N V+  A+G AS + + + AYK +++ +AQG+  RF  I  QY  AP + R+R+YL+TM
Sbjct: 287 ANNVIPRAQGTASRLIQDAEAYKAQVVAQAQGDTSRFDQILQQYEKAPQVTRERMYLQTM 346

Query: 314 EGILKKAKKVIID-KKQSVMPYLPLNE 339
           + IL    KV++D +  + + Y+PL++
Sbjct: 347 QDILSSVSKVMVDSRNNNNLLYMPLDK 373


>gi|170723841|ref|YP_001751529.1| HflK protein [Pseudomonas putida W619]
 gi|169761844|gb|ACA75160.1| HflK protein [Pseudomonas putida W619]
          Length = 393

 Score =  186 bits (472), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 99/283 (34%), Positives = 174/283 (61%), Gaps = 12/283 (4%)

Query: 59  LIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIG 118
           ++ +   + ++Y+V   E+AV LRFGK    V  PGL++ F PID+ + ++ + R++   
Sbjct: 78  VLAAIWLYSAVYVVDEQEQAVVLRFGKYYETVG-PGLNIYFPPIDR-KYMENVTRERAY- 134

Query: 119 GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVV 178
                  +  G +LT D+NIV +  +V Y +T+ + ++ N++ P  +L+  +ESA+R VV
Sbjct: 135 -------TKQGQMLTEDENIVEVPLTVQYKITNLQDFVLNVDQPEVSLQHATESALRHVV 187

Query: 179 GRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQR 238
           G      +    R+Q+A+++R  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V R
Sbjct: 188 GSTSMDQVLTEGREQMAVDIRERLQRFLDNYRTGITVTQVNVQSAAAPREVQEAFDDVIR 247

Query: 239 AEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYV 298
           A +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +I  A+GEADRF  +  +Y 
Sbjct: 248 AREDEQRARNQAESYANGVVPEARGQAQRIIEDANGYRDEVIARAKGEADRFTKLLAEYR 307

Query: 299 NAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
            AP + R+R+YLETM+ +     KV++  K  Q+ + YLPL++
Sbjct: 308 KAPDVTRQRLYLETMQEVYSNTSKVMVATKDGQNNLLYLPLDK 350


>gi|302189787|ref|ZP_07266460.1| HflK [Pseudomonas syringae pv. syringae 642]
          Length = 401

 Score =  186 bits (471), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 97/284 (34%), Positives = 175/284 (61%), Gaps = 12/284 (4%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           +++ +F  + +IY+V   E+AV LRFG+  ++   PGL++ F P D+ + ++ + R++  
Sbjct: 79  VVLVAFWLYSAIYVVDEQEQAVVLRFGQ-YHETVGPGLNIYFPPFDR-KYMENVTRERAY 136

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
                   S  G +LT D+NIV +  +V Y ++D + ++ N++ P  +L+  +ESA+R V
Sbjct: 137 --------SKQGQMLTEDENIVEVPLTVQYKISDLQAFVLNVDQPEISLQHATESALRHV 188

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG      +    R+ +A E++  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V 
Sbjct: 189 VGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSAAAPREVQEAFDDVI 248

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A+GEADRF  +  +Y
Sbjct: 249 RAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEVVSRAKGEADRFTKLVAEY 308

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
             AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 309 RKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 352


>gi|66043841|ref|YP_233682.1| HflK [Pseudomonas syringae pv. syringae B728a]
 gi|63254548|gb|AAY35644.1| HflK [Pseudomonas syringae pv. syringae B728a]
          Length = 400

 Score =  186 bits (471), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 97/284 (34%), Positives = 175/284 (61%), Gaps = 12/284 (4%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           +++ +F  + +IY+V   E+AV LRFG+  ++   PGL++ F P D+ + ++ + R++  
Sbjct: 79  VVLVAFWLYSAIYVVDEQEQAVVLRFGQ-YHETVGPGLNIYFPPFDR-KYMENVTRERAY 136

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
                   S  G +LT D+NIV +  +V Y ++D + ++ N++ P  +L+  +ESA+R V
Sbjct: 137 --------SKQGQMLTEDENIVEVPLTVQYKISDLQAFVLNVDQPEISLQHATESALRHV 188

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG      +    R+ +A E++  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V 
Sbjct: 189 VGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSAAAPREVQEAFDDVI 248

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A+GEADRF  +  +Y
Sbjct: 249 RAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEVVSRAKGEADRFTKLVAEY 308

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
             AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 309 RKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 352


>gi|330978948|gb|EGH78007.1| HflK [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 401

 Score =  186 bits (471), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 97/284 (34%), Positives = 175/284 (61%), Gaps = 12/284 (4%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           +++ +F  + +IY+V   E+AV LRFG+  ++   PGL++ F P D+ + ++ + R++  
Sbjct: 79  VVLVAFWLYSAIYVVDEQEQAVVLRFGQ-YHETVGPGLNIYFPPFDR-KYMENVTRERAY 136

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
                   S  G +LT D+NIV +  +V Y ++D + ++ N++ P  +L+  +ESA+R V
Sbjct: 137 --------SKQGQMLTEDENIVEVPLTVQYKISDLQAFVLNVDQPEISLQHATESALRHV 188

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG      +    R+ +A E++  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V 
Sbjct: 189 VGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSAAAPREVQEAFDDVI 248

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A+GEADRF  +  +Y
Sbjct: 249 RAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEVVSRAKGEADRFTKLVAEY 308

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
             AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 309 RKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 352


>gi|330951476|gb|EGH51736.1| HflK [Pseudomonas syringae Cit 7]
          Length = 401

 Score =  186 bits (471), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 97/284 (34%), Positives = 175/284 (61%), Gaps = 12/284 (4%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           +++ +F  + +IY+V   E+AV LRFG+  ++   PGL++ F P D+ + ++ + R++  
Sbjct: 79  VVLVAFWLYSAIYVVDEQEQAVVLRFGQ-YHETVGPGLNIYFPPFDR-KYMENVTRERAY 136

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
                   S  G +LT D+NIV +  +V Y ++D + ++ N++ P  +L+  +ESA+R V
Sbjct: 137 --------SKQGQMLTEDENIVEVPLTVQYKISDLQAFVLNVDQPEISLQHATESALRHV 188

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG      +    R+ +A E++  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V 
Sbjct: 189 VGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSAAAPREVQEAFDDVI 248

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A+GEADRF  +  +Y
Sbjct: 249 RAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEVVSRAKGEADRFTKLVAEY 308

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
             AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 309 RKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 352


>gi|330899895|gb|EGH31314.1| HflK [Pseudomonas syringae pv. japonica str. M301072PT]
          Length = 401

 Score =  186 bits (471), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 97/284 (34%), Positives = 175/284 (61%), Gaps = 12/284 (4%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           +++ +F  + +IY+V   E+AV LRFG+  ++   PGL++ F P D+ + ++ + R++  
Sbjct: 79  VVLVAFWLYSAIYVVDEQEQAVVLRFGQ-YHETVGPGLNIYFPPFDR-KYMENVTRERAY 136

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
                   S  G +LT D+NIV +  +V Y ++D + ++ N++ P  +L+  +ESA+R V
Sbjct: 137 --------SKQGQMLTEDENIVEVPLTVQYKISDLQAFVLNVDQPEISLQHATESALRHV 188

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG      +    R+ +A E++  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V 
Sbjct: 189 VGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSAAAPREVQEAFDDVI 248

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A+GEADRF  +  +Y
Sbjct: 249 RAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEVVSRAKGEADRFTKLVAEY 308

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
             AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 309 RKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 352


>gi|330971557|gb|EGH71623.1| HflK [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 401

 Score =  185 bits (470), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 97/284 (34%), Positives = 175/284 (61%), Gaps = 12/284 (4%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           +++ +F  + +IY+V   E+AV LRFG+  ++   PGL++ F P D+ + ++ + R++  
Sbjct: 79  VVLVAFWLYSAIYVVDEQEQAVVLRFGQ-YHETVGPGLNIYFPPFDR-KYMENVTRERAY 136

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
                   S  G +LT D+NIV +  +V Y ++D + ++ N++ P  +L+  +ESA+R V
Sbjct: 137 --------SKQGQMLTEDENIVEVPLTVQYKISDLQAFVLNVDQPEISLQHATESALRHV 188

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG      +    R+ +A E++  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V 
Sbjct: 189 VGSTAMDHVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSAAAPREVQEAFDDVI 248

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A+GEADRF  +  +Y
Sbjct: 249 RAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEVVSRAKGEADRFTKLVAEY 308

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
             AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 309 RKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 352


>gi|289672586|ref|ZP_06493476.1| HflK [Pseudomonas syringae pv. syringae FF5]
          Length = 389

 Score =  185 bits (470), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 97/284 (34%), Positives = 175/284 (61%), Gaps = 12/284 (4%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           +++ +F  + +IY+V   E+AV LRFG+  ++   PGL++ F P D+ + ++ + R++  
Sbjct: 79  VVLVAFWLYSAIYVVDEQEQAVVLRFGQ-YHETVGPGLNIYFPPFDR-KYMENVTRERAY 136

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
                   S  G +LT D+NIV +  +V Y ++D + ++ N++ P  +L+  +ESA+R V
Sbjct: 137 --------SKQGQMLTEDENIVEVPLTVQYKISDLQAFVLNVDQPEISLQHATESALRHV 188

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG      +    R+ +A E++  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V 
Sbjct: 189 VGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSAAAPREVQEAFDDVI 248

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A+GEADRF  +  +Y
Sbjct: 249 RAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEVVSRAKGEADRFTKLVAEY 308

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
             AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 309 RKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 352


>gi|114319736|ref|YP_741419.1| HflK protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226130|gb|ABI55929.1| protease FtsH subunit HflK [Alkalilimnicola ehrlichii MLHE-1]
          Length = 459

 Score =  185 bits (470), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 124/341 (36%), Positives = 179/341 (52%), Gaps = 59/341 (17%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQ-- 114
           L+I  + A   IYIV   +R VEL FG     V  PG H  F  PI  VE V V E +  
Sbjct: 79  LVIAGWLA-SGIYIVDEGQRGVELTFGA-NTGVTQPGPHWHFPRPIGSVERVDVSEVRTI 136

Query: 115 ----QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
               + +G R+ SV     L+LT D+NIV L  +V Y V+DP  YLFN   P +TLKQ++
Sbjct: 137 EIGYESMGERTRSV-LREALMLTRDENIVNLKVAVQYRVSDPANYLFNFRFPDDTLKQLA 195

Query: 171 ESAMREVVGRRFAVD--------------------------------------------- 185
           ESA+REVVG+  A +                                             
Sbjct: 196 ESALREVVGKAEAPEDVEIGPGEDFGQLADELADQLTEEELQALMTGADETARAHITPLE 255

Query: 186 -IFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDED 244
            +    R Q+A E   LIQ+ +D Y++GI +  ++I+DA PP EV  AF +  RA +D+ 
Sbjct: 256 WVLTQGRAQVADESERLIQEALDRYQAGITLVRVAIQDAQPPEEVQPAFADAIRAREDQQ 315

Query: 245 RFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLL 304
           R +  +  Y+N +L  A G+A+  RE + AY+D++I  AQGE++RF ++  +Y  AP + 
Sbjct: 316 RTISRARAYANALLPRAEGQAARQREEAQAYRDQVIARAQGESERFTALLNEYERAPQVT 375

Query: 305 RKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNEAFSR 343
           R+R+YLETME +L  + K++ID +  Q +M YLPL+    R
Sbjct: 376 RQRLYLETMERVLGNSSKIMIDVEGGQPLM-YLPLDRMIDR 415


>gi|256828078|ref|YP_003156806.1| HflK protein [Desulfomicrobium baculatum DSM 4028]
 gi|256577254|gb|ACU88390.1| HflK protein [Desulfomicrobium baculatum DSM 4028]
          Length = 360

 Score =  185 bits (470), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 115/303 (37%), Positives = 177/303 (58%), Gaps = 18/303 (5%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIER 113
           II+L+   F     IYIV PDE  V  RFG  +     PG H    +P + V   +V + 
Sbjct: 44  IIVLVALLFWLGSGIYIVQPDEVGVVKRFGAYERTTD-PGPHYRLPFPFESVLTPQVTKI 102

Query: 114 QQ-KIGGRSAS---VGSNS--------GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
           Q+ ++G R ++   VG+ +         L+LTGD+NIV + F V +++ + + YLFN+ N
Sbjct: 103 QRLEVGFRGSTAFTVGTGTQVRQVPEESLMLTGDENIVDVQFIVQFLIDNAQDYLFNVAN 162

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
             +T+K  +E+AMREV+G           +  I  + R+L+QK ++ YKSGI +  + ++
Sbjct: 163 QDKTVKDAAEAAMREVIGYNKIDAALTDDKLTIQNDTRDLLQKILNSYKSGIRVVAVQLQ 222

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
           D  PPR+V DAF +V  A++D+ RF+ E+  Y N ++   RGEA+ I   + AYK+  I 
Sbjct: 223 DVHPPRQVIDAFKDVASAKEDKSRFINEAEAYENDLVPRTRGEAAAILNQAQAYKETKIL 282

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKK--AKKVII--DKKQSVMPYLPL 337
           +A+G++DRFL +  +Y  A  + +KRIYLETME IL +   +K+II  D  Q V PYLPL
Sbjct: 283 QARGDSDRFLFVLEEYRKAKDITKKRIYLETMEEILSRPEVEKIIISNDSMQRVFPYLPL 342

Query: 338 NEA 340
             +
Sbjct: 343 QRS 345


>gi|242277651|ref|YP_002989780.1| HflK protein [Desulfovibrio salexigens DSM 2638]
 gi|242120545|gb|ACS78241.1| HflK protein [Desulfovibrio salexigens DSM 2638]
          Length = 367

 Score =  185 bits (469), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 128/366 (34%), Positives = 197/366 (53%), Gaps = 33/366 (9%)

Query: 7   NSDW---RPTRLSGSNGNGDGLPPF--DVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIG 61
           N DW      R     G G   PP   D+ + IR I+     +P  K      I+L  + 
Sbjct: 12  NWDWDKLSEQRQRNKGGGGAPKPPNVDDINSTIRKIRGTG--LPGGKFIIIGIILLWFLS 69

Query: 62  SFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE-RQQKIG- 118
                  +YIV PDE  V  RFGK       PG H     PI+ V   KV + R+ ++G 
Sbjct: 70  G------VYIVEPDEVGVVTRFGKYVTTT-TPGPHYHLPIPIESVMKPKVTQIRRVEVGF 122

Query: 119 -----------GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
                      G+S +V   S L+LTGD+NIV + F V Y + DP  YLF + N  +T++
Sbjct: 123 RSYGSSRSFTQGQSRNVPEES-LMLTGDENIVDVQFIVQYQIKDPVNYLFEVSNQPKTIQ 181

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
             +E+AMRE++G+        + + QI  E R+L+Q+ +D YK G+ +  + +++  PP 
Sbjct: 182 DAAEAAMREIIGKTKIELALTTGKLQIQTETRDLLQEIVDRYKLGVNVLAVQLQNVHPPN 241

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
           EV DAF +V  A +D+ R++ E+  Y N +L  ARG+A+ I   + AYK+  I+EA+G+A
Sbjct: 242 EVVDAFKDVASAREDKSRYINEAEAYRNDILPKARGQAAVILNKAEAYKETKIREAEGQA 301

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILK--KAKKVII--DKKQSVMPYLPLNEAFSR 343
            RF+++Y +Y  A  +  KR+YLETM+ IL   + KKVI+  D  +  +P+L L+ +   
Sbjct: 302 KRFMAVYKEYQKAKDITVKRLYLETMQNILSNPEVKKVILSDDSAKKALPFLSLDGSTLP 361

Query: 344 IQTKRE 349
           IQT ++
Sbjct: 362 IQTGKK 367


>gi|325271233|ref|ZP_08137778.1| HflK protein [Pseudomonas sp. TJI-51]
 gi|324103636|gb|EGC00938.1| HflK protein [Pseudomonas sp. TJI-51]
          Length = 393

 Score =  185 bits (469), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 98/283 (34%), Positives = 176/283 (62%), Gaps = 12/283 (4%)

Query: 59  LIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIG 118
           ++ +   + ++Y+V   E+AV LRFGK    V  PGL++ F PID+ + ++ + R++   
Sbjct: 78  VLAAIWLYNAVYVVDEQEQAVVLRFGKYYETVG-PGLNIYFPPIDR-KYMENVTRERAY- 134

Query: 119 GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVV 178
                  +  G +LT D+NIV +  +V Y +++ + ++ N++ P  +L+  ++SA+R VV
Sbjct: 135 -------TKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQPEVSLQHATDSALRHVV 187

Query: 179 GRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQR 238
           G      +    R+Q+A+++R  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V R
Sbjct: 188 GSTSMDQVLTEGREQMAVDIRERLQRFLDNYRTGITVTQVNVQSAAAPREVQEAFDDVIR 247

Query: 239 AEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYV 298
           A +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +I  A+GEADRF  + G+Y 
Sbjct: 248 AREDEQRARNQAESYANGVVPEARGQAQRIIEDANGYRDEVIARAKGEADRFSKLLGEYR 307

Query: 299 NAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
            AP + R+R+YLETM+ +   + KV++  K  Q+ + YLPL++
Sbjct: 308 KAPDVTRQRLYLETMQEVYSNSSKVMVATKDGQNNLLYLPLDK 350


>gi|87122643|ref|ZP_01078520.1| protease subunit HflK [Marinomonas sp. MED121]
 gi|86162101|gb|EAQ63389.1| protease subunit HflK [Marinomonas sp. MED121]
          Length = 409

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 105/296 (35%), Positives = 172/296 (58%), Gaps = 17/296 (5%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVE---IVKVI 111
           + ++ + +  A   +Y V   ER V LR GK  ++  +PGLH     ID V+   + KV 
Sbjct: 90  VGVVAVTALWAASGVYQVDQQERGVVLRLGK-YHETVMPGLHWNPPLIDSVQSENVTKVR 148

Query: 112 ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSE 171
               K             L+LT D+ IV +  SV Y+V +P+ +L N+ +P  +L Q +E
Sbjct: 149 SHDHK------------ALMLTEDEAIVEVGLSVQYLVQNPKDFLLNVRDPESSLSQATE 196

Query: 172 SAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231
           SA+R VVG      I    R+ +A +V+  +Q+ +D Y +G+LI+ +++E+   P++V  
Sbjct: 197 SALRHVVGSSEMDQILTEGRELLAQDVKTRLQRYIDDYGTGLLISQVNVENVQAPQQVQA 256

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           AFD+V +A++DE R   E+  Y+N V+  ARG A  IRE + AY+  ++  A+G+ADRF 
Sbjct: 257 AFDDVIKAKEDEQRVRNEAESYANGVIPEARGRAQRIREEAEAYRSEVVARAEGQADRFD 316

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQT 346
            +Y +YV AP + R+R+Y+ET+E +   A KV++D +  + M YLPL++  S  +T
Sbjct: 317 RLYQEYVKAPEVTRRRLYIETVEDVYGNANKVVVDVEGGNNMMYLPLDKIVSERKT 372


>gi|293604549|ref|ZP_06686954.1| FtsH protease regulator HflK [Achromobacter piechaudii ATCC 43553]
 gi|292817130|gb|EFF76206.1| FtsH protease regulator HflK [Achromobacter piechaudii ATCC 43553]
          Length = 438

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 125/370 (33%), Positives = 196/370 (52%), Gaps = 45/370 (12%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI------------------- 44
           + N S+  P R     GNGDG P  D++ + R   ++   +                   
Sbjct: 23  NNNGSEPPPKR---PQGNGDGPP--DLDEVWRDFNNRIGSLFGRKGGGGGNNRPGNRGGM 77

Query: 45  ----PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
               P     G   I L+  G + A    YIV   + AV  +FGK K+         + +
Sbjct: 78  TPPSPRGTRIGLGVIALVAAGIWLA-SGFYIVQEGQVAVVTQFGKYKSTSQAGFQWRLPY 136

Query: 101 PIDQVEIVKVIE-RQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVVTDPRL--- 154
           PI   EIV V + R  ++G R  S        L+LT D+NIV + F V Y     RL   
Sbjct: 137 PIQSQEIVNVSQLRTFEVGFRGGSRNKVLPEALMLTTDENIVDMQFVVQY-----RLRAD 191

Query: 155 ----YLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYK 210
               YLF   +P E+++Q SE+AMREVVG++    +    R  +A +V+ L+Q+ +D YK
Sbjct: 192 GAPDYLFQTRDPDESVRQASETAMREVVGKQSMDFVLYEGRTAVATQVQALMQQILDRYK 251

Query: 211 SGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRE 270
           SG+ ++T++I++  PP +V  AFD+  +A QD +R + E   Y+N+V+  A G+AS + E
Sbjct: 252 SGVQVSTVAIQNVQPPEQVQAAFDDAVKAGQDRERQINEGQAYANQVVPLASGQASRMTE 311

Query: 271 SSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQ 329
            +  YK +++ +AQG + RF SI G+Y  AP ++R+R+YLE+M+ I  +A KV++D K  
Sbjct: 312 QAEGYKAKVVGDAQGNSSRFTSILGEYEKAPLVMRQRMYLESMQDIFTRASKVMVDTKSN 371

Query: 330 SVMPYLPLNE 339
           + M YLPL++
Sbjct: 372 NNMLYLPLDK 381


>gi|71908591|ref|YP_286178.1| HflK [Dechloromonas aromatica RCB]
 gi|71848212|gb|AAZ47708.1| protease FtsH subunit HflK [Dechloromonas aromatica RCB]
          Length = 436

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 105/276 (38%), Positives = 163/276 (59%), Gaps = 6/276 (2%)

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE-RQQKIGGRSASVGS 126
            YIV   +R + L+FG  K +   PGL   F +PI   E+V +   R  +IG R +    
Sbjct: 96  FYIVDASQRGLVLQFGSFK-EATEPGLRWRFPYPIQSHELVNLTGVRTIEIGYRGSERNK 154

Query: 127 --NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAV 184
                L+LT D+NIV + F+V Y++ DP  YLFN  +P E +   +E+A+RE+VG+    
Sbjct: 155 VLKEALMLTDDENIVNIQFAVQYILKDPVEYLFNNRSPDEAVMGAAETAVREIVGKSKMD 214

Query: 185 DIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDED 244
            +    R+QIA +   L+Q  +D Y+SGILI+ +++++A PP +V  AFD+  +A QD +
Sbjct: 215 YVLYEGREQIASQASKLMQDILDRYQSGILISKVTMQNAQPPEQVQSAFDDAVKAGQDRE 274

Query: 245 RFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLL 304
           R   E   Y+N V+  A+G A+ + E +  YK R+I  A+G+A RF  +  +Y  AP + 
Sbjct: 275 RQKNEGQAYANDVIPKAKGTAARLLEEANGYKQRVISSAEGDASRFKQVLTEYAKAPEVT 334

Query: 305 RKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNE 339
           R+R+YLETM+ I     KV++D K Q  + YLPL++
Sbjct: 335 RQRMYLETMQQIYANTSKVMVDAKGQGNLLYLPLDK 370


>gi|26991570|ref|NP_746995.1| HflK protein [Pseudomonas putida KT2440]
 gi|24986657|gb|AAN70459.1|AE016687_6 HflK protein [Pseudomonas putida KT2440]
          Length = 405

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 98/283 (34%), Positives = 175/283 (61%), Gaps = 12/283 (4%)

Query: 59  LIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIG 118
           ++ +   + ++Y+V   E+AV LRFGK    V  PGL++ F PID+ + ++ + R++   
Sbjct: 90  VLAAIWLYSAVYVVDEQEQAVVLRFGKYYETVG-PGLNIYFPPIDR-KYMENVTRERAY- 146

Query: 119 GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVV 178
                  +  G +LT D+NIV +  +V Y +++ + ++ N++ P  +L+  ++SA+R VV
Sbjct: 147 -------TKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQPEVSLQHATDSALRHVV 199

Query: 179 GRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQR 238
           G      +    R+Q+A+++R  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V R
Sbjct: 200 GSTSMDQVLTEGREQMAVDIRERLQRFLDNYRTGITVTQVNVQSAAAPREVQEAFDDVIR 259

Query: 239 AEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYV 298
           A +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +I  A+GEADRF  +  +Y 
Sbjct: 260 AREDEQRARNQAESYANGVVPEARGQAQRIIEDANGYRDEVIARAKGEADRFTKLLAEYR 319

Query: 299 NAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
            AP + R+R+YLETM+ +   + KV++  K  QS + YLPL++
Sbjct: 320 KAPDVTRERLYLETMQEVYSNSSKVMVATKDGQSNLLYLPLDK 362


>gi|220934078|ref|YP_002512977.1| HflK protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995388|gb|ACL71990.1| HflK protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 393

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 112/295 (37%), Positives = 174/295 (58%), Gaps = 16/295 (5%)

Query: 50  YGSVYIILLLIGSFCAF--QSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVE 106
           + S  I L+LI +   +     YI+   ER V LRFG  ++ V  PG +    +PI+ VE
Sbjct: 67  HASAGISLILIVALVVWLASGFYIISEGERGVVLRFGSFQS-VSQPGPNWHLPYPIESVE 125

Query: 107 IVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
            V  I+  + I  R+        L+LT D+NI+ +  +V Y V DP  +LFN+ +P  T 
Sbjct: 126 RVD-IDSIRSIQHRA--------LMLTADENIIDVDVAVQYRVMDPVDFLFNVRDPDRTT 176

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
           +QV ESA+RE VG+     I    R +IA   R +IQ+ +D Y +G+ + T+S++ A PP
Sbjct: 177 RQVMESAIRERVGKNNLEFILGEGRGEIATSARTVIQEALDAYGAGVTVTTVSMQQAQPP 236

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
             V ++F +  RA +DE RF  E+  Y+N ++  ARGEA+ IRE + AY++++I  A+G+
Sbjct: 237 EPVQESFADAIRAREDEARFRNEAEAYANAIVPQARGEAARIREEAQAYREQVIARAEGD 296

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
           A RF  +  +Y  AP + R+R+YLET E +L    KVI+D +   ++M YLPL++
Sbjct: 297 ASRFSQLLVEYQRAPDVTRQRLYLETAEAVLGGTNKVIVDMQGGNNLM-YLPLDK 350


>gi|148549970|ref|YP_001270072.1| HflK protein [Pseudomonas putida F1]
 gi|148514028|gb|ABQ80888.1| HflK protein [Pseudomonas putida F1]
          Length = 393

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 98/283 (34%), Positives = 175/283 (61%), Gaps = 12/283 (4%)

Query: 59  LIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIG 118
           ++ +   + ++Y+V   E+AV LRFGK    V  PGL++ F PID+ + ++ + R++   
Sbjct: 78  VLAAIWLYSAVYVVDEQEQAVVLRFGKYYETVG-PGLNIYFPPIDR-KYMENVTRERAY- 134

Query: 119 GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVV 178
                  +  G +LT D+NIV +  +V Y +++ + ++ N++ P  +L+  ++SA+R VV
Sbjct: 135 -------TKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQPEVSLQHATDSALRHVV 187

Query: 179 GRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQR 238
           G      +    R+Q+A+++R  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V R
Sbjct: 188 GSTSMDQVLTEGREQMAVDIRERLQRFLDNYRTGITVTQVNVQSAAAPREVQEAFDDVIR 247

Query: 239 AEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYV 298
           A +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +I  A+GEADRF  +  +Y 
Sbjct: 248 AREDEQRARNQAESYANGVVPEARGQAQRIIEDANGYRDEVIARAKGEADRFTKLLAEYR 307

Query: 299 NAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
            AP + R+R+YLETM+ +   + KV++  K  QS + YLPL++
Sbjct: 308 KAPDVTRERLYLETMQEVYSNSSKVMVATKDGQSNLLYLPLDK 350


>gi|119897225|ref|YP_932438.1| putative Hflk protein [Azoarcus sp. BH72]
 gi|119669638|emb|CAL93551.1| putative Hflk protein [Azoarcus sp. BH72]
          Length = 413

 Score =  184 bits (468), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 107/304 (35%), Positives = 173/304 (56%), Gaps = 9/304 (2%)

Query: 41  FDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF- 99
           F    F    G++  ++L++        +Y V  ++R V LR GK   +   PGL     
Sbjct: 69  FSFRQFGGGLGALVALVLIV---WLASGLYTVDANQRGVVLRLGK-FTETTEPGLRWRLP 124

Query: 100 WPIDQVEIVKVIE-RQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVVTDPRLYL 156
           +P +  EIV +   R  ++G R +         L+LT D+NI+ + F+V YV+  P  Y+
Sbjct: 125 YPFETHEIVDLTGVRTVEVGYRGSERNKVLRESLMLTDDENIINIQFAVQYVLNSPENYV 184

Query: 157 FNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILIN 216
           FN   P E++ Q +E+AMRE+VG+     +    R++IA     L+Q+ +D Y++GILI+
Sbjct: 185 FNNRFPDESVAQAAETAMREIVGKSRMDFVLYEGREEIAATAHELMQRILDRYQTGILIS 244

Query: 217 TISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYK 276
            +++++A PP +V  AFD+  +A QD +R   E   Y+N V+  ARG AS + E + AY+
Sbjct: 245 RVTMQNAQPPEQVQAAFDDAVKAGQDRERQKNEGEAYANDVIPRARGTASRLIEEANAYQ 304

Query: 277 DRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYL 335
            R++  A+GEA RF  I  +Y  AP + R+R+YLETM+ +L    KV+ID K    + +L
Sbjct: 305 ARVVANAEGEASRFSQILAEYKRAPDVTRERLYLETMQQVLSSTSKVMIDAKGNGNLLFL 364

Query: 336 PLNE 339
           PL++
Sbjct: 365 PLDK 368


>gi|152985788|ref|YP_001350990.1| protease subunit HflK [Pseudomonas aeruginosa PA7]
 gi|150960946|gb|ABR82971.1| protease subunit HflK [Pseudomonas aeruginosa PA7]
          Length = 399

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 106/283 (37%), Positives = 169/283 (59%), Gaps = 12/283 (4%)

Query: 59  LIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIG 118
           ++     + +IY+V   E+AV LRFGK    V  PGL+  F PID+        R Q+  
Sbjct: 81  ILAVLWLYNAIYVVDEQEQAVILRFGKYYETVG-PGLNFYFPPIDK--------RFQENV 131

Query: 119 GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVV 178
            R  +  S  G +LT D+NIV +  +V Y +++ + ++ N++ P  +L+Q +ESA+R V 
Sbjct: 132 TRERAY-SKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQPEVSLQQATESALRHVA 190

Query: 179 GRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQR 238
           G      I    R+Q+A EVR  +Q+ +D YK+GI +  ++I+ A  PREV +AFD+V R
Sbjct: 191 GSTTMDRILTEGREQMATEVRERLQRFLDTYKTGITVTQVNIQSAQAPREVQEAFDDVIR 250

Query: 239 AEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYV 298
           A +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +I  AQGEADRF  +  +Y 
Sbjct: 251 AREDEQREKNQAEAYANGVVPEARGQAQRIIEEANGYRDEVISRAQGEADRFSKLLVEYR 310

Query: 299 NAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
            AP + R+R+YL+TM+ +  +  KV++   + Q+ + YLPL++
Sbjct: 311 KAPEVTRERLYLDTMQEVFSQTSKVLVTGQQGQNNLLYLPLDK 353


>gi|330501626|ref|YP_004378495.1| HflK protein [Pseudomonas mendocina NK-01]
 gi|328915912|gb|AEB56743.1| HflK protein [Pseudomonas mendocina NK-01]
          Length = 389

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 101/276 (36%), Positives = 171/276 (61%), Gaps = 12/276 (4%)

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVG 125
           + +IY+V   E+AV LRFGK  ++   PGL++ F PID+ +  + + R++          
Sbjct: 81  YSAIYVVDEQEQAVVLRFGK-YHETVGPGLNIYFPPIDR-KFQENVTRERAY-------- 130

Query: 126 SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVD 185
           S  G +LT D+NI+ +  +V Y V++ + ++ N++ P  +L+  ++SA+R VVG      
Sbjct: 131 SKQGAMLTEDENIIEVPLTVQYRVSNLQDFVLNVDQPEVSLQHATDSAVRHVVGSTEMDQ 190

Query: 186 IFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDR 245
           +    R+ +A EVR  +Q+ +D Y++GI I  ++I+ A+ PREV +AFD+V RA +DE R
Sbjct: 191 VLTEGRELMASEVRERLQRFLDNYRTGITITQVNIQSAAAPREVQEAFDDVIRAREDEQR 250

Query: 246 FVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLR 305
              ++  Y+N V+  ARG+A  + E +  Y+D +I  AQGEADRF  +  +Y  AP + R
Sbjct: 251 EKNQAESYANGVIPEARGQAQRLLEEANGYRDEVIARAQGEADRFTKLVAEYRKAPEVTR 310

Query: 306 KRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
           +R+YL+TM+ ++    KV++  DK Q+ + YLPL++
Sbjct: 311 ERLYLDTMQEMMSNTSKVLVTGDKGQNNLLYLPLDK 346


>gi|330965983|gb|EGH66243.1| hflK protein [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 395

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 174/285 (61%), Gaps = 12/285 (4%)

Query: 57  LLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQK 116
           L+++ +F  + +IY+V   E+AV LRFG+  ++   PGL++ F P D+ + ++ + R++ 
Sbjct: 77  LVVLVAFWLYSAIYVVDEQEQAVVLRFGQ-YHETVGPGLNIYFPPFDR-KYMENVTRERA 134

Query: 117 IGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMRE 176
                    S  G +LT D+NIV +  +V Y +++   ++ N++ P  +L+  +ESA+R 
Sbjct: 135 Y--------SKQGQMLTEDENIVEVPLTVQYKISNLEAFVLNVDQPEISLQHATESALRH 186

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
           VVG      +    R+ +A E++  +Q+ +D Y +GI +  ++++ A+ PREV +AFD+V
Sbjct: 187 VVGSTAMDQVLTEGRELMASEIKERLQRFLDTYGTGITVTQVNVQSAAAPREVQEAFDDV 246

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
            RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A+GEADRF  +  +
Sbjct: 247 IRAREDEQRSRNQAESYANGVIPEARGQAQRILEDANGYRDEVVSRAKGEADRFTKLVAE 306

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
           Y  AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 307 YRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 351


>gi|146305672|ref|YP_001186137.1| HflK protein [Pseudomonas mendocina ymp]
 gi|145573873|gb|ABP83405.1| protease FtsH subunit HflK [Pseudomonas mendocina ymp]
          Length = 389

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 101/276 (36%), Positives = 170/276 (61%), Gaps = 12/276 (4%)

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVG 125
           + +IY+V   E+AV LRFGK  ++   PGL++ F PID+       + Q+ +    A   
Sbjct: 81  YSAIYVVDEQEQAVVLRFGK-YHETVGPGLNIYFPPIDR-------KFQENVTRERAY-- 130

Query: 126 SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVD 185
           S  G +LT D+NI+ +  +V Y V++ + ++ N++ P  +L+  ++SA+R VVG      
Sbjct: 131 SKQGAMLTEDENIIEVPLTVQYRVSNLQDFVLNVDQPEVSLQHATDSAVRHVVGSTEMDQ 190

Query: 186 IFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDR 245
           +    R+ +A EVR  +Q+ +D Y++GI I  ++I+ A+ PREV +AFD+V RA +DE R
Sbjct: 191 VLTEGRELMASEVRERLQRFLDNYRTGITITQVNIQSAAAPREVQEAFDDVIRAREDEQR 250

Query: 246 FVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLR 305
              ++  Y+N V+  ARG+A  + E +  Y+D +I  AQGEADRF  +  +Y  AP + R
Sbjct: 251 EKNQAESYANGVIPEARGQAQRLLEEANGYRDEVIARAQGEADRFTKLVAEYRKAPEITR 310

Query: 306 KRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
           +R+Y++TM+ ++    KV++  DK Q+ + YLPL++
Sbjct: 311 ERLYIDTMQEVMSNTSKVLVTGDKGQNNLLYLPLDK 346


>gi|104783870|ref|YP_610368.1| HflK protein [Pseudomonas entomophila L48]
 gi|95112857|emb|CAK17585.1| HflK protein [Pseudomonas entomophila L48]
          Length = 392

 Score =  184 bits (466), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 175/283 (61%), Gaps = 12/283 (4%)

Query: 59  LIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIG 118
           ++ +   + ++Y+V   E+AV LRFGK    V  PGL++ F PID+ + ++ + R++   
Sbjct: 78  VLAAIWLYSAVYVVDEQEQAVVLRFGKYYETVG-PGLNIYFPPIDR-KYMENVTRERAY- 134

Query: 119 GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVV 178
                  +  G +LT D+NIV +  +V Y +++ + ++ N++ P  +L+  ++SA+R VV
Sbjct: 135 -------TKQGQMLTEDENIVEVPLTVQYRISNLQDFVLNVDQPEVSLQHATDSALRHVV 187

Query: 179 GRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQR 238
           G      +    R+Q+A+++R  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V R
Sbjct: 188 GSTSMDQVLTEGREQMAVDIRERLQRFLDTYRTGITVTQVNVQSAAAPREVQEAFDDVIR 247

Query: 239 AEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYV 298
           A +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +I  A+GEADRF  +  +Y 
Sbjct: 248 AREDEQRARNQAESYANGVVPEARGQAQRIIEDANGYRDEVIARAKGEADRFTKLVAEYR 307

Query: 299 NAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
            AP + R+R+YLETM+ +   + KV++  K  Q+ + YLPL++
Sbjct: 308 KAPEVTRQRLYLETMQEVYSNSSKVLVTAKDGQNNLLYLPLDK 350


>gi|90416483|ref|ZP_01224414.1| HflK [marine gamma proteobacterium HTCC2207]
 gi|90331682|gb|EAS46910.1| HflK [marine gamma proteobacterium HTCC2207]
          Length = 376

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 103/288 (35%), Positives = 170/288 (59%), Gaps = 14/288 (4%)

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE 112
           V ++LL++     F   Y V   E+AV LR GK  +D    GL      ID V  V+V E
Sbjct: 58  VAMVLLVLWGLMGF---YQVDEKEQAVVLRLGK-YHDTLGSGLQWNPKLIDNVYTVRVTE 113

Query: 113 RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
            +Q          S  GL+LT D+NIV +  +V Y + D + ++ N+ +P  +LK  ++S
Sbjct: 114 ERQY---------SARGLMLTQDENIVEISLTVQYNIEDAKAFVLNIRDPETSLKHATDS 164

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           A+R VVG      +  + R++IA+   + +Q  ++ YKSGI +  I+IE+A PP EV  A
Sbjct: 165 ALRHVVGSTGLDGVISTGREEIAISTADKLQVLLNNYKSGINVVKINIEEARPPNEVKSA 224

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           +D+V +A +D +R V E+  YSN ++  ARG A  +RE + AYK +++ +A+GEA RF +
Sbjct: 225 YDDVIKAREDLERLVNEAQSYSNGIIPEARGAAQRMREEAGAYKSQVVSKAEGEAQRFTN 284

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNE 339
           +Y +Y  AP + R R+Y++ +E ++  + K+++D +  + M YLPL++
Sbjct: 285 LYIEYAKAPEVTRDRLYIDAVENVMMNSTKILVDTESGNNMLYLPLDK 332


>gi|254787454|ref|YP_003074883.1| membrane protease subunit HflK [Teredinibacter turnerae T7901]
 gi|237686388|gb|ACR13652.1| membrane protease subunit HflK [Teredinibacter turnerae T7901]
          Length = 385

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 106/295 (35%), Positives = 173/295 (58%), Gaps = 17/295 (5%)

Query: 58  LLIGSFCAFQSIY------IVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI 111
           L+  +  AF  IY      IV+  ERAV LR G   N    PG       ID+V  V V 
Sbjct: 64  LVALALIAFLLIYGFLGAGIVNEQERAVVLRLG-VYNQTLQPGFRWNPPLIDKVYPVNVT 122

Query: 112 ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSE 171
           + +Q          S S  +LT D NIV +  SV Y+++D + ++  + +P  +LKQ + 
Sbjct: 123 KVRQ---------WSTSEQMLTKDLNIVDIKLSVQYIISDAQEFVLRVRDPESSLKQATN 173

Query: 172 SAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231
           SA+R V G     DI    R+++A E+++ +Q  ++ Y++GI +  ++IED++PPREV D
Sbjct: 174 SALRHVAGSTLMHDILTEGRERVAYEIQDRLQAYLNAYQTGISVEKVNIEDSNPPREVQD 233

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           AFD+V +A +DE+R+  ++  Y+N +L  ARG A  + E + AYK+++I +A+GEA RF 
Sbjct: 234 AFDDVIKAREDEERYKNQAQTYANGILPEARGAAQRVIEEATAYKEQVIAKAEGEAKRFE 293

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQ 345
            +  +Y  AP + R+R+YL+ +E ++  A KV++D +  + M YLPL++  +  Q
Sbjct: 294 YLLNEYKKAPEVTRQRLYLDAVEDVMSNASKVLVDVEGGNNMLYLPLDKIVNTSQ 348


>gi|317151915|ref|YP_004119963.1| HflK protein [Desulfovibrio aespoeensis Aspo-2]
 gi|316942166|gb|ADU61217.1| HflK protein [Desulfovibrio aespoeensis Aspo-2]
          Length = 357

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 116/352 (32%), Positives = 190/352 (53%), Gaps = 27/352 (7%)

Query: 7   NSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAF 66
           N DW   +       G   P F+        +++FD    FK  G   I+ +++  + A 
Sbjct: 2   NWDWEKLQKQQQGRPGGKPPSFN------DFQEQFDKFKNFKFPGWKLIVPIIVLLWIA- 54

Query: 67  QSIYIVHPDERAVELRFGK-PKNDVFLPGLHMMFWPIDQVEIVKVIERQQ-KIGGRSASV 124
              YIV PDE  V  +FG+  +     P  H+ + P++     KV + Q+ + G RS   
Sbjct: 55  SGFYIVEPDEVGVVKQFGQFNRITTAGPNYHIPY-PVESAVTPKVTQIQRIEFGFRSGVR 113

Query: 125 G-------------SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSE 171
           G                 L+LTGD+NIV + F+V Y++ D + YLFN+  P  T+   +E
Sbjct: 114 GRAENFQQGVSREVPEEALMLTGDENIVSVQFTVQYLIKDAQDYLFNVAAPEATIVHAAE 173

Query: 172 SAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231
           ++MRE++GR    D   + +Q I  E R+L+Q  +D Y +GI I  + +++  PP +V +
Sbjct: 174 ASMREIIGRAKIDDALTTGKQDIQTETRDLMQTILDSYGTGISIVAVQMQNVHPPEQVVE 233

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           AF +V  A +D+ RF+ E+  Y   +L  ARGEAS I  ++ AY +  I+ +QG+A RFL
Sbjct: 234 AFKDVASAREDKSRFINEAEAYERDILPKARGEASRIVNAAQAYMETKIRRSQGDASRFL 293

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILK--KAKKVII--DKKQSVMPYLPLNE 339
           ++  +Y  A  + R+R+YLET+E IL+  + +K+I+  D  +  +PYLPL++
Sbjct: 294 AVLAEYDKAKDITRRRLYLETIESILENPEVEKLIMSDDALKKSVPYLPLDK 345


>gi|254503205|ref|ZP_05115356.1| HflK protein [Labrenzia alexandrii DFL-11]
 gi|222439276|gb|EEE45955.1| HflK protein [Labrenzia alexandrii DFL-11]
          Length = 400

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 118/301 (39%), Positives = 169/301 (56%), Gaps = 31/301 (10%)

Query: 68  SIYIVHPD--ERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVG 125
            +YIV     E  VEL  GK   D    G H   WP    E+ K    QQ    R  +VG
Sbjct: 95  GVYIVDEGRGEVGVELVLGK-VTDQTGTGFHYN-WPYPIGEVYKPQVEQQ----RETTVG 148

Query: 126 -----SNSG-----------LILTGDQNIVGLHFSVLYVVTDPR----LYLFNLENPGET 165
                +N+G           L+LTGD+NIV + F V + + + R     YLFN++NP  T
Sbjct: 149 VEELFTNTGAVRSRDVPEESLMLTGDENIVDVGFKVQWRIKNTRDGITNYLFNIQNPEGT 208

Query: 166 LKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASP 225
           +K V+ESAMREVVG      I    R  I  +V  L+Q T+D Y +GI I  + ++   P
Sbjct: 209 VKAVAESAMREVVGESNIDAILTQNRVTIQNDVATLMQSTLDSYLAGIEITEVQMQKVDP 268

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           P++V D+F +VQ A  D++R   E+  Y+NR +  ARGEA+ + E++ AYK++ I EA G
Sbjct: 269 PQQVIDSFRDVQAARADQERIQNEAQAYANRKIPEARGEAARVLEAANAYKEQTIAEATG 328

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS---VMPYLPLNEAFS 342
           ++ RF  IY +Y  AP + R+R+YLET+E +L +  K+IID + S   V+P+LPLN+   
Sbjct: 329 QSQRFTKIYQEYKLAPDVTRERLYLETLEKVLGENNKIIIDSQSSGSGVLPFLPLNDLNG 388

Query: 343 R 343
           R
Sbjct: 389 R 389


>gi|254436375|ref|ZP_05049881.1| HflK protein, putative [Nitrosococcus oceani AFC27]
 gi|207088065|gb|EDZ65338.1| HflK protein, putative [Nitrosococcus oceani AFC27]
          Length = 409

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 117/339 (34%), Positives = 185/339 (54%), Gaps = 22/339 (6%)

Query: 21  NGDGLPPFDVEAIIRYIKDKFDLI---------PFFKSYGSVY---IILLLIGSFCAFQS 68
           +GD   P D++ +IR +K K   +         P     GS+    +++L++        
Sbjct: 25  DGDRQGPPDLDEVIRNLKAKLSGLFGGKGGGGRPTLGRGGSILGLALLVLVLAVAWGLSG 84

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE-RQQKIGGRSASVGS 126
           IYIV P ER V LRFG+       PG H    +PI++VE+V V + R  +IG RS   G 
Sbjct: 85  IYIVAPAERGVVLRFGE-YVATTEPGPHWHIPYPIEKVELVDVAQIRSYEIGYRSTGRGQ 143

Query: 127 ------NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGR 180
                    L+LT D+NIV +  +V Y V D   YLFN+ N    L+QV ESA+RE VG+
Sbjct: 144 AGSPVPTEALMLTQDENIVDVRIAVQYRVKDAANYLFNVRNADTNLRQVVESALREAVGK 203

Query: 181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE 240
                +    R  I L    L Q+ +D Y +G++I +++++DA PP +V  AF +  +A 
Sbjct: 204 SKMDFVLTEGRSDIVLRTEELAQQVLDQYHAGLIITSVNMQDAQPPEQVQAAFADAIKAR 263

Query: 241 QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA 300
           +D+ R   E+  Y+N ++  ARG A    + + AYK  ++  A GE  RF  +  +Y++A
Sbjct: 264 EDQQRLRNEAEAYANDIIPRARGAAFRKVQEAEAYKSEVVALAGGETARFEQVLKEYLDA 323

Query: 301 PTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLN 338
           P +  KR+YLETME ++++++KV++D  +   + YLPL+
Sbjct: 324 PEITEKRLYLETMETVMERSRKVLVDVPEGTNVFYLPLD 362


>gi|332701649|ref|ZP_08421737.1| HflK protein [Desulfovibrio africanus str. Walvis Bay]
 gi|332551798|gb|EGJ48842.1| HflK protein [Desulfovibrio africanus str. Walvis Bay]
          Length = 360

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 107/296 (36%), Positives = 171/296 (57%), Gaps = 18/296 (6%)

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE-RQQKIGGRSA 122
                YIV PDER VE RFGK    +  PG H+ + +PI+ V   KV E ++ ++G RS 
Sbjct: 53  GLSGFYIVQPDERGVEKRFGK-FTQITDPGPHIHWPFPIESVHKPKVSEIKRVEVGFRSV 111

Query: 123 SVGSN-----------SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSE 171
           +                 L+LTGD+NIV + F V Y + DP  YLFN+     T+K V++
Sbjct: 112 ARNGTLQPGQYRLVPEESLMLTGDENIVDVQFIVQYQINDPVHYLFNVAEQENTVKYVAQ 171

Query: 172 SAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231
           + MREVVG         + +  I  + R+L+Q+ +D Y++G+ +  + ++D  PP+EV D
Sbjct: 172 ATMREVVGNSMIDSALTTGKFVIQTQTRDLMQEVLDRYQAGVRVIAVQLQDVHPPKEVVD 231

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           AF +V  A +D+ R + E+  Y N +L  ARG+ + I   + AYK+  + +A+G A++FL
Sbjct: 232 AFKDVASAREDKSRLINEAEAYRNDILPKARGQVAVIVNEAQAYKESQVLDARGGAEKFL 291

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILKKA--KKVIIDKKQS--VMPYLPLNEAFSR 343
           ++  +Y  A  + R+R+YLETME I   +  +K+I+  + +  V+PYLPL++A  R
Sbjct: 292 AVLTEYRKAKDVTRQRMYLETMERIFSSSGLEKIILSSQTAGNVVPYLPLDKAAPR 347


>gi|313109943|ref|ZP_07795871.1| LOW QUALITY PROTEIN: protease subunit HflC [Pseudomonas aeruginosa
           39016]
 gi|310882373|gb|EFQ40967.1| LOW QUALITY PROTEIN: protease subunit HflC [Pseudomonas aeruginosa
           39016]
          Length = 689

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 105/283 (37%), Positives = 169/283 (59%), Gaps = 12/283 (4%)

Query: 59  LIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIG 118
           ++     + +IY+V   E+AV LRFGK    V  PGL+  F PID+        R Q+  
Sbjct: 81  ILAVLWLYNAIYVVDEQEQAVILRFGKYYETVG-PGLNFYFPPIDK--------RFQENV 131

Query: 119 GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVV 178
            R  +  S  G +LT D+NIV +  +V Y +++ + ++ N++ P  +L+Q +ESA+R V 
Sbjct: 132 TRERAY-SKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQPEVSLQQATESALRHVA 190

Query: 179 GRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQR 238
           G      I    R+Q+A EVR  +Q+ +D Y++GI +  ++I+ A  PREV +AFD+V R
Sbjct: 191 GSTTMDRILTEGREQMATEVRERLQRFLDTYRTGITVTQVNIQSAQAPREVQEAFDDVIR 250

Query: 239 AEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYV 298
           A +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +I  AQGEADRF  +  +Y 
Sbjct: 251 AREDEQREKNQAEAYANGVVPEARGQAQRIIEEANGYRDEVISRAQGEADRFSKLLVEYR 310

Query: 299 NAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
            AP + R+R+YL+TM+ +  +  KV++   + Q+ + YLPL++
Sbjct: 311 KAPEVTRERLYLDTMQEVFSQTSKVLVTGQQGQNNLLYLPLDK 353



 Score = 45.1 bits (105), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 83/189 (43%), Gaps = 14/189 (7%)

Query: 45  PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQ 104
           P   +   + +I+ ++ +   + S+Y+V   ERAV LRFG+       PGLH     ++Q
Sbjct: 399 PLMGNKSLIALIVGVVAAIVLWNSVYVVQQTERAVMLRFGRVVESDVKPGLHFKIPYVNQ 458

Query: 105 VEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDP-RLYLFN---LE 160
           V         +K   R  ++ + +   LT ++  V +     + V D  R Y       +
Sbjct: 459 V---------RKFDARLLTLDAPTQRFLTLEKKAVMVDAYAKWRVADAERFYTATSGLKQ 509

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
              E L +  E+ +R+  G+R   ++   +R  +  ++   + + M   + GI +  + +
Sbjct: 510 IADERLSRRLEAGLRDQFGKRTLHEVVSGERDALMGDITASLNR-MAQKELGIEVIDVRV 568

Query: 221 EDASPPREV 229
           +    P+EV
Sbjct: 569 KAIDLPKEV 577


>gi|83954153|ref|ZP_00962873.1| HflK protein [Sulfitobacter sp. NAS-14.1]
 gi|83841190|gb|EAP80360.1| HflK protein [Sulfitobacter sp. NAS-14.1]
          Length = 361

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 105/315 (33%), Positives = 168/315 (53%), Gaps = 22/315 (6%)

Query: 45  PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQ 104
           P F + G+V + L+         S Y V P+++++EL  G+    +   GL+   WP   
Sbjct: 40  PKF-TRGTVGLGLVAAAVVWGMASFYTVRPEQQSIELFLGEFSG-IGTEGLNFAPWPFVT 97

Query: 105 VEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
            E+  V   + +  G   S   N GL+LT D+NIV + F V++ V +   + F+L +P  
Sbjct: 98  AEVFDVTTNRAETIGAGRSGDDNEGLMLTTDENIVDIDFQVVWNVKNAENFKFSLRDPQM 157

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
            ++ +SESAMRE++ +     I    R  I    R LIQ T+D  ++GI I  ++     
Sbjct: 158 AVRAISESAMREIIAQSELAPILNRDRATIEASARELIQTTLDNRQTGINIIRVNFNKVD 217

Query: 225 PPRE---------------VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIR 269
           PP +               V DAF +VQ AEQ+ DR   +++ Y+NR    ARGE++ + 
Sbjct: 218 PPSQTVTVTDANGNTTQESVIDAFRDVQAAEQERDRVERQADAYANRRTAEARGESARLL 277

Query: 270 ESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-- 327
           E++  Y+ R++ +A GEA RF ++  +Y  AP + R+R+Y+ETME +L    K+I++   
Sbjct: 278 EAAEGYRARVVNDAVGEASRFEAVLQEYAAAPDVTRRRLYIETMEKVLGDVDKIILENGS 337

Query: 328 ---KQSVMPYLPLNE 339
               Q V+PYLPLNE
Sbjct: 338 DGTGQGVVPYLPLNE 352


>gi|270159140|ref|ZP_06187796.1| HflK protein [Legionella longbeachae D-4968]
 gi|289166026|ref|YP_003456164.1| protease subunit HflK [Legionella longbeachae NSW150]
 gi|269987479|gb|EEZ93734.1| HflK protein [Legionella longbeachae D-4968]
 gi|288859199|emb|CBJ13131.1| protease subunit HflK [Legionella longbeachae NSW150]
          Length = 378

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 116/353 (32%), Positives = 192/353 (54%), Gaps = 34/353 (9%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI-----------PFFKSYGS 52
           DK    W+          G   PP D++  ++ I +K   I           P  KS G 
Sbjct: 7   DKGKEPWK----------GKNQPP-DLDEALKRIHEKLKKILFGGTVKTNNEPSKKSNGG 55

Query: 53  VYIILLLIGSFC--AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
           +  +++++ +F   A   I+IV P E+AV LRFGK    V   G H   W I ++   K+
Sbjct: 56  LVTMMIVLFAFLIWALSGIFIVDPAEQAVILRFGKYVETVG-SGPH---W-IPRIISSKI 110

Query: 111 IERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
           I    ++   S S       +LT D+N+V +  +V Y + D   YLFN+ NP E+L+Q +
Sbjct: 111 IMNVDRVLDYSYS-----AQMLTSDENLVAVSLAVQYRIGDLEQYLFNVANPEESLQQAT 165

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
            SA+R+VVG      +    R+    +V++ + K ++ Y +GI+I  ++ + A  P  V 
Sbjct: 166 SSALRQVVGATTLNQMITEGREVWGSQVQDTLVKILNLYNTGIVIVNVAPQPARAPESVQ 225

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
           +AFD+  +A++DE RF  ++N Y  +V+  A G+AS I++ + AY  +++  AQGE   F
Sbjct: 226 EAFDDAIKAQEDEKRFKAQANAYVAKVIPIAEGKASRIQQEAEAYSKQVVLNAQGEVSEF 285

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSR 343
           L++  QY  AP ++ +R+YLETM+ +L K  K+I+D K S + YLPL++ F++
Sbjct: 286 LALLSQYNVAPEVMAERMYLETMQKVLNKTSKIIVDSKSSNLLYLPLDKLFTK 338


>gi|167035933|ref|YP_001671164.1| HflK protein [Pseudomonas putida GB-1]
 gi|166862421|gb|ABZ00829.1| HflK protein [Pseudomonas putida GB-1]
          Length = 393

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 175/283 (61%), Gaps = 12/283 (4%)

Query: 59  LIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIG 118
           ++ +   + ++Y+V   E+AV LRFGK    V  PGL++ F PID+ + ++ + R++   
Sbjct: 78  VLAAIWLYSAVYVVDEQEQAVVLRFGKYYETVG-PGLNIYFPPIDR-KYMENVTRERAY- 134

Query: 119 GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVV 178
                  +  G +LT D+NIV +  +V Y +++ + ++ N++ P  +L+  ++SA+R VV
Sbjct: 135 -------TKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQPEVSLQHATDSALRHVV 187

Query: 179 GRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQR 238
           G      +    R+Q+A+++R  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V R
Sbjct: 188 GSTSMDQVLTEGREQMAVDIRERLQRFLDNYRTGITVTQVNVQSAAAPREVQEAFDDVIR 247

Query: 239 AEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYV 298
           A +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +I  A+GEADRF  +  +Y 
Sbjct: 248 AREDEQRARNQAESYANGVVPEARGQAQRIIEDANGYRDEVIARAKGEADRFTKLVAEYH 307

Query: 299 NAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
            AP + R+R+YLETM+ +   + KV++  K  Q+ + YLPL++
Sbjct: 308 KAPDVTRQRLYLETMQEVYSNSSKVMVATKDGQNNLLYLPLDK 350


>gi|254238343|ref|ZP_04931666.1| protease subunit HflK [Pseudomonas aeruginosa C3719]
 gi|126170274|gb|EAZ55785.1| protease subunit HflK [Pseudomonas aeruginosa C3719]
          Length = 399

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 105/283 (37%), Positives = 169/283 (59%), Gaps = 12/283 (4%)

Query: 59  LIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIG 118
           ++     + +IY+V   E+AV LRFGK    V  PGL+  F PID+        R Q+  
Sbjct: 81  ILAVLWLYNAIYVVDEQEQAVILRFGKYYETVG-PGLNFYFPPIDK--------RFQENV 131

Query: 119 GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVV 178
            R  +  S  G +LT D+NIV +  +V Y +++ + ++ N++ P  +L+Q +ESA+R V 
Sbjct: 132 TRERAY-SKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQPEVSLQQATESALRHVA 190

Query: 179 GRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQR 238
           G      I    R+Q+A EVR  +Q+ +D Y++GI +  ++I+ A  PREV +AFD+V R
Sbjct: 191 GSTTMDRILTEGREQMATEVRERLQRFLDTYRTGITVTQVNIQSAQAPREVQEAFDDVIR 250

Query: 239 AEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYV 298
           A +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +I  AQGEADRF  +  +Y 
Sbjct: 251 AREDEQREKNQAEAYANGVVPEARGQAQRIIEEANGYRDEVISRAQGEADRFSKLLVEYR 310

Query: 299 NAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
            AP + R+R+YL+TM+ +  +  KV++   + Q+ + YLPL++
Sbjct: 311 KAPEVTRERLYLDTMQEVFSQTSKVLVTGQQGQNNLLYLPLDK 353


>gi|313500871|gb|ADR62237.1| HflK [Pseudomonas putida BIRD-1]
          Length = 393

 Score =  183 bits (464), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 174/283 (61%), Gaps = 12/283 (4%)

Query: 59  LIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIG 118
           ++ +   + ++Y+V   E+AV LR GK    V  PGL++ F P+D+ + ++ + R++   
Sbjct: 78  VLAAIWLYSAVYVVDEQEQAVVLRLGKYYETVG-PGLNIYFPPLDR-KYMENVTRERAY- 134

Query: 119 GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVV 178
                  +  G +LT D+NIV +  +V Y +++ + ++ N++ P  +L+  +ESA+R VV
Sbjct: 135 -------TKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQPEVSLQHATESALRHVV 187

Query: 179 GRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQR 238
           G      +    R+Q+A+++R  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V R
Sbjct: 188 GSTSMDQVLTEGREQMAVDIRERLQRFLDTYRTGITVTQVNVQSAAAPREVQEAFDDVIR 247

Query: 239 AEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYV 298
           A +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +I  A+GEADRF  +  +Y 
Sbjct: 248 AREDEQRARNQAESYANGVVPEARGQAQRIIEDANGYRDEVIARAKGEADRFTKLLAEYR 307

Query: 299 NAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
            AP + R+R+YLETM+ +   + KV++  K  QS + YLPL++
Sbjct: 308 KAPDVTRERLYLETMQEVYSNSSKVMVATKDGQSNLLYLPLDK 350


>gi|226942904|ref|YP_002797977.1| membrane bound protease regulator HflK [Azotobacter vinelandii DJ]
 gi|226717831|gb|ACO77002.1| membrane bound protease regulator HflK [Azotobacter vinelandii DJ]
          Length = 351

 Score =  182 bits (463), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 97/289 (33%), Positives = 179/289 (61%), Gaps = 12/289 (4%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           I L ++ +F  + ++Y++   E+AV LRFGK  ++   PGL++ F PID+ + V+ + R+
Sbjct: 32  IALAVLAAFWLYSAVYVLDEQEQAVVLRFGK-YHETVGPGLNIHFPPIDR-KFVENVTRE 89

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
           +          S  G +LT D+NIV +  +V Y +++ + ++ N++ P  +L+  ++SA+
Sbjct: 90  RAY--------SKQGQMLTEDENIVEVPLTVQYKISNLKDFVLNVDQPEVSLQHATDSAL 141

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           R VVG      +    R+ +A EVR  +Q+ +D Y++GI++  +++++A  PREV +AFD
Sbjct: 142 RHVVGSTEMDQVLTEGRELLASEVRERLQRFLDTYRTGIVVTQVNVQNAQAPREVQEAFD 201

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +V RA +DE R   ++  Y+N V+  ARG+A  I E +  Y++ ++  A+GEA RF  + 
Sbjct: 202 DVIRAREDEQRERNQAEAYANGVIPEARGQAQRILEDANGYREEVVARAEGEAQRFGKLV 261

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNEAF 341
            +Y  AP ++R+R+YLET++ +L  + KV++  +  Q+ + YLPL++  
Sbjct: 262 VEYRKAPEVMRRRLYLETLQEVLSNSSKVLVATEGGQNNLLYLPLDKML 310


>gi|68171509|ref|ZP_00544891.1| HflK [Ehrlichia chaffeensis str. Sapulpa]
 gi|88657696|ref|YP_507835.1| hflK protein [Ehrlichia chaffeensis str. Arkansas]
 gi|67999073|gb|EAM85742.1| HflK [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599153|gb|ABD44622.1| hflK protein [Ehrlichia chaffeensis str. Arkansas]
          Length = 357

 Score =  182 bits (463), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 122/356 (34%), Positives = 196/356 (55%), Gaps = 31/356 (8%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSV--------- 53
           YD  NS+ +    S    N +     D+  +I Y  + F    F K+   +         
Sbjct: 5   YDPWNSNNKEDHKSKGYKNSN-----DINKVIHYFNNTFG--SFLKNKKGIRPNNHGKTQ 57

Query: 54  YIILLLIGSFCAFQS-IYIVHPDERAVELRFGKPKNDVFLPGL-HMMFWPIDQVEIVKV- 110
           +II  L+       S  YIV P+E AV+L FGK  +D   PGL + +  PI QV  +KV 
Sbjct: 58  FIIAFLVMMLLYMGSGFYIVEPEEEAVQLLFGK-YHDTVGPGLRYYLPSPIGQVIKLKVK 116

Query: 111 IERQQKIGGR---SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENP--GET 165
              +++IG R    ++ G   G++LTGD+NIV ++F V + + +   YLF + +   G+T
Sbjct: 117 TVNREEIGSRFYSDSTSGHGEGVMLTGDENIVNINFDVHWRINNAYNYLFKVRDNQVGDT 176

Query: 166 LKQVSESAMREVVGRR---FAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIED 222
           +K  +ESAMREV+G+    FA++     R  I+ E + L+Q  +D Y  G+ I +I ++ 
Sbjct: 177 VKNAAESAMREVIGKSSISFAIE--GKGRAIISQETKTLLQHILDQYNMGVEILSIQLKK 234

Query: 223 ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQE 282
             PP +V ++F +VQ A  D+++ + E+  Y N+VL  A+GEA  I+  + AY+  ++  
Sbjct: 235 VDPPEKVINSFRDVQSARADKEKLINEAYAYRNQVLPKAKGEAIKIKLDAEAYESEVVNA 294

Query: 283 AQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII-DKKQSVMPYLPL 337
           A+G   RF+++Y +YV  P  +R R+YLETME IL K  KV++ D  + ++ Y PL
Sbjct: 295 AEGNTKRFIALYKEYVYQPDAMRNRLYLETMEEILNKNDKVVVSDDLKGMLSYFPL 350


>gi|330984558|gb|EGH82661.1| HflK protein [Pseudomonas syringae pv. lachrymans str. M301315]
          Length = 397

 Score =  182 bits (463), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 96/284 (33%), Positives = 175/284 (61%), Gaps = 12/284 (4%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           +++ +F  + +IY+V   E+AV LRFG+  ++   PGL++ F P D+ + ++ + R++  
Sbjct: 77  VVLVAFWLYSAIYVVDEQEQAVVLRFGQ-YHETVGPGLNIYFPPFDR-KYMENVTRERAY 134

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
                   S  G +LT D+NIV +  +V Y +++ + ++ N++ P  +L+  +ESA+R V
Sbjct: 135 --------SKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQPEISLQHATESALRHV 186

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG      +    R+ +A E++  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V 
Sbjct: 187 VGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSAAAPREVQEAFDDVI 246

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A+GEADRF  +  +Y
Sbjct: 247 RAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEVVSRAKGEADRFTKLVAEY 306

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
             AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 307 RKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 350


>gi|320321882|gb|EFW77978.1| HflK protein [Pseudomonas syringae pv. glycinea str. B076]
          Length = 399

 Score =  182 bits (463), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 96/284 (33%), Positives = 175/284 (61%), Gaps = 12/284 (4%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           +++ +F  + +IY+V   E+AV LRFG+  ++   PGL++ F P D+ + ++ + R++  
Sbjct: 77  VVLVAFWLYSAIYVVDEQEQAVVLRFGQ-YHETVGPGLNIYFPPFDR-KYMENVTRERAY 134

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
                   S  G +LT D+NIV +  +V Y +++ + ++ N++ P  +L+  +ESA+R V
Sbjct: 135 --------SKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQPEISLQHATESALRHV 186

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG      +    R+ +A E++  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V 
Sbjct: 187 VGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSAAAPREVQEAFDDVI 246

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A+GEADRF  +  +Y
Sbjct: 247 RAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEVVSRAKGEADRFTKLVAEY 306

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
             AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 307 RKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 350


>gi|71735270|ref|YP_272869.1| HflK protein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|289623758|ref|ZP_06456712.1| HflK protein [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289648625|ref|ZP_06479968.1| HflK protein [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298484913|ref|ZP_07003012.1| HflK protein [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|71555823|gb|AAZ35034.1| HflK protein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|298160600|gb|EFI01622.1| HflK protein [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|320331013|gb|EFW86987.1| HflK protein [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330865896|gb|EGH00605.1| HflK protein [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330872252|gb|EGH06401.1| HflK protein [Pseudomonas syringae pv. glycinea str. race 4]
          Length = 399

 Score =  182 bits (463), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 96/284 (33%), Positives = 175/284 (61%), Gaps = 12/284 (4%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           +++ +F  + +IY+V   E+AV LRFG+  ++   PGL++ F P D+ + ++ + R++  
Sbjct: 77  VVLVAFWLYSAIYVVDEQEQAVVLRFGQ-YHETVGPGLNIYFPPFDR-KYMENVTRERAY 134

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
                   S  G +LT D+NIV +  +V Y +++ + ++ N++ P  +L+  +ESA+R V
Sbjct: 135 --------SKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQPEISLQHATESALRHV 186

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG      +    R+ +A E++  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V 
Sbjct: 187 VGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSAAAPREVQEAFDDVI 246

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A+GEADRF  +  +Y
Sbjct: 247 RAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEVVSRAKGEADRFTKLVAEY 306

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
             AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 307 RKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 350


>gi|15600135|ref|NP_253629.1| protease subunit HflK [Pseudomonas aeruginosa PAO1]
 gi|107104041|ref|ZP_01367959.1| hypothetical protein PaerPA_01005114 [Pseudomonas aeruginosa PACS2]
 gi|116053091|ref|YP_793410.1| protease subunit HflK [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218894037|ref|YP_002442906.1| protease subunit HflK [Pseudomonas aeruginosa LESB58]
 gi|254244167|ref|ZP_04937489.1| protease subunit HflK [Pseudomonas aeruginosa 2192]
 gi|296391782|ref|ZP_06881257.1| protease subunit HflK [Pseudomonas aeruginosa PAb1]
 gi|9951222|gb|AAG08327.1|AE004907_5 protease subunit HflK [Pseudomonas aeruginosa PAO1]
 gi|115588312|gb|ABJ14327.1| protease subunit HflK [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126197545|gb|EAZ61608.1| protease subunit HflK [Pseudomonas aeruginosa 2192]
 gi|218774265|emb|CAW30082.1| protease subunit HflK [Pseudomonas aeruginosa LESB58]
          Length = 400

 Score =  182 bits (463), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 105/283 (37%), Positives = 169/283 (59%), Gaps = 12/283 (4%)

Query: 59  LIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIG 118
           ++     + +IY+V   E+AV LRFGK    V  PGL+  F PID+        R Q+  
Sbjct: 82  ILAVLWLYNAIYVVDEQEQAVILRFGKYYETVG-PGLNFYFPPIDK--------RFQENV 132

Query: 119 GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVV 178
            R  +  S  G +LT D+NIV +  +V Y +++ + ++ N++ P  +L+Q +ESA+R V 
Sbjct: 133 TRERAY-SKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQPEVSLQQATESALRHVA 191

Query: 179 GRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQR 238
           G      I    R+Q+A EVR  +Q+ +D Y++GI +  ++I+ A  PREV +AFD+V R
Sbjct: 192 GSTTMDRILTEGREQMATEVRERLQRFLDTYRTGITVTQVNIQSAQAPREVQEAFDDVIR 251

Query: 239 AEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYV 298
           A +DE R   ++  Y+N V+  ARG+A  I E +  Y+D +I  AQGEADRF  +  +Y 
Sbjct: 252 AREDEQREKNQAEAYANGVVPEARGQAQRIIEEANGYRDEVISRAQGEADRFSKLLVEYR 311

Query: 299 NAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
            AP + R+R+YL+TM+ +  +  KV++   + Q+ + YLPL++
Sbjct: 312 KAPEVTRERLYLDTMQEVFSQTSKVLVTGQQGQNNLLYLPLDK 354


>gi|330886602|gb|EGH20263.1| HflK protein [Pseudomonas syringae pv. mori str. 301020]
          Length = 399

 Score =  182 bits (463), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 96/284 (33%), Positives = 175/284 (61%), Gaps = 12/284 (4%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           +++ +F  + +IY+V   E+AV LRFG+  ++   PGL++ F P D+ + ++ + R++  
Sbjct: 77  VVLVAFWLYSAIYVVDEQEQAVVLRFGQ-YHETVGPGLNIYFPPFDR-KYMENVTRERAY 134

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
                   S  G +LT D+NIV +  +V Y +++ + ++ N++ P  +L+  +ESA+R V
Sbjct: 135 --------SKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQPEISLQHATESALRHV 186

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG      +    R+ +A E++  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V 
Sbjct: 187 VGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSAAAPREVQEAFDDVI 246

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A+GEADRF  +  +Y
Sbjct: 247 RAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEVVSRAKGEADRFTKLVAEY 306

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
             AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 307 RKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 350


>gi|170739396|ref|YP_001768051.1| HflK protein [Methylobacterium sp. 4-46]
 gi|168193670|gb|ACA15617.1| HflK protein [Methylobacterium sp. 4-46]
          Length = 386

 Score =  182 bits (463), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 117/334 (35%), Positives = 182/334 (54%), Gaps = 23/334 (6%)

Query: 27  PFDVEAIIRYIKDKFDLI---PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRF 83
           P D+E ++R  +D+   +           + + +L++ +       Y V P++  +   F
Sbjct: 40  PPDLEDLLRRGQDRLRTLMPGGGPVGGRGIALAVLIVAAVWLLTGFYTVAPNQVGINTVF 99

Query: 84  GKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQ-KIGGRSASVGSN-------SGLILTG 134
           G+    V   GL   F +PI  V    V +    +IG RS  VG           L+LTG
Sbjct: 100 GRYTGQVG-EGLRYNFPYPIGAVVKPNVGQVNSIQIGYRSG-VGPQRMRDVPEESLMLTG 157

Query: 135 DQNIVGLHFSVLYVVTDPRL--YLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQ 192
           D NIV + F V + V   +   ++FNL+NP  T+K V+ESAMREVVGRR    I  +++ 
Sbjct: 158 DDNIVDIDFDVQWRVNPAKAEEFVFNLQNPEGTIKSVAESAMREVVGRRKIQAILTTEQT 217

Query: 193 QIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNK 252
            +A EV+ +IQ+ +D Y +G+LIN + ++  SPP+EV  AF +V  A+QD +R   E+  
Sbjct: 218 SVAQEVQEIIQRALDSYGAGVLINVVQLQGVSPPQEVRQAFVDVNAAQQDAERARNEART 277

Query: 253 YSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLET 312
           Y++RV+  A G AS + + +  YK +   EA G+A RF  +Y  Y  AP + R+R++L+T
Sbjct: 278 YASRVVPQAEGRASQMIQQAEGYKSQATAEATGQAGRFREVYESYKLAPAVSRERMFLDT 337

Query: 313 MEGILKKAKKVIIDKKQS-------VMPYLPLNE 339
           ME +L    KVI+D+  +       V+P LPLNE
Sbjct: 338 MEKVLGSVNKVILDQPGTGGSAAPGVIPVLPLNE 371


>gi|117924871|ref|YP_865488.1| HflK protein [Magnetococcus sp. MC-1]
 gi|117608627|gb|ABK44082.1| protease FtsH subunit HflK [Magnetococcus sp. MC-1]
          Length = 367

 Score =  182 bits (462), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 124/362 (34%), Positives = 194/362 (53%), Gaps = 33/362 (9%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL--L 58
           MS++ N  D  P    G   N    P  D+E I+R  KD+F          S+  IL  +
Sbjct: 1   MSWNGNGGDQGPW---GQRPNNPQQP--DLEQILRAAKDRFGGGNLPGGKLSLIFILGVV 55

Query: 59  LIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQKI 117
           L+G F     IY V P+E+AV +RFGK   +   PG++M   WPI+ VE    + + Q+I
Sbjct: 56  LVGWFAT--GIYTVGPNEQAVVVRFGK-YVETTGPGVNMHLPWPIESVEGKPKVLQNQRI 112

Query: 118 -------GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN------------ 158
                  G R   V + S + LTGD+NI+ ++ SV + + D    LF             
Sbjct: 113 EIGFRSNGSREIDVPAESKM-LTGDENIIDINMSVQFKIKDAADSLFQVSDVVSGTRGRE 171

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           + +P   ++Q SE+A+REVVG+    +   S ++QI  + R L+Q+ +D Y+SG  I  +
Sbjct: 172 IRDPSLLIRQASETALREVVGKNKIDEALTSGKEQIETQTRELVQEILDSYRSGYQIEGV 231

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
            ++   PP EV DAF +V  A +D+ R V E+  YS  +L  A G ++ +   + AYK  
Sbjct: 232 QLQQVQPPEEVIDAFKDVASAREDKVRKVNEAQGYSADILPKAMGTSAQLINEAEAYKQS 291

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLP 336
            +  A+G+ +RF ++Y +Y  A  + R R+YLETME ++ +A KVII  +  + V+P+LP
Sbjct: 292 KVARARGDVERFNNLYVEYKKAKDITRTRLYLETMEEVMARANKVIISPEAGRGVLPHLP 351

Query: 337 LN 338
           L+
Sbjct: 352 LD 353


>gi|53803935|ref|YP_114413.1| hflK protein [Methylococcus capsulatus str. Bath]
 gi|53757696|gb|AAU91987.1| hflK protein [Methylococcus capsulatus str. Bath]
          Length = 403

 Score =  182 bits (462), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 115/333 (34%), Positives = 182/333 (54%), Gaps = 22/333 (6%)

Query: 27  PFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCA-------FQSIYIVHPDERAV 79
           P D++ ++R ++++ + +   K  G       L G   A          IYIV    R V
Sbjct: 23  PPDLDEVLRNLQERINKLFGRKPDGGGGNATRLAGMIGAAAVAVWGLTGIYIVDEGSRGV 82

Query: 80  ELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI-------GGRSASVGS-----N 127
             RFGK   +   PG H   WP     +  V   QQ+        GGR  +VGS      
Sbjct: 83  VSRFGK-YVETTQPGPHW-HWPSPVETVTVVNVEQQRFVEVGYRSGGRQQAVGSLGSVPR 140

Query: 128 SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIF 187
             L+LT D+NIV +  +V Y + D + YLFN+ +P  TLKQV+ESA R V+G      + 
Sbjct: 141 EALMLTQDENIVDVRLAVQYQIKDAKEYLFNVLDPEGTLKQVTESAERSVIGNSTMDFVL 200

Query: 188 RSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFV 247
              R  IA ++++ IQ+ +D Y +GI I T+++ DA PP +V  AF++  +A +DE R  
Sbjct: 201 TEGRSSIASDIKSEIQEILDQYHAGIRIITVNLVDAQPPEDVQAAFEDAIKAREDEQRLK 260

Query: 248 EESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKR 307
            E+  Y+N V+  ARG AS + + S  YK+++I  A+GEA RF  I  +Y  AP ++R+R
Sbjct: 261 NEAEAYANEVVPKARGAASRLIQESEGYKEKVIARARGEAGRFERILAEYEKAPEVMRER 320

Query: 308 IYLETMEGILKKAKKVIID-KKQSVMPYLPLNE 339
           +Y+E+M+ ++ +A  +++D K  + + YLPL++
Sbjct: 321 LYIESMQEVMGRANTLLLDVKGGNNVVYLPLDK 353


>gi|330873783|gb|EGH07932.1| hflK protein [Pseudomonas syringae pv. morsprunorum str. M302280PT]
          Length = 395

 Score =  182 bits (462), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 96/284 (33%), Positives = 173/284 (60%), Gaps = 12/284 (4%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           +++ +F  + +IY+V   E+AV LRFG+  ++   PGL++ F P D+ + ++ + R++  
Sbjct: 78  VVLVAFWLYSAIYVVDEQEQAVVLRFGQ-YHETVGPGLNIYFPPFDR-KYMENVTRERAY 135

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
                   S  G +LT D+NIV +  +V Y +++   ++ N++ P  +L+  +ESA+R V
Sbjct: 136 --------SKQGQMLTEDENIVEVPLTVQYKISNLEAFVLNVDQPEISLQHATESALRHV 187

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG      +    R+ +A E++  +Q+ +D Y +GI +  ++++ A+ PREV +AFD+V 
Sbjct: 188 VGSTAMDQVLTEGRELMASEIKERLQRFLDTYGTGITVTQVNVQSAAAPREVQEAFDDVI 247

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A+GEADRF  +  +Y
Sbjct: 248 RAREDEQRSRNQAESYANGVIPEARGQAQRILEDANGYRDEVVSRAKGEADRFTKLVAEY 307

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
             AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 308 RKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 351


>gi|28872054|ref|NP_794673.1| hflK protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|28855307|gb|AAO58368.1| hflK protein [Pseudomonas syringae pv. tomato str. DC3000]
          Length = 395

 Score =  182 bits (461), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 96/284 (33%), Positives = 173/284 (60%), Gaps = 12/284 (4%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           +++ +F  + +IY+V   E+AV LRFG+  ++   PGL++ F P D+ + ++ + R++  
Sbjct: 78  VVLVAFWLYSAIYVVDEQEQAVVLRFGQ-YHETVGPGLNIYFPPFDR-KYMENVTRERAY 135

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
                   S  G +LT D+NIV +  +V Y +++   ++ N++ P  +L+  +ESA+R V
Sbjct: 136 --------SKQGQMLTEDENIVEVPLTVQYKISNLEAFVLNVDQPEISLQHATESALRHV 187

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG      +    R+ +A E++  +Q+ +D Y +GI +  ++++ A+ PREV +AFD+V 
Sbjct: 188 VGSTAMDQVLTEGRELMASEIKERLQRFLDTYGTGITVTQVNVQSAAAPREVQEAFDDVI 247

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A+GEADRF  +  +Y
Sbjct: 248 RAREDEQRSRNQAESYANGVIPEARGQAQRILEDANGYRDEVVSRAKGEADRFTKLVAEY 307

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
             AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 308 RKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 351


>gi|330807233|ref|YP_004351695.1| hypothetical protein PSEBR_a543 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375341|gb|AEA66691.1| Phage-related protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 390

 Score =  182 bits (461), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 172/285 (60%), Gaps = 13/285 (4%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           +++ +   + ++Y+V   E+AV LRFGK    V  PGL++ F PIDQ + ++ + R++  
Sbjct: 75  VVLAAVWLYSAVYVVDEQEQAVVLRFGKYYETVG-PGLNIYFPPIDQ-KYLENVTRERAY 132

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
                   +  G +LT D+NIV +  +V Y +T+ + ++ N++ P  +L+  +ESA+R V
Sbjct: 133 --------TKQGQMLTEDENIVEVPLTVQYKITNLQDFVLNVDQPETSLQHATESALRHV 184

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG      +    R+ +A E++  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V 
Sbjct: 185 VGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSAAAPREVQEAFDDVI 244

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A+GEADRF  +  +Y
Sbjct: 245 RAREDEQRSRNQAETYANGVVPEARGQAQRIIEDANGYRDEVVSRAKGEADRFTKLVAEY 304

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVII---DKKQSVMPYLPLNE 339
             AP + R+R+YL+TM+ +     KV++      QS + YLPL++
Sbjct: 305 RKAPEVTRERLYLDTMQEVFSNTSKVLVTGNKNGQSNLLYLPLDK 349


>gi|218887760|ref|YP_002437081.1| HflK protein [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218758714|gb|ACL09613.1| HflK protein [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 388

 Score =  182 bits (461), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 112/321 (34%), Positives = 175/321 (54%), Gaps = 22/321 (6%)

Query: 40  KFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDV-FLPGLHMM 98
           KF   PF    G V  ++ ++    A   IYIV PDE  V LRFG+    V   P  H+ 
Sbjct: 62  KFREYPF--PAGKVVALVFVL--LWAASGIYIVEPDELGVVLRFGRYDRTVESGPHYHLP 117

Query: 99  FWPIDQVEIVKVIERQQ-KIGGRSASVGSN-----------SGLILTGDQNIVGLHFSVL 146
           F P++ V   KV + Q+ ++G RS + G++              +LTGD+NIV + FS+ 
Sbjct: 118 F-PMESVYTPKVTQVQRAEVGFRSLAQGASFQQGGGRIVPEEAAMLTGDENIVNVQFSIQ 176

Query: 147 YVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTM 206
           + + DP  YLFN+ NP   ++   E+AMREV+G           +Q I  E   L+Q  +
Sbjct: 177 FQIKDPVQYLFNVTNPAAVVRSAGEAAMREVIGNSRIDAALTDGKQLIQNETLTLLQAIL 236

Query: 207 DYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEAS 266
           D Y+ G+ +  + ++D  PP+EV DAF +V  A +D+ R + E+  Y N +L   RG A+
Sbjct: 237 DTYQVGVRVLAVQMQDVHPPKEVIDAFKDVASAREDKSRIINEAEAYQNEILPRTRGLAA 296

Query: 267 HIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKA--KKVI 324
            +   + AY+   ++EA+G+A RFL++  +Y  A  + RKR+YLE ME +L     +K++
Sbjct: 297 EVINQAEAYRQARVREAEGQASRFLAVLKEYNKAKDVTRKRLYLEAMEEVLSAPGMEKIV 356

Query: 325 I--DKKQSVMPYLPLNEAFSR 343
           I  +    ++PYLPL+ A  R
Sbjct: 357 IPGEAGARMLPYLPLDGARPR 377


>gi|213967926|ref|ZP_03396072.1| hflK protein [Pseudomonas syringae pv. tomato T1]
 gi|301384446|ref|ZP_07232864.1| hflK protein [Pseudomonas syringae pv. tomato Max13]
 gi|302064113|ref|ZP_07255654.1| hflK protein [Pseudomonas syringae pv. tomato K40]
 gi|302132266|ref|ZP_07258256.1| hflK protein [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|213927269|gb|EEB60818.1| hflK protein [Pseudomonas syringae pv. tomato T1]
 gi|331014612|gb|EGH94668.1| hflK protein [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 395

 Score =  182 bits (461), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 96/284 (33%), Positives = 173/284 (60%), Gaps = 12/284 (4%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           +++ +F  + +IY+V   E+AV LRFG+  ++   PGL++ F P D+ + ++ + R++  
Sbjct: 78  VVLVAFWLYSAIYVVDEQEQAVVLRFGQ-YHETVGPGLNIYFPPFDR-KYMENVTRERAY 135

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
                   S  G +LT D+NIV +  +V Y +++   ++ N++ P  +L+  +ESA+R V
Sbjct: 136 --------SKQGQMLTEDENIVEVPLTVQYKISNLEAFVLNVDQPEISLQHATESALRHV 187

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG      +    R+ +A E++  +Q+ +D Y +GI +  ++++ A+ PREV +AFD+V 
Sbjct: 188 VGSTAMDQVLTEGRELMASEIKERLQRFLDTYGTGITVTQVNVQSAAAPREVQEAFDDVI 247

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A+GEADRF  +  +Y
Sbjct: 248 RAREDEQRSRNQAESYANGVIPEARGQAQRILEDANGYRDEVVSRAKGEADRFTKLVAEY 307

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
             AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 308 RKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 351


>gi|254450942|ref|ZP_05064379.1| HflK protein [Octadecabacter antarcticus 238]
 gi|198265348|gb|EDY89618.1| HflK protein [Octadecabacter antarcticus 238]
          Length = 321

 Score =  182 bits (461), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 109/304 (35%), Positives = 171/304 (56%), Gaps = 32/304 (10%)

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI-ERQQKIG------ 118
           F S+Y V P++R+VEL  G+  + +   GL+   WPI   EIV V  ER  +IG      
Sbjct: 9   FTSVYTVRPEQRSVELFLGE-FSAIGESGLNFAPWPIVTYEIVNVSQERVIEIGEEEVPA 67

Query: 119 ------GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
                    + + ++ GL+LTGD+NIV + F V++ + +P  +LFNL +P  T+  V+ES
Sbjct: 68  QLSDSRAVQSQLEADIGLMLTGDENIVDIDFQVVWNIPEPDKFLFNLADPETTITAVAES 127

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA-- 230
           AMRE++       + R +R  I   ++ L Q T++ Y SG+ I  I++++A PP      
Sbjct: 128 AMREIIATSELASLNR-ERAVIRERLQELTQSTLNSYDSGVNIVRINLDEADPPATQVQV 186

Query: 231 -------------DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKD 277
                        DAF +VQ AEQ+  +   +++ Y+NRV   ARG A+ I E +  Y+ 
Sbjct: 187 VDIDGNERLTSPLDAFRDVQDAEQERIQLQNQADAYANRVTAGARGNAAQIIEGAEGYRA 246

Query: 278 RIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ--SVMPYL 335
           R++ EA+GEA RFL++  +Y  AP + R+R+YLET E +   A  +++D      V+PYL
Sbjct: 247 RVVNEAEGEASRFLAVLNEYSKAPEVTRQRLYLETAESVFGSADIILLDDNAGGGVVPYL 306

Query: 336 PLNE 339
           PL+E
Sbjct: 307 PLDE 310


>gi|307545952|ref|YP_003898431.1| HflK protein [Halomonas elongata DSM 2581]
 gi|307217976|emb|CBV43246.1| HflK protein [Halomonas elongata DSM 2581]
          Length = 405

 Score =  182 bits (461), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 106/293 (36%), Positives = 171/293 (58%), Gaps = 14/293 (4%)

Query: 47  FKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVE 106
           F   G + I+ L + +   F   Y+V   ER V LRFGK +  V  PGL      ID V 
Sbjct: 77  FALPGLLLIVALAVWAASGF---YLVDQSERGVVLRFGKYQETV-TPGLQWNPPLIDDVR 132

Query: 107 IVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
           +V V         R  SV S +  +LT D+NIV +  S  Y V+DPR Y+ N+ +P  +L
Sbjct: 133 MVNVT--------RVRSV-SQTQSMLTQDENIVSVEISAQYQVSDPRGYVLNVRDPELSL 183

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
           +   +SA+R VVG    +DI  S R+ +   V + +Q  +D Y +GI++ T+++E  SPP
Sbjct: 184 ENALDSALRHVVGGTDMIDILTSGREILGSSVNSRLQSYLDSYGTGIVLQTLNVESTSPP 243

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
             V DAFD+V RA +D  R + ++  Y+N V+ +A+G+A  I E    Y++ ++ EA+G+
Sbjct: 244 DAVQDAFDDVIRAREDRQRTINQAMAYANAVIPAAQGQAQRIVEQGQGYRESVVAEARGQ 303

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLN 338
           A+RF ++  QY +AP ++R+R+YL+T+  +  +  KV++D  +QS +  LP++
Sbjct: 304 ANRFNALLTQYQDAPAIMRERLYLDTLSDVYSETPKVMVDVSEQSPLMVLPMD 356


>gi|237798280|ref|ZP_04586741.1| hflK protein [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331021132|gb|EGI01189.1| hflK protein [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 398

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 96/284 (33%), Positives = 174/284 (61%), Gaps = 12/284 (4%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           +++ +F  + +IY+V   E+AV LRFG+  ++   PGL++ F P D+ + ++ + R++  
Sbjct: 78  VVLVAFWLYSAIYVVDEQEQAVVLRFGQ-YHETVGPGLNIYFPPFDR-KYMENVTRERAY 135

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
                   S  G +LT D+NIV +  +V Y +++ + ++ N++ P  +L+  +ESA+R V
Sbjct: 136 --------SKQGQMLTEDENIVEVPLTVQYKISNLKDFVLNVDQPEISLQHATESALRHV 187

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG      +    R+ +A E++  +Q+ +D Y +GI +  ++++ A+ PREV +AFD+V 
Sbjct: 188 VGSTAMDQVLTEGRELMASEIKERLQRFLDTYGTGITVTQVNVQSAAAPREVQEAFDDVI 247

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A+GEADRF  +  +Y
Sbjct: 248 RAREDEQRSRNQAESYANGVIPEARGQAQRILEDANGYRDEVVSRAKGEADRFTKLVAEY 307

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
             AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 308 RKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 351


>gi|77166046|ref|YP_344571.1| HflK-like protein [Nitrosococcus oceani ATCC 19707]
 gi|76884360|gb|ABA59041.1| protease FtsH subunit HflK [Nitrosococcus oceani ATCC 19707]
          Length = 413

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 117/343 (34%), Positives = 185/343 (53%), Gaps = 26/343 (7%)

Query: 21  NGDGLPPFDVEAIIRYIKDKFDLI-------------PFFKSYGSVY---IILLLIGSFC 64
           +GD   P D++ +IR +K K   +             P     GS+    +++L++    
Sbjct: 25  DGDRQGPPDLDEVIRNLKAKLSGLFGGKGGGGPGGGRPTLGRGGSILGLALLVLVLAVAW 84

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE-RQQKIGGRSA 122
               IYIV P ER V LRFG+       PG H    +PI++VE+V V + R  +IG RS 
Sbjct: 85  GLSGIYIVAPAERGVVLRFGE-YVATTEPGPHWHIPYPIEKVELVDVAQIRSYEIGYRST 143

Query: 123 SVGS------NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMRE 176
             G          L+LT D+NIV +  +V Y V D   YLFN+ N    L+QV ESA+RE
Sbjct: 144 GRGQAGSPVPTEALMLTQDENIVDVRIAVQYRVKDAANYLFNVRNADTNLRQVVESALRE 203

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
            VG+     +    R  I L    L Q+ +D Y +G++I +++++DA PP +V  AF + 
Sbjct: 204 AVGKSKMDFVLTEGRSDIVLRTEELAQQVLDQYHAGLIITSVNMQDAQPPEQVQAAFADA 263

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
            +A +D+ R   E+  Y+N ++  ARG A    + + AYK  ++  A GE  RF  +  +
Sbjct: 264 IKAREDQQRLRNEAEAYANDIIPRARGAAFRKVQEAEAYKSEVVALAGGETARFEQVLKE 323

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLN 338
           Y++AP +  KR+YLETME ++++++KV++D  +   + YLPL+
Sbjct: 324 YLDAPEITEKRLYLETMETVMERSRKVLVDVPEGTNVFYLPLD 366


>gi|57239530|ref|YP_180666.1| protease activity modulator hflk [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58579514|ref|YP_197726.1| protease activity modulator hflk [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58617568|ref|YP_196767.1| protease activity modulator hflk [Ehrlichia ruminantium str.
           Gardel]
 gi|57161609|emb|CAH58537.1| putative HflK protein [Ehrlichia ruminantium str. Welgevonden]
 gi|58417180|emb|CAI28293.1| Protease activity modulator hflk [Ehrlichia ruminantium str.
           Gardel]
 gi|58418140|emb|CAI27344.1| Protease activity modulator hflk [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 356

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 109/295 (36%), Positives = 178/295 (60%), Gaps = 19/295 (6%)

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGL-HMMFWPIDQVEIVKV-IER 113
           +LL +GS       Y+V P+E AV+L FGK  N V  PGL + +  PI +V  +KV    
Sbjct: 67  LLLYMGS-----GFYVVEPEEEAVQLIFGKYYNTVG-PGLRYHLPSPIGEVTKLKVKTVN 120

Query: 114 QQKIGGR---SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN--PGETLKQ 168
           +++IG R     ++G   G++LTGD+NIV ++F V + + +   YLF + +   G+T+K 
Sbjct: 121 REEIGSRFHVDNTLGHGEGVMLTGDENIVHINFDVHWRINNAYNYLFKVRDNQAGDTVKN 180

Query: 169 VSESAMREVVGRR---FAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASP 225
            +ESAMRE++G+    FA++     R  I+ E ++L+Q  +D+Y  G+ + +I ++   P
Sbjct: 181 AAESAMREIIGKSSISFAIE--GKGRAAISQETKSLLQNILDHYNMGVEVLSIQLKKVDP 238

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           P +V  +F +VQ A  D+++ + E+  Y N+V+  A+GEA  I+  + AY+  ++  A+G
Sbjct: 239 PEKVISSFRDVQSARADKEKLINEAYAYRNQVVPRAKGEAIKIKLDAEAYESEVVNAAEG 298

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII-DKKQSVMPYLPLNE 339
            A RFL+IY +Y   PT +R R+YLETME IL K  KV+  D  + ++ + PL E
Sbjct: 299 NAQRFLAIYKEYAQQPTAVRNRLYLETMEEILNKNDKVVFTDDLKGMLSHFPLIE 353


>gi|302878479|ref|YP_003847043.1| HflK protein [Gallionella capsiferriformans ES-2]
 gi|302581268|gb|ADL55279.1| HflK protein [Gallionella capsiferriformans ES-2]
          Length = 395

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 119/366 (32%), Positives = 196/366 (53%), Gaps = 40/366 (10%)

Query: 6   NNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI-------------------PF 46
           N+  W      G+N N  G P  D+E ++R +K +  ++                     
Sbjct: 4   NDPQW------GNNKNNSGPP--DLEELLRKLKAQVAILLGDKGGGNKGGGGNMPKLGSG 55

Query: 47  FKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPG--LHMMFWPIDQ 104
                +V  +L+ +GS       YIV   +R V LRFGK + DV + G   HM + P++ 
Sbjct: 56  GLGLLAVIAVLIWLGS-----GFYIVDASQRGVVLRFGK-QVDVTMAGPRWHMPY-PVET 108

Query: 105 VEIVKVIE-RQQKIGGRS--ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
           VE+V + + R  ++G R    +  +   L+LT D+NI+ + F+V Y + DP  YLFN  N
Sbjct: 109 VELVNLSQVRTVEVGYRENVKNKVAKESLMLTDDENIIDIQFAVQYFLRDPAEYLFNNRN 168

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
             E ++Q +E+A+REVVG+     +    R+ +A     LIQ+ +D YKSGI+I+ ++++
Sbjct: 169 SDENVRQAAETAIREVVGKNKMDFVLYEGREAVAANATKLIQEILDRYKSGIVISKLTMQ 228

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
           +A PP +V  AFD+  +A QD +R   E   Y+N V+  A+G A+ + + S  YK  +I 
Sbjct: 229 NAQPPEQVQAAFDDAVKAGQDRERQKNEGQAYANDVVPRAKGTAARLIQESEGYKQSVIA 288

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEA 340
            A+G+A RF  I  +Y  AP + R R+YL+ M  ++    KV++D+K  + + YLPL++ 
Sbjct: 289 NAEGDASRFKQILVEYEKAPAVTRDRMYLDMMSQVMGNISKVMVDQKNGNSLLYLPLDKL 348

Query: 341 FSRIQT 346
               +T
Sbjct: 349 IESSRT 354


>gi|323143743|ref|ZP_08078411.1| HflK protein [Succinatimonas hippei YIT 12066]
 gi|322416456|gb|EFY07122.1| HflK protein [Succinatimonas hippei YIT 12066]
          Length = 437

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 106/292 (36%), Positives = 165/292 (56%), Gaps = 13/292 (4%)

Query: 50  YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVK 109
           YG   ++ + +G +  F   Y V   ER V LRFGK   DV  PGL   F  ID V +V 
Sbjct: 89  YGLYLLVAVALGVYI-FSGFYTVREAERGVVLRFGK-VYDVVEPGLRWKFTGIDDVNVVD 146

Query: 110 VIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
            IE+ + I         +SG++LT D+N+V +   V Y ++DP  YL+++ +P  +L + 
Sbjct: 147 -IEQVRAI--------QSSGMMLTEDENVVIVEMDVQYRISDPVKYLYSVTDPDNSLTEA 197

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           ++SA+R VVG     DI  S R+ +    R+L+   ++ Y  G+ +  ++   A  P EV
Sbjct: 198 TDSALRYVVGHTMMDDILTSGREMVRQNTRDLLVSIIEPYDMGLSVVDVNFLPAHAPDEV 257

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
            +AFD+   A++DE RF  E+  Y+N VL  A G+   I + + AY+ R++ EAQG+  R
Sbjct: 258 KEAFDDAIAAQEDEQRFKREAEAYANEVLPRADGQVQRITQEAEAYRSRVVLEAQGQVAR 317

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMP--YLPLNE 339
           F  I  +Y+ AP + RKRIYL+TM+ ++  + K+I+D  +   P  YLPL E
Sbjct: 318 FEQILPEYLAAPEITRKRIYLDTMQQVMGSSSKIILDTPEGSSPVLYLPLPE 369


>gi|330960087|gb|EGH60347.1| hflK protein [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 396

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 95/284 (33%), Positives = 174/284 (61%), Gaps = 12/284 (4%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           +++ +F  + +IY+V   E+AV LRFG+  ++   PGL++ F P D+ + ++ + R++  
Sbjct: 79  VVLVAFWLYSAIYVVDEQEQAVVLRFGQ-YHETVGPGLNIYFPPFDR-KYMENVTRERAY 136

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
                   +  G +LT D+NIV +  +V Y +++ + ++ N++ P  +L+  +ESA+R V
Sbjct: 137 --------TKQGQMLTEDENIVEVPLTVQYKISNLKDFVLNVDQPEISLQHATESALRHV 188

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG      +    R+ +A E++  +Q+ +D Y +GI +  ++++ A+ PREV +AFD+V 
Sbjct: 189 VGSTAMDQVLTEGRELMASEIKERLQRFLDTYGTGITVTQVNVQSAAAPREVQEAFDDVI 248

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A+GEADRF  +  +Y
Sbjct: 249 RAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEVVSRAKGEADRFTKLVAEY 308

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
             AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 309 RKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 352


>gi|319941502|ref|ZP_08015829.1| HflK protein [Sutterella wadsworthensis 3_1_45B]
 gi|319804976|gb|EFW01815.1| HflK protein [Sutterella wadsworthensis 3_1_45B]
          Length = 558

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 110/302 (36%), Positives = 170/302 (56%), Gaps = 11/302 (3%)

Query: 52  SVYIILLLIG-SFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVK 109
           SV  +  +IG S   F   YIV   +  V   FG       +PG++     PI  VE+V 
Sbjct: 210 SVLAVCAVIGWSVSGF---YIVPEGQTGVVTTFGAYSKST-MPGINWHLPAPIQDVELVD 265

Query: 110 VIE-RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVV---TDPRLYLFNLENPGET 165
           V   R  +IG R  +      L+LT D+NIV + F+V Y +   T  + YLFN   P  +
Sbjct: 266 VSSVRTAEIGMRGTTDRLREALMLTDDENIVDVQFNVQYRIKPETGAKDYLFNTRAPDAS 325

Query: 166 LKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASP 225
           + Q +ESAMREVVGR+    +    + +IA  VRN +Q  +D Y +GI + +++I++A P
Sbjct: 326 VTQAAESAMREVVGRKAMDSVLFESKAEIAEAVRNSMQAMLDRYSTGIEVMSVAIQNAQP 385

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           P++V  AF++  +A QD +R +     Y N V+  A+G AS ++E +  YK R+++ A+G
Sbjct: 386 PQQVQAAFNDAVKAGQDRERQINLGEAYMNAVIPKAQGTASRLKEEAEGYKARVVETARG 445

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFSRI 344
           +ADRF S+Y +Y  AP + R RIY++ M  I +   KV +D+K  S + YLPL++  +  
Sbjct: 446 DADRFTSVYTEYAKAPQVTRDRIYVDAMRDIYQNVTKVYVDQKSGSNLLYLPLDKIVAST 505

Query: 345 QT 346
           Q 
Sbjct: 506 QA 507


>gi|292493694|ref|YP_003529133.1| HflK protein [Nitrosococcus halophilus Nc4]
 gi|291582289|gb|ADE16746.1| HflK protein [Nitrosococcus halophilus Nc4]
          Length = 415

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 105/293 (35%), Positives = 168/293 (57%), Gaps = 17/293 (5%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE- 112
           ++ LL G       IYIV P ER V LRFG+       PG H    +PI++VE+V V + 
Sbjct: 84  VVWLLSG-------IYIVAPAERGVVLRFGQYVT-TTEPGPHWHIPYPIEKVELVDVSQI 135

Query: 113 RQQKIG------GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
           R  +IG      GR+ S      L+LT D+NIV +  +V Y V D   Y+FN+ N    L
Sbjct: 136 RSYEIGYRSTGRGRAGSPVPTEALMLTEDENIVDIRIAVQYRVKDAANYVFNVRNADINL 195

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
           +QV ESA+RE+VG+     +    R +I L    L Q+ +D Y +G+++ +++++DA PP
Sbjct: 196 RQVVESALREIVGKNTMDFVLTEGRSEIVLRTEKLAQEILDQYNAGLIVTSVNMQDAQPP 255

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            +V  AF +  +A +D+ R   E+  Y+N +L  ARG A    + + AYK+ ++  A+GE
Sbjct: 256 EQVQAAFADAIKAREDQQRLRNEAEAYANDILPKARGAAFRRVQEAEAYKNEVVAHAEGE 315

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLN 338
             RF  +  +Y+ AP +  +R+YLE ME ++ +++KV++D  +   + YLPL+
Sbjct: 316 TARFAQVLKEYLEAPQITEERLYLEAMESVMDRSRKVMVDVPEGTNVFYLPLD 368


>gi|33602144|ref|NP_889704.1| hypothetical protein BB3168 [Bordetella bronchiseptica RB50]
 gi|33576582|emb|CAE33660.1| putative membrane protein [Bordetella bronchiseptica RB50]
          Length = 380

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 107/281 (38%), Positives = 169/281 (60%), Gaps = 16/281 (5%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE-RQQKIGGRSASVGS-- 126
           +IV   + AV  +FGK K+         M +PI   E+V V + R  ++G R  S     
Sbjct: 48  FIVQEGQVAVVTQFGKYKSTAPAGFQWRMPYPIQNHEMVNVSQLRTFEVGFRGGSRNKVL 107

Query: 127 NSGLILTGDQNIVGLHFSVLYVVTDPRL-------YLFNLENPGETLKQVSESAMREVVG 179
              L+LT D+NIV + F V Y     RL       YLF + +P E+++Q +E+AMRE+VG
Sbjct: 108 PEALMLTTDENIVDMQFVVQY-----RLRADGAPDYLFKMRDPDESVRQAAETAMREIVG 162

Query: 180 RRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRA 239
           ++    +    R ++A EV+NL+Q+ +D Y +GI I+T++I++  PP +V  AFD+  +A
Sbjct: 163 KKPMDFVLYEGRTEVAAEVQNLMQQILDRYSAGIQISTVAIQNVQPPEQVQAAFDDAVKA 222

Query: 240 EQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVN 299
            QD +R + E   Y+N+V+  A G+AS + E +  YK ++I +AQG A RF SI  +Y  
Sbjct: 223 GQDRERQINEGQAYANQVVPLASGQASRMIEQAEGYKAKVIGDAQGNASRFSSILNEYEK 282

Query: 300 APTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNE 339
           AP ++R+R+YLETM+ +  +A KV++D K  + M YLPL++
Sbjct: 283 APQVMRERLYLETMQEVFTRASKVMVDTKGGNNMLYLPLDK 323


>gi|113868331|ref|YP_726820.1| membrane protease subunit stomatin/prohibitin-like protein
           [Ralstonia eutropha H16]
 gi|113527107|emb|CAJ93452.1| membrane protease subunit, stomatin/prohibitin homolog [Ralstonia
           eutropha H16]
          Length = 453

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 105/298 (35%), Positives = 177/298 (59%), Gaps = 11/298 (3%)

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM-MFWPIDQVEIVK 109
           G+  I+  ++G + A    ++V   + AV L+FGK K     PG++  M WP+   EIV 
Sbjct: 112 GAGVIVAAVVGIWLA-SGFFMVQEGQTAVILQFGKFKYSTG-PGINWRMPWPVQSAEIVN 169

Query: 110 VIERQQKIGGRSASVGSNS---GLILTGDQNIVGLHFSVLYVVTDPRLYLF-NLENPG-- 163
           +   +    GRS S+  ++     +LT D+NI+ + F+V YV+ D   +LF N  + G  
Sbjct: 170 LSAVRSVEVGRSTSIKDSNLKDSSMLTQDENIIDVRFTVQYVIQDAGEFLFFNKTDRGGD 229

Query: 164 -ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIED 222
            E + Q +E+++RE+VGR     +    R+QIA ++   IQ  +  YK+GI + +++++ 
Sbjct: 230 EELVTQAAETSVREIVGRNKMDAVLYESREQIAQQLAKSIQAILTAYKTGIRVLSVNVQS 289

Query: 223 ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQE 282
             PP +V  AFD+V +A QD +R + E   Y+N +L  A+G A+ ++E S AY+ R++ +
Sbjct: 290 VQPPEQVQAAFDDVNKASQDRERAISEGQAYANDILPRAKGTAARLKEESEAYRSRVVAQ 349

Query: 283 AQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNE 339
           A+G+A RF S+  +Y  AP + R RIYLETM+ I   + KV++D +Q + + YLPL++
Sbjct: 350 AEGDASRFRSVQTEYAKAPQVTRDRIYLETMQQIYTNSTKVLVDARQGNNLLYLPLDK 407


>gi|194290000|ref|YP_002005907.1| protein hflk, cofactor of ATP-dependent protease ftsh [Cupriavidus
           taiwanensis LMG 19424]
 gi|193223835|emb|CAQ69842.1| Protein hflK, cofactor of ATP-dependent protease FtsH [Cupriavidus
           taiwanensis LMG 19424]
          Length = 454

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 104/306 (33%), Positives = 181/306 (59%), Gaps = 11/306 (3%)

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM-MFWPIDQVEIVK 109
           G+  I+  ++G + A    ++V   + AV L+FGK K     PG++  M WPI   E+V 
Sbjct: 111 GAGVIVAAVVGIWLA-SGFFMVQEGQTAVILQFGKFKYSAG-PGINWRMPWPIQSAEVVN 168

Query: 110 VIERQQKIGGRSASVGSNS---GLILTGDQNIVGLHFSVLYVVTDPRLYLF-NLENPG-- 163
           +   +    GRS S+  ++     +LT D+NI+ + F+V YV+ D   +LF N  + G  
Sbjct: 169 LSAVRSVEVGRSTSIKDSNLKDSSMLTQDENIIDVRFTVQYVIQDASEFLFFNKTDRGGD 228

Query: 164 -ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIED 222
            E + Q +E+++RE+VGR     +    R+QIA ++   IQ  +  YK+GI + +++++ 
Sbjct: 229 EELVTQAAETSVREIVGRNKMDAVLYENREQIAQQLAKSIQAILSAYKTGIRVLSVNVQS 288

Query: 223 ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQE 282
             PP +V  AFD+V +A QD +R + E   Y+N ++  A+G A+ ++E S AY+ R++ +
Sbjct: 289 VQPPEQVQAAFDDVNKASQDRERAISEGQAYANDIIPRAKGTAARLKEESEAYRARVVAQ 348

Query: 283 AQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAF 341
           A+G+A RF S+  +Y  AP + R RIYLETM+ I   + KV++D +Q + + YLPL++  
Sbjct: 349 AEGDAARFRSVQAEYAKAPQVTRDRIYLETMQQIYTNSTKVLVDARQGNNLLYLPLDKLM 408

Query: 342 SRIQTK 347
           ++ + +
Sbjct: 409 AQAEGR 414


>gi|149377522|ref|ZP_01895263.1| HflK protein [Marinobacter algicola DG893]
 gi|149358214|gb|EDM46695.1| HflK protein [Marinobacter algicola DG893]
          Length = 398

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 100/290 (34%), Positives = 160/290 (55%), Gaps = 11/290 (3%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           +  ++   +  FQS Y V+  ERAV LRFG+       PGL      ID V +V+V    
Sbjct: 76  LAAIIFAGYVIFQSFYTVNEQERAVVLRFGEFSR-TETPGLRFKVPLIDSVYLVRVT--- 131

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
                 +     ++G +LT D+N+V +   V Y V D + Y+ N+ +  + L   ++SA+
Sbjct: 132 ------NVRNAESTGQMLTQDENLVSVDLQVQYRVGDAKSYVLNVRDSNQALAFATDSAL 185

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           R  VG     D+    R ++A+ V   +Q  ++ Y +G+ I  +++E   PP  V DAF 
Sbjct: 186 RHEVGSSTLDDVLTEGRAELAVRVEQRLQSFLEEYGTGLTIVRVNVESTQPPDAVQDAFR 245

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           EVQRA +DE +  EE+  Y N+V+  ARG A  + E + AYK+ +I+ A+GE  RFL++ 
Sbjct: 246 EVQRAREDEQQVKEEAETYRNKVVPEARGRAQRLTEEAAAYKEEVIERARGETSRFLAVL 305

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSR 343
             Y  AP + R+R+Y++ +EG+L    KV++D + S  M YLPL+   +R
Sbjct: 306 DVYQTAPEVTRERMYIQALEGVLSNTSKVLVDTQSSDNMMYLPLDRLTNR 355


>gi|220920735|ref|YP_002496036.1| HflK protein [Methylobacterium nodulans ORS 2060]
 gi|219945341|gb|ACL55733.1| HflK protein [Methylobacterium nodulans ORS 2060]
          Length = 389

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 121/340 (35%), Positives = 188/340 (55%), Gaps = 31/340 (9%)

Query: 27  PFDVEAIIRYIKDKF-DLIPFFKSYGSVYIIL--LLIGSFCAFQSIYIVHPDERAVELRF 83
           P D+E ++R  +D+   L+P   S G   ++L  L++ +       Y V P++  +   F
Sbjct: 39  PPDLEDLLRRGQDRLRTLMPGGGSVGGRGVVLAVLIVAALWLLTGFYTVAPNQVGINTVF 98

Query: 84  GKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQ-KIGGRSASVGSNSG-----------L 130
           G+    V   GL   F +P+  V    V +    +IG RS   GS +G           L
Sbjct: 99  GRYTGQVG-EGLRYNFPYPVGAVVKPNVGQVNSIQIGYRS---GSGTGPQRMRDVPEESL 154

Query: 131 ILTGDQNIVGLHFSVLYVVTDPRL--YLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           +LTGD NIV + F V + V   +   ++FNL+NP  T+K V+ESAMREVVGRR    I  
Sbjct: 155 MLTGDDNIVDIDFDVQWRVNPAKAEEFVFNLQNPEGTIKAVAESAMREVVGRRKIQAILT 214

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
           +++  +A EV+ +IQ+ +D Y +G+LIN + ++  SPP+EV  AF +V  A+QD +R   
Sbjct: 215 TEQTSVAQEVQEIIQRALDSYGAGVLINVVQLQGVSPPQEVRQAFIDVNAAQQDAERARN 274

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           E+  Y++RV+  A G AS + + +  YK +   EA G+A RF  +Y  Y  AP + R+R+
Sbjct: 275 EARTYASRVVPQAEGRASQMIQQAEGYKAQATAEATGQAARFREVYESYKLAPAVSRERM 334

Query: 309 YLETMEGILKKAKKVIIDKKQS---------VMPYLPLNE 339
           +L+TME +L    KVI+D+  +         V+P LPL+E
Sbjct: 335 FLDTMEKVLGGVNKVIVDQPGTGASSGTAAGVIPVLPLSE 374


>gi|33593195|ref|NP_880839.1| hypothetical protein BP2191 [Bordetella pertussis Tohama I]
 gi|33563570|emb|CAE42469.1| putative membrane protein [Bordetella pertussis Tohama I]
 gi|332382606|gb|AEE67453.1| hypothetical protein BPTD_2157 [Bordetella pertussis CS]
          Length = 434

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 105/276 (38%), Positives = 168/276 (60%), Gaps = 6/276 (2%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE-RQQKIGGRSASVGS-- 126
           +IV   + AV  +FGK K+         M +PI   E+V V + R  ++G R  S     
Sbjct: 102 FIVQEGQVAVVTQFGKYKSTAPAGFQWRMPYPIQNHEMVNVSQLRTFEVGFRGGSRNKVL 161

Query: 127 NSGLILTGDQNIVGLHFSVLYVVTDPRL--YLFNLENPGETLKQVSESAMREVVGRRFAV 184
              L+LT D+NIV + F V Y +       YLF + +P E+++Q +E+AMRE+VG++   
Sbjct: 162 PEALMLTTDENIVDMQFVVQYRLRADGAPDYLFKMRDPDESVRQAAETAMREIVGKKPMD 221

Query: 185 DIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDED 244
            +    R ++A EV+NL+Q+ +D Y +GI I+T++I++  PP +V  AFD+  +A QD +
Sbjct: 222 FVLYEGRTEVATEVQNLMQQILDRYSAGIQISTVAIQNVQPPEQVQAAFDDAVKAGQDRE 281

Query: 245 RFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLL 304
           R + E   Y+N+V+  A G+AS + E +  YK ++I +AQG A RF SI  +Y  AP ++
Sbjct: 282 RQINEGQAYANQVVPLASGQASRMIEQAEGYKAKVIGDAQGNASRFSSILNEYEKAPQVM 341

Query: 305 RKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNE 339
           R+R+YLETM+ +  +A KV++D K  + M YLPL++
Sbjct: 342 RERLYLETMQEVFTRASKVMVDTKGGNNMLYLPLDK 377


>gi|78357986|ref|YP_389435.1| HflK protein [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
 gi|78220391|gb|ABB39740.1| protease FtsH subunit HflK [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 359

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 110/288 (38%), Positives = 167/288 (57%), Gaps = 16/288 (5%)

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLH-MMFWPIDQVEIVKVIE-RQQKIGGRSAS 123
           F  ++IV PDE  V LRFG+  N    PG H  M +P++     KV + R+ ++G RS S
Sbjct: 62  FSGVFIVEPDEVGVVLRFGE-YNRTVQPGPHYHMPFPMETAYTPKVSQVRRVEVGFRS-S 119

Query: 124 VGSNSG---------LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
            G + G         L+LTGD+NIV + F V Y + DP  +LFN+     T+K  +E+AM
Sbjct: 120 EGFSQGQLRPVKEESLMLTGDENIVDVQFIVQYQIKDPVAFLFNVSQQAWTVKSAAEAAM 179

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           REV+G           +  I  + R+L+Q  +D Y +G+ +  + ++D  PP+EV DAF 
Sbjct: 180 REVIGYNAIDSALTGGKLDIQNKSRDLLQGILDNYNAGVHVVAVQMQDVHPPKEVIDAFK 239

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +V  A +D  R + E+  Y N +L  ARG A+ I   + AYK+  I++A+GE+ RF+++ 
Sbjct: 240 DVASAREDRSRIINEAEAYQNEILPRARGLAAEIINQAEAYKETRIRDAKGESARFVNVL 299

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKA--KKVIIDKKQ-SVMPYLPLNE 339
            +Y  A  + RKR+YLETME IL     +K+I+  K   V+PYLPL++
Sbjct: 300 AEYNKAKDITRKRMYLETMETILSNPDLEKIILSGKAGGVVPYLPLDK 347


>gi|257482408|ref|ZP_05636449.1| HflK protein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 399

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 95/284 (33%), Positives = 174/284 (61%), Gaps = 12/284 (4%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           +++ +F  + +IY+V   E+AV LRFG+  ++   PGL++ F P D+ + ++ + R++  
Sbjct: 77  VVLVAFWLYSAIYVVDEQEQAVVLRFGQ-YHETVGPGLNIYFPPFDR-KYMENVTRERAY 134

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
                   S  G +LT D+ IV +  +V Y +++ + ++ N++ P  +L+  +ESA+R V
Sbjct: 135 --------SKQGQMLTEDETIVEVPLTVQYKISNLQDFVLNVDQPEISLQHATESALRHV 186

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG      +    R+ +A E++  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V 
Sbjct: 187 VGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSAAAPREVQEAFDDVI 246

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A+GEADRF  +  +Y
Sbjct: 247 RAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEVVSRAKGEADRFTKLVAEY 306

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
             AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 307 RKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 350


>gi|253996264|ref|YP_003048328.1| HflK protein [Methylotenera mobilis JLW8]
 gi|253982943|gb|ACT47801.1| HflK protein [Methylotenera mobilis JLW8]
          Length = 400

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 110/307 (35%), Positives = 171/307 (55%), Gaps = 22/307 (7%)

Query: 44  IPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPI 102
           +P     G V++I L  G        YIV      V +RFGK  ++   PG      +PI
Sbjct: 55  LPLLPIMGLVFLIWLGSG-------FYIVDQGSTGVVMRFGKALDETTEPGPRWHLPYPI 107

Query: 103 DQVEIVKVIE-RQQKIGGRSASVGSNSG--------LILTGDQNIVGLHFSVLYVVTDPR 153
           + VE+V + + R+ ++G RS++ GS  G        L+LT D+NI+ L F+V Y + + +
Sbjct: 108 ETVEVVNMEQVRRLEVGYRSSAEGSGGGKTKLPKEALMLTEDENIIDLQFAVQYNLNNAK 167

Query: 154 LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGI 213
            YLFN  +    +   +ESA+REVVG+    D+     Q+   +    +Q  +D YK+G+
Sbjct: 168 YYLFNNRSTDTAVMSAAESAIREVVGKNKLDDLL----QKGLADTSERMQVILDSYKTGV 223

Query: 214 LINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
            I ++S++ A PP +V +AF++V RA QD  R + E   Y+N V+  ARG AS +   + 
Sbjct: 224 KIISVSLQSAQPPEQVQEAFEDVNRANQDNQRQINEGQAYANDVIPKARGTASRLLSEAA 283

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVM 332
            YK ++  EA+G A RF  I  QY NAP + R+R+YL+  E IL    KVI+D+K  + +
Sbjct: 284 GYKLKVESEARGNASRFDQILAQYNNAPEVTRQRLYLDAQEQILSTTSKVIVDQKAGNSL 343

Query: 333 PYLPLNE 339
            YLPL++
Sbjct: 344 LYLPLDK 350


>gi|33597404|ref|NP_885047.1| hypothetical protein BPP2847 [Bordetella parapertussis 12822]
 gi|33573831|emb|CAE38139.1| putative membrane protein [Bordetella parapertussis]
          Length = 434

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 105/276 (38%), Positives = 168/276 (60%), Gaps = 6/276 (2%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE-RQQKIGGRSASVGS-- 126
           +IV   + AV  +FGK K+         M +PI   E+V V + R  ++G R  S     
Sbjct: 102 FIVQEGQVAVVTQFGKYKSTAPAGFQWRMPYPIQNHEMVNVSQLRTFEVGFRGGSRNKVL 161

Query: 127 NSGLILTGDQNIVGLHFSVLYVVTDPRL--YLFNLENPGETLKQVSESAMREVVGRRFAV 184
              L+LT D+NIV + F V Y +       YLF + +P E+++Q +E+AMRE+VG++   
Sbjct: 162 PEALMLTTDENIVDMQFVVQYRLRADGAPDYLFKMRDPDESVRQAAETAMREIVGKKPMD 221

Query: 185 DIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDED 244
            +    R ++A EV+NL+Q+ +D Y +GI I+T++I++  PP +V  AFD+  +A QD +
Sbjct: 222 FVLYEGRTEVAAEVQNLMQQILDRYSAGIQISTVAIQNVQPPEQVQAAFDDAVKAGQDRE 281

Query: 245 RFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLL 304
           R + E   Y+N+V+  A G+AS + E +  YK ++I +AQG A RF SI  +Y  AP ++
Sbjct: 282 RQINEGQAYANQVVPLASGQASRMIEQAEGYKAKVIGDAQGNASRFSSILNEYEKAPQVM 341

Query: 305 RKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNE 339
           R+R+YLETM+ +  +A KV++D K  + M YLPL++
Sbjct: 342 RERLYLETMQEVFTRASKVMVDTKGGNNMLYLPLDK 377


>gi|326795794|ref|YP_004313614.1| HflK protein [Marinomonas mediterranea MMB-1]
 gi|326546558|gb|ADZ91778.1| HflK protein [Marinomonas mediterranea MMB-1]
          Length = 410

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 104/279 (37%), Positives = 162/279 (58%), Gaps = 17/279 (6%)

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM---MFWPIDQVEIVKVIERQQKIGGRS 121
           A   +Y V   ER V LR GK  + V +PGLH    M   + +V + KV     K     
Sbjct: 100 AASGVYQVDQQERGVVLRLGKYHSTV-MPGLHWNPPMIDSVSKVNVTKVRSHDHK----- 153

Query: 122 ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRR 181
                   L+LT D+ IV +  SV Y V +P+ +L N+  P E+L Q  ES++R VVG  
Sbjct: 154 -------ALMLTVDEAIVEVGVSVQYSVENPKDFLLNVRTPEESLSQAVESSLRHVVGSS 206

Query: 182 FAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQ 241
               I    R+ +A EV+  +Q  ++ Y +G+LI+ +++E+   P +V +AFD+V +A++
Sbjct: 207 EMDQILTEGRELLATEVKVRLQDYINAYGTGLLISKVNVENTQAPEQVKEAFDDVIKAKE 266

Query: 242 DEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAP 301
           DE R   E+  Y+N ++  ARG++  IRE + AY+  ++  A+G+ADRF  +Y +YV AP
Sbjct: 267 DEQRVRNEAESYANGIIPEARGKSQRIREEAEAYRSEVVARAEGQADRFDRLYQEYVKAP 326

Query: 302 TLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNE 339
            + ++R+YLET+E I K A KV+ID    + M YLPL++
Sbjct: 327 AVTKRRLYLETVETIYKDANKVVIDDDGGNNMMYLPLDQ 365


>gi|311105367|ref|YP_003978220.1| HflK protein [Achromobacter xylosoxidans A8]
 gi|310760056|gb|ADP15505.1| HflK protein [Achromobacter xylosoxidans A8]
          Length = 433

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 121/369 (32%), Positives = 195/369 (52%), Gaps = 44/369 (11%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI------------------- 44
           + N S+  P R     GNGDG P  D++ + R   ++   +                   
Sbjct: 19  NNNGSEPPPKR---PQGNGDGPP--DLDEVWRDFNNRIGSLFGRKGGGGNNRPGNRGGMT 73

Query: 45  ---PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP 101
              P     G   I L+  G + A    YIV   + AV  +FGK K+         M +P
Sbjct: 74  PPSPRGARIGLGVIALVAAGIWLA-SGFYIVQEGQVAVVTQFGKYKSTSQAGFQWRMPYP 132

Query: 102 IDQVEIVKVIE-RQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVVTDPRL---- 154
           I   E+V V + R  ++G R  +        L+LT D+NIV + F V Y     RL    
Sbjct: 133 IQSHEMVNVSQLRTFEVGFRGGARNKVLPEALMLTTDENIVDMQFVVQY-----RLRADG 187

Query: 155 ---YLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKS 211
              YLF   +P E+++Q SE+AMREVVG++    +    R  +A +V+ L+Q+ +D Y++
Sbjct: 188 APDYLFMTRDPDESVRQASETAMREVVGKQSMDFVLYEGRTTVATQVQTLMQQILDRYQT 247

Query: 212 GILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRES 271
           G+ ++T++I++  PP +V  AFD+  +A QD +R + E   Y+N+V+  A G+AS + E 
Sbjct: 248 GVQVSTVAIQNVQPPEQVQAAFDDAVKAGQDRERQINEGQAYANQVVPLASGQASRMTEQ 307

Query: 272 SIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQS 330
           +  YK +++ +AQG   RF SI G+Y  +P ++R+R+YLE+M+ I  +A KV++D K  +
Sbjct: 308 AEGYKAKVVGDAQGNTSRFTSILGEYEKSPAVMRQRMYLESMQEIFTRASKVMVDTKSNN 367

Query: 331 VMPYLPLNE 339
            M YLPL++
Sbjct: 368 NMLYLPLDK 376


>gi|83942978|ref|ZP_00955438.1| HflK protein [Sulfitobacter sp. EE-36]
 gi|83845986|gb|EAP83863.1| HflK protein [Sulfitobacter sp. EE-36]
          Length = 361

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 102/311 (32%), Positives = 165/311 (53%), Gaps = 21/311 (6%)

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIV 108
           + G+V + L+         S Y V P+++++EL  G+    +   GL+   WP    E+ 
Sbjct: 43  TRGTVGLGLVAAAVVWGMASFYTVRPEQQSIELFLGEFSG-IGTEGLNFAPWPFVTAEVF 101

Query: 109 KVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
            V   + +  G       N GL+LT D+NIV + F V++ V +   + F+L +P   ++ 
Sbjct: 102 DVTTNRAETIGAGRGGDDNEGLMLTTDENIVDIDFQVVWNVKNAENFKFSLRDPQMAVRA 161

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
           +SESAMRE++ +     I    R  I    R LIQ T+D  ++GI I  ++     PP +
Sbjct: 162 ISESAMREIIAQSELAPILNRDRATIEASARELIQTTLDNRETGINIIRVNFNKVDPPSQ 221

Query: 229 ---------------VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
                          V DAF +VQ AEQ+ DR   +++ Y+NR    ARGE++ + E++ 
Sbjct: 222 TVTVTDANGNTTQESVIDAFRDVQAAEQERDRVERQADAYANRRTAEARGESARLLEAAE 281

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK-----K 328
            Y+ R++ +A GEA RF ++  +Y  AP + R+R+Y+ETME +L    K+I++       
Sbjct: 282 GYRARVVNDAVGEASRFEAVLQEYEAAPDVTRRRLYIETMEKVLGDVDKIILENGSDGTG 341

Query: 329 QSVMPYLPLNE 339
           Q V+PYLPLNE
Sbjct: 342 QGVVPYLPLNE 352


>gi|319943733|ref|ZP_08018014.1| HflK protein [Lautropia mirabilis ATCC 51599]
 gi|319742966|gb|EFV95372.1| HflK protein [Lautropia mirabilis ATCC 51599]
          Length = 482

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 114/301 (37%), Positives = 172/301 (57%), Gaps = 8/301 (2%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM-MFWPIDQVEIV-KVIE 112
           I+ ++ G        YIV   + A  LRFG+ +      G+   + +PI+  EIV +   
Sbjct: 124 IVGVVAGLAWLGSGFYIVQEGQVAAVLRFGQFRYLTHEAGIQWNLPYPIETHEIVDRSRL 183

Query: 113 RQQKIGGRSA--SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLF--NLENPGETL-K 167
           RQ ++G R++  +      LILTGDQ+IV L ++V Y + +P  +LF  NL +  E L +
Sbjct: 184 RQIEVGYRNSVRTKVPKESLILTGDQSIVDLQYAVQYRIDNPGDFLFQNNLSSGSEELIR 243

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
           QV+ESAMREVVG+R    +    + Q+A + + L Q  +D YK GI I   +I+ A PP 
Sbjct: 244 QVAESAMREVVGQRTTDQVLYEDKAQVAEDAQTLTQAILDRYKLGIGIVDFTIQQAQPPE 303

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
           +V  AF++  +A+QD  R + E   Y+N V+  A+G A  +   +  Y+ R+I +A+G+A
Sbjct: 304 QVQAAFEDANKADQDRQRLINEGQAYANDVIPRAKGTADRMVLEAQGYRARVIAQAEGDA 363

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQT 346
            RF  IY QY NAP + R+R+YLETM+ IL    KV +D +K   + YLPL+    R Q 
Sbjct: 364 LRFDQIYTQYANAPQVTRERMYLETMQQILSNTSKVYLDSQKNGSLLYLPLDRILDRNQG 423

Query: 347 K 347
           K
Sbjct: 424 K 424


>gi|291613889|ref|YP_003524046.1| HflK protein [Sideroxydans lithotrophicus ES-1]
 gi|291584001|gb|ADE11659.1| HflK protein [Sideroxydans lithotrophicus ES-1]
          Length = 396

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 116/344 (33%), Positives = 192/344 (55%), Gaps = 26/344 (7%)

Query: 20  GNGDGLPPFDVEAIIRYIKDKFDLIPFFKS----------------YGSVYIILLLIGSF 63
           GN +   P D+E ++R +  K + + F KS                 G + +I+L++   
Sbjct: 9   GNKNSGGPPDLEELVRKLNRKIESL-FGKSGGGAPKGGNANAPGGFAGGIGLIVLIVVLI 67

Query: 64  CAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE-RQQKIGGRS 121
                 YIV   +R V LRFGK + ++   G    F +PI+ VE+V + + R  ++G R 
Sbjct: 68  WIASGFYIVDASQRGVVLRFGK-QVEITDSGPRWHFPYPIETVEVVNLSQVRTVEVGYRE 126

Query: 122 ASVGS--NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN--LENPGETLKQVSESAMREV 177
                     L+LT D+NIV + F+V Y + DP  +LFN  + +  ET++QV+E+A+REV
Sbjct: 127 NEKNKVLKESLMLTDDENIVDIQFAVQYFLKDPAEFLFNNRMVDDKETVRQVAETAIREV 186

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VGR     +    R+QIA     LIQ+ +D YK+GI+I+ +++ +A PP +V  AFD+  
Sbjct: 187 VGRSKMDFVLYEGREQIAASTTKLIQEILDRYKAGIIISKVTMRNAQPPEQVQAAFDDAV 246

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           +A QD +R   E   Y+N V+  A+G A+ + + +  YK ++I +A+G+A RF  I  +Y
Sbjct: 247 KAGQDRERQKNEGQAYANDVVPRAKGAAARLMQEADGYKQKVIADAEGDASRFKQILVEY 306

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ--SVMPYLPLNE 339
             AP + R+R+Y +  + IL    KV++D+K   + + YLPL++
Sbjct: 307 NKAPQVTRERMYQDMKQQILTSTSKVLVDQKSGGNNLLYLPLDK 350


>gi|192360411|ref|YP_001983531.1| HflK protein [Cellvibrio japonicus Ueda107]
 gi|190686576|gb|ACE84254.1| HflK protein [Cellvibrio japonicus Ueda107]
          Length = 377

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 120/351 (34%), Positives = 193/351 (54%), Gaps = 29/351 (8%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI----------PFFKSY 50
           M++++   D  P    GS  N DG P  D++   + ++DK + +               +
Sbjct: 1   MAWNEPGKDKDPW---GSRNNNDGPP--DLDEAFKKLQDKLNGMFGGGGGSKRGSGGSGF 55

Query: 51  GSVYIILLLIGS-FCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP-IDQVEIV 108
           G + +I L+I + F     +Y V   ERAV LRFG    D+   GL+   WP I+QV IV
Sbjct: 56  GFMAVIALIIAAVFYVAVGVYQVDAKERAVVLRFGAFA-DIKGEGLNWR-WPLIEQVIIV 113

Query: 109 KVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
                +Q          S+ GL+LT D++IV L  +V Y V D + +  N+ +P  +L+ 
Sbjct: 114 NTTSARQY---------SSKGLMLTEDESIVELPLTVQYNVADVKAFALNVRDPETSLRH 164

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
            ++SA+R VVG      +    RQ IA EV+  +Q  ++ Y +GI +  ++I++A PP+E
Sbjct: 165 ATDSAVRHVVGSSELNQVLSEGRQAIAAEVQRRLQAYLEAYGAGINVMNVNIQEARPPQE 224

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V  AFD+V +A++DE R   ++  YSN V+  ARG A  + E + AY+  +I  A+GE D
Sbjct: 225 VRAAFDDVIKAKEDESRLKSQAQAYSNAVIPEARGRAQRMMEEAEAYRAEVIARAEGETD 284

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLN 338
           RF ++  +Y  AP + R+R+YL+ +E ++  A KV++D K  + M YLPL+
Sbjct: 285 RFENLLAEYKRAPEVTRERLYLDAVESVMGSASKVMVDVKGGNNMIYLPLD 335


>gi|303257597|ref|ZP_07343609.1| HflK protein [Burkholderiales bacterium 1_1_47]
 gi|302859567|gb|EFL82646.1| HflK protein [Burkholderiales bacterium 1_1_47]
          Length = 455

 Score =  180 bits (456), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 106/309 (34%), Positives = 173/309 (55%), Gaps = 6/309 (1%)

Query: 40  KFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
           +F +   F    +V  I++ + ++ A    YIV   +  V   FG+            + 
Sbjct: 94  QFKVPSSFSGGMAVSAIVIALAAWLA-SGFYIVPEGQNGVVTTFGRYTESTNAGFRWHLP 152

Query: 100 WPIDQVEIVKVIE-RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVV---TDPRLY 155
           +PI  V +V V   R+ +IG R  +      L+LT D+NIV + F+V Y +        +
Sbjct: 153 YPIQDVALVDVSSVRKAEIGLRGGTQRLKEALMLTDDENIVDVMFNVQYRIKQGNGAEEF 212

Query: 156 LFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILI 215
           LF   +P   + Q +ESAMREVVGR+    +    +Q+IA EV+ L+Q+ +D Y SGI +
Sbjct: 213 LFRTRDPMGAVVQTAESAMREVVGRKKMDSVLFESKQEIAEEVKKLMQEMLDRYHSGIQV 272

Query: 216 NTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAY 275
            +++I++A PP +V  AF++  +A QD +R + E   Y+N V+  ARG A  +R+ + AY
Sbjct: 273 LSVAIQNAQPPEQVQAAFNDAVKAGQDRERQINEGEAYANDVVPKARGLAERLRQEAEAY 332

Query: 276 KDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPY 334
           K R++ +A+G+A+RF  +Y QY  AP + R R+Y++TM+ I     KV++D K S  + Y
Sbjct: 333 KSRVVSQAEGDANRFNQVYAQYEKAPKVTRDRMYVDTMQQIFNNTTKVMVDNKSSNNLLY 392

Query: 335 LPLNEAFSR 343
           LPL++   R
Sbjct: 393 LPLDQLAKR 401


>gi|83858877|ref|ZP_00952399.1| putative membrane bound protease protein [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853700|gb|EAP91552.1| putative membrane bound protease protein [Oceanicaulis alexandrii
           HTCC2633]
          Length = 384

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 107/279 (38%), Positives = 170/279 (60%), Gaps = 15/279 (5%)

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQKIGGRSASVGS 126
           S+Y V P E  V  RFG+        GL +   +PI+ VE V V E       RS ++G+
Sbjct: 96  SVYQVGPGEAGVVQRFGEYVRTAGA-GLRVKLPYPIETVETVNVTEI------RSITIGT 148

Query: 127 N--SGLILTGDQNIVGLHFSVLYVVTDP---RLYLFNLENPGETLKQVSESAMREVVGRR 181
                L++T D+NIV L F+V + V DP   R Y+FN+ +    ++ VSESAMREVVG  
Sbjct: 149 TPQEALMVTRDENIVDLSFTVQWQV-DPTRVRDYVFNVRDQRAMVQAVSESAMREVVGTS 207

Query: 182 FAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQ 241
               I  + R ++A     +IQ T+D Y++GI +  + +++++PP +V  AF +V  AEQ
Sbjct: 208 DLQPIIGTGRGEVAQRAEEIIQDTLDLYEAGIQVVGLQLQESAPPEDVIAAFQDVISAEQ 267

Query: 242 DEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAP 301
           D +    ++  Y+NR++  ARG+A  + E +  Y+D+++ EAQG+ADRF +IY +Y  AP
Sbjct: 268 DAEANALQATAYANRIVPEARGDAVRLLEEARGYRDQVVAEAQGQADRFNAIYDEYAQAP 327

Query: 302 TLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNE 339
            + R+R+YLETME +L +++ +I+D+     +PYLPL++
Sbjct: 328 DVTRERMYLETMERVLGRSELLILDQNGNGAVPYLPLDQ 366


>gi|330999638|ref|ZP_08323347.1| HflK protein [Parasutterella excrementihominis YIT 11859]
 gi|329574144|gb|EGG55720.1| HflK protein [Parasutterella excrementihominis YIT 11859]
          Length = 499

 Score =  179 bits (455), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 106/309 (34%), Positives = 173/309 (55%), Gaps = 6/309 (1%)

Query: 40  KFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
           +F +   F    +V  I++ + ++ A    YIV   +  V   FG+            + 
Sbjct: 138 QFKVPSSFSGGMAVSAIVIALAAWLA-SGFYIVPEGQNGVVTTFGRYTESTNAGFRWHLP 196

Query: 100 WPIDQVEIVKVIE-RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVV---TDPRLY 155
           +PI  V +V V   R+ +IG R  +      L+LT D+NIV + F+V Y +        +
Sbjct: 197 YPIQDVALVDVSSVRKAEIGLRGGTQRLKEALMLTDDENIVDVMFNVQYRIKQGNGAEEF 256

Query: 156 LFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILI 215
           LF   +P   + Q +ESAMREVVGR+    +    +Q+IA EV+ L+Q+ +D Y SGI +
Sbjct: 257 LFRTRDPMGAVVQTAESAMREVVGRKKMDSVLFESKQEIAEEVKKLMQEMLDRYHSGIQV 316

Query: 216 NTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAY 275
            +++I++A PP +V  AF++  +A QD +R + E   Y+N V+  ARG A  +R+ + AY
Sbjct: 317 LSVAIQNAQPPEQVQAAFNDAVKAGQDRERQINEGEAYANDVVPKARGLAERLRQEAEAY 376

Query: 276 KDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPY 334
           K R++ +A+G+A+RF  +Y QY  AP + R R+Y++TM+ I     KV++D K S  + Y
Sbjct: 377 KSRVVSQAEGDANRFNQVYAQYEKAPKVTRDRMYVDTMQQIFNNTTKVMVDNKSSNNLLY 436

Query: 335 LPLNEAFSR 343
           LPL++   R
Sbjct: 437 LPLDQLAKR 445


>gi|120610118|ref|YP_969796.1| HflK protein [Acidovorax citrulli AAC00-1]
 gi|120588582|gb|ABM32022.1| protease FtsH subunit HflK [Acidovorax citrulli AAC00-1]
          Length = 471

 Score =  179 bits (454), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 109/299 (36%), Positives = 169/299 (56%), Gaps = 11/299 (3%)

Query: 52  SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI 111
           +   +L+ +GS       +IV   ++AV  +FGK K  V       + +PI + E+V V 
Sbjct: 130 AAVAVLIWLGS-----GFFIVQEGQQAVITQFGKYKTTVNAGFNWRLPYPIQRHELVFVT 184

Query: 112 ERQQKIGGRSA---SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
           + +    GR +   S G     +LT D+NIV + F+V Y + D R +LF   NPGE + Q
Sbjct: 185 QIRSADVGRDSIIKSTGLRESAMLTEDENIVEIKFAVQYRLNDARAWLFESRNPGEAVIQ 244

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS--PP 226
           V+E+A+RE+VG+         +R QIA  VR L+Q  +D YK G+ +  I+++     PP
Sbjct: 245 VAETAVREIVGKMRMDTALAEERDQIAPRVRTLMQTILDRYKIGVEVVGINLQQGGVRPP 304

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            +V  AFD+V +A Q+ +R   E+  Y+N V+  A G AS + E + AYK RI+ +AQG+
Sbjct: 305 EQVQAAFDDVLKAGQERERAKNEAQAYANDVIPRAVGSASRLTEEAAAYKARIVAQAQGD 364

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFSRI 344
           A RF S+  +Y  AP + R R+YLE M+ I     KV++D +Q S + YLPL++    +
Sbjct: 365 AQRFSSVLTEYQKAPQVTRDRMYLEAMQQIYSNVTKVLVDSRQGSNLLYLPLDKIMQNV 423


>gi|326316287|ref|YP_004233959.1| HflK protein [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323373123|gb|ADX45392.1| HflK protein [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 454

 Score =  179 bits (454), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 109/299 (36%), Positives = 169/299 (56%), Gaps = 11/299 (3%)

Query: 52  SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI 111
           +   +L+ +GS       +IV   ++AV  +FGK K  V       + +PI + E+V V 
Sbjct: 113 AAVAVLIWLGS-----GFFIVQEGQQAVITQFGKYKTTVNAGFNWRLPYPIQRHELVFVT 167

Query: 112 ERQQKIGGRSA---SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
           + +    GR +   S G     +LT D+NIV + F+V Y + D R +LF   NPGE + Q
Sbjct: 168 QIRSADVGRDSIIKSTGLRESAMLTEDENIVEIKFAVQYRLNDARAWLFESRNPGEAVIQ 227

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS--PP 226
           V+E+A+RE+VG+         +R QIA  VR L+Q  +D YK G+ +  I+++     PP
Sbjct: 228 VAETAVREIVGKMRMDTALAEERDQIAPRVRTLMQTILDRYKIGVEVVGINLQQGGVRPP 287

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            +V  AFD+V +A Q+ +R   E+  Y+N V+  A G AS + E + AYK RI+ +AQG+
Sbjct: 288 EQVQAAFDDVLKAGQERERAKNEAQAYANDVIPRAVGSASRLTEEAAAYKARIVAQAQGD 347

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFSRI 344
           A RF S+  +Y  AP + R R+YLE M+ I     KV++D +Q S + YLPL++    +
Sbjct: 348 AQRFSSVLTEYQKAPQVTRDRMYLEAMQQIYSNVTKVLVDSRQGSNLLYLPLDKIMQNV 406


>gi|254447103|ref|ZP_05060570.1| protease subunit HflK [gamma proteobacterium HTCC5015]
 gi|198263242|gb|EDY87520.1| protease subunit HflK [gamma proteobacterium HTCC5015]
          Length = 393

 Score =  179 bits (454), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 104/292 (35%), Positives = 164/292 (56%), Gaps = 11/292 (3%)

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE 112
           V  I+ ++ SF       I+   ER V   FG+  N V  PG    + P   +  V V  
Sbjct: 74  VAAIVYIVWSFT------IIQEGERGVIQTFGEHTNTVG-PGPIFTWKPFQTIRRVNVDN 126

Query: 113 RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
                 GR      N   +LT D+NIV + +SV Y + +   +LFNL +P ETL QV+ES
Sbjct: 127 VNSIDSGRYTK---NQREMLTKDENIVIVRYSVQYKINNAENFLFNLADPVETLYQVAES 183

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           ++REV+G+     I   QR+++ ++ R   Q  MD Y++GI I   +  DA  P  V  A
Sbjct: 184 SVREVIGQNDMDQITTQQREKVVVKARQRTQDIMDSYQAGIEITNFNFSDAKYPEAVQSA 243

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
            D+V RA +D +R++ E+  YSN+++  ARGE   + E + AYK R+++ A+GEA+RFLS
Sbjct: 244 IDDVTRAREDHERYINEAQAYSNQIIPEARGERVQMVERAKAYKARVVESAEGEAERFLS 303

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNEAFSR 343
           +Y +Y  AP + R R+Y++ +E ++    KV++D +  + M YLPL++   +
Sbjct: 304 LYNEYRKAPQVTRDRLYIDAVESVMSSTHKVMVDTEGGNNMLYLPLDKILEK 355


>gi|288940957|ref|YP_003443197.1| HflK protein [Allochromatium vinosum DSM 180]
 gi|288896329|gb|ADC62165.1| HflK protein [Allochromatium vinosum DSM 180]
          Length = 391

 Score =  179 bits (454), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 108/304 (35%), Positives = 171/304 (56%), Gaps = 18/304 (5%)

Query: 48  KSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVE 106
           K  G++  +L++I        IYIV P ER V +RFG+   D   PG H     PI+ V 
Sbjct: 67  KVVGAIIGVLIVI---WLATGIYIVEPAERGVVMRFGR-YVDTTGPGPHWHIPLPIESVV 122

Query: 107 IVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
            V V E          S  ++   +LT D+NIV L  +V   + D   YLF  ++P  TL
Sbjct: 123 KVNVDE---------ISTLTHRAAMLTQDENIVELELTVQSRIQDAADYLFQDQDPERTL 173

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
              + +  R V+G+     +    R  +A+ ++  IQK MD YK+G+++ +++++ A PP
Sbjct: 174 NDATVTVARVVIGQSKLDFVMTEGRGAVAVTIKERIQKLMDRYKTGLIVTSVNMQPAKPP 233

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            +V  AFD+  +A +D++R   ++  YSN VL SARG A+ I   + AY+DR+I  ++GE
Sbjct: 234 EQVKAAFDDAIKAREDKERLENQAEAYSNEVLPSARGNAARILADAKAYRDRVIASSEGE 293

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII---DKKQSVMPYLPLNEAFSR 343
           A RF ++  +Y  AP + R+R+YLETME +L K  KV++   D   S+M YLP+++   +
Sbjct: 294 AARFSAVLAEYSKAPEVTRQRLYLETMEEVLSKNGKVVLDVTDGANSLM-YLPIDQLMKQ 352

Query: 344 IQTK 347
            QT+
Sbjct: 353 TQTQ 356


>gi|15837054|ref|NP_297742.1| integral membrane protease [Xylella fastidiosa 9a5c]
 gi|9105296|gb|AAF83262.1|AE003895_13 integral membrane protease [Xylella fastidiosa 9a5c]
          Length = 379

 Score =  179 bits (454), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 118/345 (34%), Positives = 184/345 (53%), Gaps = 31/345 (8%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSF 63
           D + S +R +      GNG G        +   +KD FD         +  +I +LIG  
Sbjct: 12  DASESQYRGSGPLRGRGNGGGF-----WKVPGPLKDLFD---------AGILIWVLIGVL 57

Query: 64  --CAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQKIGGR 120
               F SI ++   +R V LRFG+    V  PGL +   WP++ V  V   E   K  G+
Sbjct: 58  LIVVFSSIQLIGEQQRGVVLRFGQFVR-VLQPGLSLKLPWPVESVYKVNATE--IKTFGK 114

Query: 121 SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGR 180
              V       LT D+NIV +  +V Y + DP LYL+   N  E L Q ++SA+RE VGR
Sbjct: 115 QVPV-------LTRDENIVNVTLNVQYQINDPHLYLYGSRNANEVLVQAAQSAVREQVGR 167

Query: 181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE 240
                +  + R  ++   +  +Q ++D Y++G+L+  +++ DA PP EV  AFDEV  A+
Sbjct: 168 SDLNSVL-NNRGPLSTASKERLQASLDAYRTGLLVTGLTLPDARPPEEVKSAFDEVNGAQ 226

Query: 241 QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA 300
           Q  +R ++E+  Y+ +V+  ARG A+  R ++  YK  +I  AQG+ADRF  +  QY NA
Sbjct: 227 QVRERLIDEAQAYAAKVVPEARGRAASNRTAAEGYKQAVIARAQGDADRFTLLQAQYKNA 286

Query: 301 PTLLRKRIYLETMEGILKKAKKVI-IDKKQSVMPYLPLNEAFSRI 344
           P + RKR++LET++ +L + +KVI  D +Q +  Y+P+     R+
Sbjct: 287 PEVTRKRLWLETIQQVLAQNRKVIGADGRQLI--YVPIASDVPRL 329


>gi|239907345|ref|YP_002954086.1| putative HflK protein [Desulfovibrio magneticus RS-1]
 gi|239797211|dbj|BAH76200.1| putative HflK protein [Desulfovibrio magneticus RS-1]
          Length = 370

 Score =  179 bits (453), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 104/302 (34%), Positives = 173/302 (57%), Gaps = 16/302 (5%)

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVK 109
           G   II+ ++    A   IYIV PDE  V  RFG        PG H    +PI+ V+  K
Sbjct: 42  GGPKIIIGVLALLWAASGIYIVEPDEAGVVQRFGAYAYSTG-PGPHYHLPFPIETVKTPK 100

Query: 110 VIE-RQQKIGGRSAS---------VGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
           V + R+ ++G RS+S               L+LTGD+NIV + F V Y +++P  YLF +
Sbjct: 101 VSQVRRVEVGFRSSSRDGMTTQSRAVPEESLMLTGDENIVDVQFIVQYQISNPVDYLFKV 160

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
           + P ET+K  +E+AMREV+G      +  S +  +  + + ++Q  +  Y  G+ +  + 
Sbjct: 161 DRPDETVKSAAEAAMREVIGDAKIDTVLTSGKVTVQDDTKRVLQAMLQLYNCGVEVVAVQ 220

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
           ++D  PP++V DAF +V  A +D+ RF+ E++ YSN +L  ARG ++ I   + AY++++
Sbjct: 221 LQDVHPPKQVVDAFKDVASAREDKIRFINEADAYSNDILPKARGRSAAIINEAGAYREQV 280

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAK--KVII--DKKQSVMPYL 335
           I+ A+G ADRF ++  +Y  AP + R+R+++E ME +L   +  K+I+  +  +  +PYL
Sbjct: 281 IRRAKGGADRFTALRTEYDKAPAVTRQRLFIEGMETLLANPELDKLIMSDEAARQAVPYL 340

Query: 336 PL 337
           PL
Sbjct: 341 PL 342


>gi|331009766|gb|EGH89822.1| HflK protein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 399

 Score =  179 bits (453), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 94/284 (33%), Positives = 173/284 (60%), Gaps = 12/284 (4%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           +++ +F  + +IY+V   E+AV LRFG+  ++   PGL++ F P D+ + ++ + R++  
Sbjct: 77  VVLVAFWLYSAIYVVDEQEQAVVLRFGQ-YHETVGPGLNIYFPPFDR-KYMENVTRERAY 134

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
                   S  G +LT D+ IV +  +V Y +++ + ++ N++ P  +L+  +ESA+R V
Sbjct: 135 --------SKQGQMLTEDETIVEVPLTVQYKISNLQDFVLNVDQPEISLQHATESALRHV 186

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG      +    R+ +A E++  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V 
Sbjct: 187 VGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSAAAPREVQEAFDDVI 246

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++   +GEADRF  +  +Y
Sbjct: 247 RAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEVVSRGKGEADRFTKLVAEY 306

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
             AP + R+R+YL+TM+ +     KV++  DK Q+ + YLPL++
Sbjct: 307 RKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDK 350


>gi|88858906|ref|ZP_01133547.1| HflK complex with HflC [Pseudoalteromonas tunicata D2]
 gi|88819132|gb|EAR28946.1| HflK complex with HflC [Pseudoalteromonas tunicata D2]
          Length = 396

 Score =  179 bits (453), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 121/355 (34%), Positives = 186/355 (52%), Gaps = 33/355 (9%)

Query: 6   NNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKS--------------YG 51
           N +D  P +  G    G   PP +++ + R   DKF+ + F  S              +G
Sbjct: 11  NGNDKDPWKNKGGKEQG---PP-NLDEVFRKYGDKFNGM-FGGSTKSGNSNGGLSGAAFG 65

Query: 52  SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI 111
            V II +++    A   IY V   ER V LRFG+  +D+ LPGL      +D++  V V 
Sbjct: 66  FVLIIAIVV---WALSGIYTVKEAERGVILRFGQ-FHDIALPGLRWKMTFVDRIVPVDV- 120

Query: 112 ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSE 171
                    +    S SG +LT D+N+V + F V Y VTDPR YLF++ +   +L+Q  +
Sbjct: 121 --------EAVRSLSASGFMLTEDENVVSVEFVVQYRVTDPRNYLFSVTDADHSLQQSLD 172

Query: 172 SAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231
           SA+R VVG      I    R+ I  +    + K ++ Y  G+++  ++ +DA PP EV D
Sbjct: 173 SALRYVVGHARMDQILTRGREVIRQQTWEELNKIIEPYNLGLVLTDVNFKDARPPLEVKD 232

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           AFD+   A++DE RF+ E+  Y   +   ARG+ + + + +  YK+R+  EAQGE  RF 
Sbjct: 233 AFDDAIAAQEDEQRFIREAEAYEREIEPRARGQVTRMTQEAEGYKERVTLEAQGEIARFE 292

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQ 345
            +  QY  A  + RKR+Y+E ME +L  + KV+ID K  + M YLPL++   + Q
Sbjct: 293 KLLPQYQAAKEVTRKRLYIEAMESVLSNSSKVLIDVKGGNNMMYLPLDKIMQQTQ 347


>gi|308048240|ref|YP_003911806.1| protease FtsH subunit HflK [Ferrimonas balearica DSM 9799]
 gi|307630430|gb|ADN74732.1| protease FtsH subunit HflK [Ferrimonas balearica DSM 9799]
          Length = 371

 Score =  179 bits (453), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 108/323 (33%), Positives = 184/323 (56%), Gaps = 12/323 (3%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDE 76
           G+ G  D  PP D++ + R I  +F     F S     ++LL +    AF   Y +   E
Sbjct: 15  GNRGGKDQGPP-DLDEVFRKISSRFGGGNQF-SGLGAGLVLLGLVLIWAFSGFYKIEEAE 72

Query: 77  RAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQ 136
           R V+LRFG+  +++  PGL      +D V  V +    Q++   +AS     G++LT D+
Sbjct: 73  RGVKLRFGQ-FHELVEPGLKWKPTFVDTVYPVNI----QRVNRLTAS-----GMMLTQDE 122

Query: 137 NIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIAL 196
           N+V +   V Y ++DPR YL+++ +P ++L +  +SA+R V+G     +I    R ++  
Sbjct: 123 NVVRVEMEVQYRISDPRKYLYSVTSPDQSLSEAMDSALRYVIGHTTMDNILTVGRDKVRR 182

Query: 197 EVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNR 256
           +  + ++  ++ Y  G+++  ++ ++A PP EV  AFD+   A++DE+R+V+E+  YS +
Sbjct: 183 DTWDELEGIIESYDMGLVVVDVAFKEARPPEEVKPAFDDAIAAQEDEERYVQEATAYSRQ 242

Query: 257 VLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGI 316
           V   ARG+A  + + + AYK R++ EA+GE  RF  +  QY  AP + R+R+YLETME +
Sbjct: 243 VEPQARGQAERMLQEADAYKRRVVLEAEGEVARFAQLLPQYEAAPDVTRERLYLETMEQV 302

Query: 317 LKKAKKVIIDKKQSVMPYLPLNE 339
             K  KV++D     M YLPL++
Sbjct: 303 FSKTTKVMVDNDGGSMFYLPLDK 325


>gi|257465624|ref|ZP_05629995.1| HflK protein [Actinobacillus minor 202]
 gi|257451284|gb|EEV25327.1| HflK protein [Actinobacillus minor 202]
          Length = 392

 Score =  178 bits (452), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 102/298 (34%), Positives = 170/298 (57%), Gaps = 11/298 (3%)

Query: 49  SYGSVYIILLLIGSFCAFQS-IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEI 107
           S+G    +++ +G+     S  Y V   ER V  RFGK  N + +PGL+     ID+V  
Sbjct: 64  SFGKFLPVIIALGAIVWGASGFYTVQEAERGVITRFGKLHN-IVMPGLNWKPTFIDEVIP 122

Query: 108 VKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
           V  IER  ++        + SG +LT D+N+V +  +V Y V DP  YLFN+ NP ++LK
Sbjct: 123 VN-IERVSEL--------NTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFNVNNPKDSLK 173

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
           Q ++SA+R V+G     +I  + R  +  +  N ++  +  Y  G+LI  ++ + A PP 
Sbjct: 174 QATDSALRYVIGHMKMDEILTTGRATVREKTWNALRDIIKTYDMGLLITDVNFQYARPPE 233

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
           EV  AFD+  +A++DE R + E+  Y+      ARG+A  I E + AYK++++ EA+GE 
Sbjct: 234 EVKAAFDDAIKAQEDEQRLIREAEAYARGKEPIARGQAQRIVEQATAYKEKVVLEAKGEV 293

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQ 345
           +R + +  +Y  AP L R+R+Y++TME ++K   K+I++   + +  LP+++ F   Q
Sbjct: 294 ERLVKLLPEYKAAPELTRERLYIQTMEKVMKNTPKIIMESNTNNLNVLPIDKFFGNTQ 351


>gi|160900444|ref|YP_001566026.1| HflK protein [Delftia acidovorans SPH-1]
 gi|160366028|gb|ABX37641.1| HflK protein [Delftia acidovorans SPH-1]
          Length = 464

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 110/295 (37%), Positives = 170/295 (57%), Gaps = 13/295 (4%)

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
           G  +II +  G       I+IV   ++AV  +FGK K+ V       + +PI + E+V V
Sbjct: 128 GIAFIIWMGTG-------IFIVQEGQQAVITQFGKYKSTVGAGINWRLPYPIQRHELVFV 180

Query: 111 IERQQKIGGRSA---SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
            + +    GR     S G     +LT D+NIV + F+V Y ++D R +LF  +NP E + 
Sbjct: 181 TQIRSADVGRDTIIKSTGLRESAMLTEDENIVEIKFAVQYRLSDARAWLFESKNPSEAVV 240

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS--P 225
           Q +E+A+REVVG+         +R QIA  VR+L+Q  +D YK G+ +  I+++     P
Sbjct: 241 QAAETAVREVVGKMKMDTALAEERDQIAPRVRDLMQTILDRYKVGVEVVGINLQQGGVRP 300

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           P +V  AFD+V RA Q+ +R   E+  Y+N V+  A G A+ + E S  YK RI+ +AQG
Sbjct: 301 PEQVQAAFDDVLRAGQERERAKNEAQAYANDVVPRAAGSAARLLEESNGYKARIVAQAQG 360

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNE 339
           +A RF S++ +Y  AP + R R+YLETM+ I     KV+++ +Q S + YLPL++
Sbjct: 361 DAQRFSSVFTEYQKAPQVTRDRMYLETMQQIYGNVTKVLVESRQGSNLLYLPLDK 415


>gi|182678703|ref|YP_001832849.1| HflK protein [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182634586|gb|ACB95360.1| HflK protein [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 389

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 110/290 (37%), Positives = 167/290 (57%), Gaps = 22/290 (7%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQ-KIG------GRS 121
           Y V P+E  +   FG+  +    PGL+  + +PI  V+I++V +R    IG       R 
Sbjct: 81  YTVRPNEIGLNKTFGRFTSRAN-PGLNYNYPFPIGSVQILQVTDRNTINIGFTIRPDARH 139

Query: 122 ASVGSN-----SGLILTGDQNIVGLHFSVLYVVTD--PRLYLFNLENPGETLKQVSESAM 174
            +  +        L+LTGD+NI  + F V++ +    P  + FN+ N  ET+K V+ESAM
Sbjct: 140 PNTQAQYDLPEESLMLTGDENIADVKFVVVWQIDPLRPEDFAFNVANQRETVKAVAESAM 199

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           REV+GR     I  ++R+ I   V+ L+QK ++ YK+G+LI  + ++   PP +V  AF 
Sbjct: 200 REVIGRSQIQRILTAERKVIEPAVQELMQKVLNDYKAGVLILQVQLQSVDPPEQVIAAFR 259

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +V  A+QD DR   E+  Y+NR++  ARG A+ I + +  Y+ R I EA G+A RF  IY
Sbjct: 260 DVTAAQQDLDRMRNEAEAYANRIVPEARGAAAAIVQEAEGYRARSIAEATGQAARFNQIY 319

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK------QSVMPYLPLN 338
            +Y  AP + R+R+YLET+E +L    KV+ID K      Q V+PYLPL+
Sbjct: 320 DEYKKAPQITRERLYLETLERVLGSVDKVLIDAKTGQGAVQGVLPYLPLD 369


>gi|83648040|ref|YP_436475.1| HflK protein [Hahella chejuensis KCTC 2396]
 gi|83636083|gb|ABC32050.1| HflK protein [Hahella chejuensis KCTC 2396]
          Length = 388

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 119/355 (33%), Positives = 189/355 (53%), Gaps = 35/355 (9%)

Query: 6   NNSD-WRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI--------------PFFKSY 50
           NN D W     SG  GN +  PP D++ +IR   +K   +                    
Sbjct: 10  NNQDPWG----SGRRGNKNDGPP-DLDEVIRKGLEKVGGLFGGKSSRGGSSGGGGVSGGV 64

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
            ++ I++L++       S++ V   E A+ LRFGK   D   PGL      IDQV I +V
Sbjct: 65  AAIIIVVLVL--LAVSSSVFRVDEKENAIVLRFGKYL-DTRQPGLQFKIPLIDQVFIEEV 121

Query: 111 IE-RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
              R QK            G +LT D+NIV +  +V YV+ D R Y   + +P  TL   
Sbjct: 122 TSVRNQK----------KKGHMLTEDENIVDIDLTVQYVIGDLRKYTLVMRDPVTTLDFA 171

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
            +SA+R  VG      +    R  +A+ V++ +Q+ +D+Y SGI +  ++I  A PP  V
Sbjct: 172 IDSALRHEVGSESMDKVLTEGRAILAINVQDRLQRYLDFYGSGIEVKKVNINAAQPPAAV 231

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
             AF+EVQRA++DE + +  +  Y N+V+  ARG+A  + E + AY+D++I +A+GE  R
Sbjct: 232 KSAFEEVQRAKEDEQKVINRAQAYKNQVVPEARGKAQRVIEEAKAYRDQVIAQAEGETQR 291

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFSR 343
           FL +   Y +AP + R+R+Y++TME +L  + KV++D+ Q + + YLPL++  +R
Sbjct: 292 FLKVLEVYESAPGVTRERLYIDTMEKVLSGSSKVLVDQGQGNNIMYLPLDKMLNR 346


>gi|254481034|ref|ZP_05094280.1| HflK protein, putative [marine gamma proteobacterium HTCC2148]
 gi|41582278|gb|AAS07892.1| HflK protein [uncultured marine bacterium 463]
 gi|214038829|gb|EEB79490.1| HflK protein, putative [marine gamma proteobacterium HTCC2148]
          Length = 388

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 103/299 (34%), Positives = 177/299 (59%), Gaps = 14/299 (4%)

Query: 50  YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVK 109
           +G + I  L++     F   Y +   ERAV LRFGK   D   PGL      ID  E+++
Sbjct: 65  FGVIAIGALIVWGLMGF---YQIDQQERAVVLRFGK-YYDTVQPGLQWNPPLID--EVIR 118

Query: 110 VIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
           V     K+  RSAS+     ++LT D+NIV +  SV YV+ DP+ ++  +  P  +L+  
Sbjct: 119 V--NTTKV--RSASLRE---IMLTQDENIVEVRLSVQYVINDPKKFVLQVREPERSLQHA 171

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           ++SA+R VVG      +    R +I ++V + +Q+ +D Y++GIL++ ++++++ PP +V
Sbjct: 172 AQSALRHVVGGNSMDLVLTEGRAKIGMDVDDRLQEYLDMYETGILVSKVNVDESKPPTQV 231

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
            +AFD+V +A +DE+R   E+  Y+N V+  ARG A    E + AY++ +I  A+GEADR
Sbjct: 232 QEAFDDVIKAREDEERVKNEAQAYANAVVPEARGSAQRQIEEASAYREEVIANAEGEADR 291

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTK 347
           F  ++ +Y  AP + R+R+YL+ ++G+     KV++D +  + M YLPL++   + Q +
Sbjct: 292 FNKLFAEYEKAPQVTRERLYLDALQGVYSNTNKVMVDVEGGNNMMYLPLDKLAEQSQGR 350


>gi|260221258|emb|CBA29642.1| hypothetical protein Csp_A13170 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 444

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 112/330 (33%), Positives = 181/330 (54%), Gaps = 23/330 (6%)

Query: 18  SNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDER 77
           + GNG G  P              D+       G +  +L+LI     F   +IV   ++
Sbjct: 83  AGGNGGGFQP--------------DMKNAGIGAGLIVGVLVLIWLGTGF---FIVQEGQQ 125

Query: 78  AVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSA---SVGSNSGLILTG 134
           AV  +FGK K+ V       + +PI++ E+V V + +    GR     + G     +LT 
Sbjct: 126 AVITQFGKYKSTVNAGFNWRLPYPIEKHELVFVSQIRSVDVGRDVVLKATGLKESAMLTE 185

Query: 135 DQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQI 194
           D+NI+ + F+V Y ++D R +LF  +NP E + Q +E+A+REV+G+         +R QI
Sbjct: 186 DENILDIKFAVQYRLSDARAFLFESKNPSEAVVQAAETAIREVMGKMKMDAALSEERDQI 245

Query: 195 ALEVRNLIQKTMDYYKSGILINTISIEDAS--PPREVADAFDEVQRAEQDEDRFVEESNK 252
           A  VR L+Q  +D YK G+ +  ++++     PP +V  +FD+V +A Q+ +R   E+  
Sbjct: 246 APRVRALMQTILDRYKVGVEVVGVNLQQGGVRPPEQVQSSFDDVLKAGQERERAKNEAQA 305

Query: 253 YSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLET 312
           Y+N V+  A G AS ++E + AYK R++ +AQG+A RF S+Y +Y  AP ++R R+YL+T
Sbjct: 306 YANDVVPRAVGSASRLKEEADAYKARVVAQAQGDAQRFRSVYAEYQKAPQVMRDRMYLDT 365

Query: 313 MEGILKKAKKVIIDKKQSV-MPYLPLNEAF 341
           M+ I     KVI+D KQ   + YLPL++  
Sbjct: 366 MQQIYSNVTKVIVDSKQGGNLLYLPLDKVL 395


>gi|300113240|ref|YP_003759815.1| HflK protein [Nitrosococcus watsonii C-113]
 gi|299539177|gb|ADJ27494.1| HflK protein [Nitrosococcus watsonii C-113]
          Length = 415

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 104/279 (37%), Positives = 161/279 (57%), Gaps = 10/279 (3%)

Query: 69  IYIVHPDERAVELRFGK-PKNDVFLPGLHMMFWPIDQVEIVKVIE-RQQKIGGRSASVGS 126
           IYIV P ER V LRFG+        P  H+ + PI++VE+V V + R  +IG RS   G 
Sbjct: 89  IYIVAPAERGVVLRFGEYVATTESGPHWHIPY-PIEKVELVDVAQIRSYEIGYRSTGRGQ 147

Query: 127 ------NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGR 180
                    L+LT D+NIV +  +V Y V D   YLFN+ N    L+QV ESA+RE VG+
Sbjct: 148 AGSPVPTEALMLTQDENIVDVRIAVQYRVKDAANYLFNVRNADTNLRQVVESALREAVGK 207

Query: 181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE 240
                +    R  I L    L Q+ +D Y +G++I +++++DA PP +V  AF +  +A 
Sbjct: 208 SKMDFVLTEGRSDIVLRTEELAQQVLDQYHAGLIITSVNMQDAQPPEQVQAAFADAIKAR 267

Query: 241 QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA 300
           +D+ R   E+  Y+N ++  ARG A    + + AYK ++I  A GE  RF  +  +Y++A
Sbjct: 268 EDQQRLRNEAEAYANDIIPRARGAAFRKVQEAEAYKSKVIALAGGETARFAQVLKEYLDA 327

Query: 301 PTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLN 338
           P +  KR+YLE ME ++++++KV++D  +   + YLPL+
Sbjct: 328 PEITEKRLYLEAMETVMERSRKVLVDVPEGTNVFYLPLD 366


>gi|28199507|ref|NP_779821.1| HflK protein [Xylella fastidiosa Temecula1]
 gi|182682240|ref|YP_001830400.1| HflK protein [Xylella fastidiosa M23]
 gi|28057622|gb|AAO29470.1| HflK protein [Xylella fastidiosa Temecula1]
 gi|182632350|gb|ACB93126.1| HflK protein [Xylella fastidiosa M23]
 gi|307578514|gb|ADN62483.1| HflK protein [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 379

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 108/310 (34%), Positives = 173/310 (55%), Gaps = 22/310 (7%)

Query: 37  IKDKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLH 96
           +KD FD        G +  +L+ +     F S+ ++   +R V LRFG+    V  PGL 
Sbjct: 40  LKDLFD-------AGILSWVLIGVLLIVVFSSVQLIGEQQRGVVLRFGQ-FVRVLQPGLS 91

Query: 97  MMF-WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLY 155
           +   WP++ V  V   E   K  G+   V       LT D+NIV +  +V Y + DP LY
Sbjct: 92  LKLPWPVESVYKVNATE--IKTFGKQVPV-------LTRDENIVNVTLNVQYQINDPHLY 142

Query: 156 LFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILI 215
           L+   N  E L Q ++SA+RE VGR     +  + R  ++   +  +Q ++D Y++G+L+
Sbjct: 143 LYGSRNANEVLVQAAQSAVREQVGRSDLNSVL-NNRGPLSTASKERLQASLDAYRTGLLV 201

Query: 216 NTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAY 275
             +++ DA PP EV  AFDEV  A+Q  +R ++E+  Y+ +V+  ARG A+  R ++  Y
Sbjct: 202 TGLTLPDARPPEEVKSAFDEVNGAQQVRERLIDEAQAYAAKVVPEARGRAASNRTAAEGY 261

Query: 276 KDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVI-IDKKQSVMPY 334
           K  +I  AQG+ADRF  +  QY NAP + RKR++LET++ +L++ +KVI  D +Q +  Y
Sbjct: 262 KQAVIARAQGDADRFTLLQAQYKNAPEVTRKRLWLETIQQVLEQNRKVIGADGRQLI--Y 319

Query: 335 LPLNEAFSRI 344
           +P+     R+
Sbjct: 320 VPIASDVPRL 329


>gi|71274613|ref|ZP_00650901.1| HflK [Xylella fastidiosa Dixon]
 gi|71899282|ref|ZP_00681443.1| HflK [Xylella fastidiosa Ann-1]
 gi|170730877|ref|YP_001776310.1| HflK protein [Xylella fastidiosa M12]
 gi|71164345|gb|EAO14059.1| HflK [Xylella fastidiosa Dixon]
 gi|71730908|gb|EAO32978.1| HflK [Xylella fastidiosa Ann-1]
 gi|167965670|gb|ACA12680.1| HflK protein [Xylella fastidiosa M12]
          Length = 379

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 108/310 (34%), Positives = 173/310 (55%), Gaps = 22/310 (7%)

Query: 37  IKDKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLH 96
           +KD FD        G +  +L+ +     F S+ ++   +R V LRFG+    V  PGL 
Sbjct: 40  LKDLFD-------AGILSWVLIGVLLIVVFSSVQLIGEQQRGVVLRFGQ-FVRVLQPGLS 91

Query: 97  MMF-WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLY 155
           +   WP++ V  V   E   K  G+   V       LT D+NIV +  +V Y + DP LY
Sbjct: 92  LKLPWPVESVYKVNATE--IKTFGKQVPV-------LTRDENIVNVTLNVQYQINDPHLY 142

Query: 156 LFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILI 215
           L+   N  E L Q ++SA+RE VGR     +  + R  ++   +  +Q ++D Y++G+L+
Sbjct: 143 LYGSRNANEVLVQAAQSAVREQVGRSDLNSVL-NNRGPLSTASKERLQASLDAYRTGLLV 201

Query: 216 NTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAY 275
             +++ DA PP EV  AFDEV  A+Q  +R ++E+  Y+ +V+  ARG A+  R ++  Y
Sbjct: 202 TGLTLPDARPPEEVKSAFDEVNGAQQVRERLIDEAQAYAAKVVPEARGRAASNRTAAEGY 261

Query: 276 KDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVI-IDKKQSVMPY 334
           K  +I  AQG+ADRF  +  QY NAP + RKR++LET++ +L++ +KVI  D +Q +  Y
Sbjct: 262 KQAVIARAQGDADRFTLLQAQYKNAPEVTRKRLWLETIQQVLEQNRKVIGADGRQLI--Y 319

Query: 335 LPLNEAFSRI 344
           +P+     R+
Sbjct: 320 VPIASDVPRL 329


>gi|311695388|gb|ADP98261.1| HflK [marine bacterium HP15]
          Length = 395

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 102/285 (35%), Positives = 158/285 (55%), Gaps = 11/285 (3%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           +  +L+  +  FQS Y V   ERAV LRFG+  +    PGL      ID V  V+V    
Sbjct: 74  LAAILVVGYVIFQSFYTVDEQERAVVLRFGE-YHQTENPGLRFKVPLIDSVTKVRVT--- 129

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
                 +     +SG +LT D+N+V +   V Y V D   Y+ N+ +  + L   ++SA+
Sbjct: 130 ------NVRTAESSGQMLTQDENLVTVDLQVQYRVGDAEAYVLNVRDSNQALAFATDSAI 183

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           R  VG     D+    R ++A+ V   +Q  +  Y +G+ +  +++E   PP  V DAF 
Sbjct: 184 RHEVGSSTLDDVLTEGRAELAVRVEQRLQMFLREYGTGLELVRVNVESTQPPPAVQDAFR 243

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           EVQRA +DE R  EE+  Y NR++  ARGEA  + E + AYK+ +I+ A+GE  RFL + 
Sbjct: 244 EVQRAREDEQRVKEEAETYRNRIVPEARGEAQRMIEEANAYKEEVIERARGETSRFLELL 303

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLN 338
             Y  +PT+ R+R+YL+T+E +L  + K+++D + S  M YLPL+
Sbjct: 304 AVYQMSPTVTRERLYLQTVEEVLANSSKILVDTESSGNMMYLPLD 348


>gi|71898152|ref|ZP_00680338.1| HflK [Xylella fastidiosa Ann-1]
 gi|71732126|gb|EAO34182.1| HflK [Xylella fastidiosa Ann-1]
          Length = 379

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 108/310 (34%), Positives = 173/310 (55%), Gaps = 22/310 (7%)

Query: 37  IKDKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLH 96
           +KD FD        G +  +L+ +     F S+ ++   +R V LRFG+    V  PGL 
Sbjct: 40  LKDLFD-------AGILSWVLIGVLLIVVFSSVQLIGEQQRGVVLRFGQ-FVRVLQPGLS 91

Query: 97  MMF-WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLY 155
           +   WP++ V  V   E   K  G+   V       LT D+NIV +  +V Y + DP LY
Sbjct: 92  LKLPWPVESVYKVNATE--IKTFGKQVPV-------LTRDENIVNVTLNVQYQINDPHLY 142

Query: 156 LFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILI 215
           L+   N  E L Q ++SA+RE VGR     +  + R  ++   +  +Q ++D Y++G+L+
Sbjct: 143 LYGSRNANEVLVQAAQSAVREQVGRSDLNSVL-NNRGPLSTASKERLQASLDAYRTGLLV 201

Query: 216 NTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAY 275
             +++ DA PP EV  AFDEV  A+Q  +R ++E+  Y+ +V+  ARG A+  R ++  Y
Sbjct: 202 TGLTLPDARPPEEVKSAFDEVNGAQQVRERLIDEAQAYAAKVVPEARGRAASNRTAAEGY 261

Query: 276 KDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVI-IDKKQSVMPY 334
           K  +I  AQG+ADRF  +  QY NAP + RKR++LET++ +L++ +KVI  D +Q +  Y
Sbjct: 262 KQAVIARAQGDADRFTLLQAQYKNAPEVTRKRLWLETIQQVLEQNRKVIGADGRQLI--Y 319

Query: 335 LPLNEAFSRI 344
           +P+     R+
Sbjct: 320 VPIASDMLRL 329


>gi|46579098|ref|YP_009906.1| hflK protein [Desulfovibrio vulgaris str. Hildenborough]
 gi|46448511|gb|AAS95165.1| hflK protein, putative [Desulfovibrio vulgaris str. Hildenborough]
 gi|311232942|gb|ADP85796.1| HflK protein [Desulfovibrio vulgaris RCH1]
          Length = 378

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 103/296 (34%), Positives = 168/296 (56%), Gaps = 18/296 (6%)

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQ-KIGGRSASVG 125
            +YI++PDE  V LRFG+    V  PG H    +P+++V   KV + Q+ +IG RS + G
Sbjct: 78  GVYIINPDEAGVVLRFGQYDRTVG-PGPHYHLPFPVERVYKPKVTQVQRVEIGFRSPTQG 136

Query: 126 SN-----------SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
           +               +LTGD+NIV + FSV Y + DP  YLFN+ +    ++  +E+AM
Sbjct: 137 ATFQQGQGRVFPEEAAMLTGDENIVNVQFSVQYQIKDPVEYLFNVTDQAAVVRNAAEAAM 196

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           RE++G           + +I  E   L+Q+ +D YK GI +  + ++D  PP+EV DAF 
Sbjct: 197 REIIGNSLIDAALTDGKLRIQNETTTLLQEILDRYKVGIRVLAVQMQDVHPPKEVIDAFK 256

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +V  A +D+ R V E+  Y N +L   RG A+ +   +  Y++   ++A+GEA RF+++ 
Sbjct: 257 DVASAREDKSRIVNEAEAYRNELLPRTRGAAAELVNQAEGYRETRTRQAEGEAQRFIAVL 316

Query: 295 GQYVNAPTLLRKRIYLETMEGILKK--AKKVIIDKKQS--VMPYLPLNEAFSRIQT 346
            +Y  A  + RKR+Y ETM+ IL +   +++I+ ++ +  V+PYLPL+      QT
Sbjct: 317 KEYNAAKDVTRKRLYFETMQEILSRNGVERIILPRETAGRVLPYLPLDRLTPAPQT 372


>gi|307249154|ref|ZP_07531159.1| hypothetical protein appser2_21140 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307257130|ref|ZP_07538902.1| hypothetical protein appser10_11300 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306854324|gb|EFM86522.1| hypothetical protein appser2_21140 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306864292|gb|EFM96203.1| hypothetical protein appser10_11300 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
          Length = 408

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 99/297 (33%), Positives = 170/297 (57%), Gaps = 11/297 (3%)

Query: 48  KSYGSVYIILLLIGSFCAFQS-IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVE 106
           +++G ++ +  +  +     S  Y +   ER V  RFGK  ND+ +PGL+     +D+V 
Sbjct: 80  QNFGKLFPLAAIFAAIVWGASGFYTIKEAERGVVTRFGK-LNDIVMPGLNWKPTFVDEVI 138

Query: 107 IVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
            V  IER  ++          SG +LT D+N+V +  +V Y V DP  YLF++ +  ++L
Sbjct: 139 PVN-IERVSEL--------KTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFSVRDADDSL 189

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
           KQ ++SA+R V+G     DI  + R  +  +    ++  +  Y  G+L+  ++ + A PP
Sbjct: 190 KQATDSALRYVIGHMSMDDILTTGRATVREKTWQTLRDIIKTYDMGLLVTDVNFQSARPP 249

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            EV DAFD+  +A++DE R + E+  Y+      ARG+A  I E + AYKD+I+ EA+GE
Sbjct: 250 EEVKDAFDDAIKAQEDEQRLIREAEAYARGREPIARGQAQRIVEQATAYKDQIVLEAKGE 309

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSR 343
            +RF  +  +Y  AP ++R+R+Y+ETME ++K   KVI+D   + +  LP+++  ++
Sbjct: 310 VERFSKLLPEYKAAPQVMRERLYIETMEKVMKNTPKVIMDGNGNNLNVLPMDKLLAK 366


>gi|120603322|ref|YP_967722.1| HflK protein [Desulfovibrio vulgaris DP4]
 gi|120563551|gb|ABM29295.1| protease FtsH subunit HflK [Desulfovibrio vulgaris DP4]
          Length = 378

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 103/296 (34%), Positives = 168/296 (56%), Gaps = 18/296 (6%)

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQ-KIGGRSASVG 125
            +YI++PDE  V LRFG+    V  PG H    +P+++V   KV + Q+ +IG RS + G
Sbjct: 78  GVYIINPDEAGVVLRFGQYDRTVG-PGPHYHLPFPVERVYKPKVTQVQRVEIGFRSPAQG 136

Query: 126 SN-----------SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
           +               +LTGD+NIV + FSV Y + DP  YLFN+ +    ++  +E+AM
Sbjct: 137 ATFQQGQGRVFPEEAAMLTGDENIVNVQFSVQYQIKDPVEYLFNVTDQAAVVRNAAEAAM 196

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           RE++G           + +I  E   L+Q+ +D YK GI +  + ++D  PP+EV DAF 
Sbjct: 197 REIIGNSLIDAALTDGKLRIQNETTTLLQEILDRYKVGIRVLAVQMQDVHPPKEVIDAFK 256

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +V  A +D+ R V E+  Y N +L   RG A+ +   +  Y++   ++A+GEA RF+++ 
Sbjct: 257 DVASAREDKSRIVNEAEAYRNELLPRTRGAAAELVNQAEGYRETRTRQAEGEAQRFIAVL 316

Query: 295 GQYVNAPTLLRKRIYLETMEGILKK--AKKVIIDKKQS--VMPYLPLNEAFSRIQT 346
            +Y  A  + RKR+Y ETM+ IL +   +++I+ ++ +  V+PYLPL+      QT
Sbjct: 317 KEYNAAKDVTRKRLYFETMQEILSRNGVERIILPRETAGRVLPYLPLDRLTPAPQT 372


>gi|46143462|ref|ZP_00204479.1| COG0330: Membrane protease subunits, stomatin/prohibitin homologs
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126208549|ref|YP_001053774.1| protein HflK [Actinobacillus pleuropneumoniae L20]
 gi|126097341|gb|ABN74169.1| protein HflK [Actinobacillus pleuropneumoniae serovar 5b str. L20]
          Length = 396

 Score =  176 bits (447), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 99/297 (33%), Positives = 170/297 (57%), Gaps = 11/297 (3%)

Query: 48  KSYGSVYIILLLIGSFCAFQS-IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVE 106
           +++G ++ +  +  +     S  Y +   ER V  RFGK  ND+ +PGL+     +D+V 
Sbjct: 68  QNFGKLFPLAAIFAAIVWGASGFYTIKEAERGVVTRFGK-LNDIVMPGLNWKPTFVDEVI 126

Query: 107 IVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
            V  IER  ++          SG +LT D+N+V +  +V Y V DP  YLF++ +  ++L
Sbjct: 127 PVN-IERVSEL--------KTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFSVRDADDSL 177

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
           KQ ++SA+R V+G     DI  + R  +  +    ++  +  Y  G+L+  ++ + A PP
Sbjct: 178 KQATDSALRYVIGHMSMDDILTTGRATVREKTWQTLRDIIKTYDMGLLVTDVNFQSARPP 237

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            EV DAFD+  +A++DE R + E+  Y+      ARG+A  I E + AYKD+I+ EA+GE
Sbjct: 238 EEVKDAFDDAIKAQEDEQRLIREAEAYARGREPIARGQAQRIVEQATAYKDQIVLEAKGE 297

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSR 343
            +RF  +  +Y  AP ++R+R+Y+ETME ++K   KVI+D   + +  LP+++  ++
Sbjct: 298 VERFSKLLPEYKAAPQVMRERLYIETMEKVMKNTPKVIMDGNGNNLNVLPMDKLLAK 354


>gi|303253347|ref|ZP_07339496.1| protein HflK [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|302648029|gb|EFL78236.1| protein HflK [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
          Length = 396

 Score =  176 bits (447), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 99/297 (33%), Positives = 170/297 (57%), Gaps = 11/297 (3%)

Query: 48  KSYGSVYIILLLIGSFCAFQS-IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVE 106
           +++G ++ +  +  +     S  Y +   ER V  RFGK  ND+ +PGL+     +D+V 
Sbjct: 68  QNFGKLFPLAAIFAAIVWGASGFYTIKEAERGVVTRFGK-LNDIVMPGLNWKPTFVDEVI 126

Query: 107 IVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
            V  IER  ++          SG +LT D+N+V +  +V Y V DP  YLF++ +  ++L
Sbjct: 127 PVN-IERVSEL--------KTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFSVRDADDSL 177

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
           KQ ++SA+R V+G     DI  + R  +  +    ++  +  Y  G+L+  ++ + A PP
Sbjct: 178 KQATDSALRYVIGHMSMDDILTTGRATVREKTWQTLRDIIKTYDMGLLVTDVNFQSARPP 237

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            EV DAFD+  +A++DE R + E+  Y+      ARG+A  I E + AYKD+I+ EA+GE
Sbjct: 238 EEVKDAFDDAIKAQEDEQRLIREAEAYARGREPIARGQAQRIVEQATAYKDQIVLEAKGE 297

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSR 343
            +RF  +  +Y  AP ++R+R+Y+ETME ++K   KVI+D   + +  LP+++  ++
Sbjct: 298 VERFSKLLPEYKAAPQVMRERLYIETMEKVMKNTPKVIMDGNGNNLNVLPMDKLLAK 354


>gi|170750916|ref|YP_001757176.1| HflK protein [Methylobacterium radiotolerans JCM 2831]
 gi|170657438|gb|ACB26493.1| HflK protein [Methylobacterium radiotolerans JCM 2831]
          Length = 394

 Score =  176 bits (447), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 113/301 (37%), Positives = 168/301 (55%), Gaps = 27/301 (8%)

Query: 70  YIVHPDERAVELRFGK---PKNDVFLPGLHMMF-WPIDQVEIVKVIERQQ-KIGGRSASV 124
           Y V+P +  +E  FG+    K +    GL   F +PI  V    V  +   +IG R+   
Sbjct: 93  YTVYPRQVGIETIFGRYVGTKGE----GLRYNFPYPIGGVVKPDVGSQNSIQIGFRAGPN 148

Query: 125 GS-------NSGLILTGDQNIVGLHFSVLYVVTDPRL--YLFNLENPGETLKQVSESAMR 175
           G        +  L+LTGD+NIV L F V + V   +   ++FNL+NP  T+K +SESAMR
Sbjct: 149 GQGRTRDVPDESLMLTGDENIVDLDFEVQWRVNPLKASDFVFNLQNPEGTIKAISESAMR 208

Query: 176 EVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDE 235
           EV+GRR    I  + +  IA EV+ ++QK +D Y +G+ I  + +   +PP EV  AF +
Sbjct: 209 EVIGRRNIQAILTNDQSSIAQEVKEMVQKALDEYGAGVRIEVVQLVSVNPPPEVRPAFID 268

Query: 236 VQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYG 295
           V  A+QD D    E+  Y++R +  ARG+AS I + + AY+ +   +A G+A RF  +Y 
Sbjct: 269 VNAAQQDADTAQNEAKTYASREVPQARGKASQIVQQAEAYRTKATADATGQAARFSEVYA 328

Query: 296 QYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS---------VMPYLPLNEAFSRIQT 346
            Y  AP + R+RI+LETME +L    KVIID+  +         V+P LPL+E  +R QT
Sbjct: 329 SYKAAPAISRERIFLETMEKVLGSVNKVIIDQNGTQPGGATAAGVLPVLPLSEFGARAQT 388

Query: 347 K 347
           +
Sbjct: 389 Q 389


>gi|154247312|ref|YP_001418270.1| HflK protein [Xanthobacter autotrophicus Py2]
 gi|154161397|gb|ABS68613.1| HflK protein [Xanthobacter autotrophicus Py2]
          Length = 359

 Score =  176 bits (447), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 107/301 (35%), Positives = 170/301 (56%), Gaps = 9/301 (2%)

Query: 44  IPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPI 102
           +P F  +G++ +  +L+  + A    Y V PDE+ + LRFGK        G+H  + +PI
Sbjct: 45  LPHFGRWGALMVAGILVFLWAA-SGFYRVQPDEQGIVLRFGK-WVSTQASGVHYHWPYPI 102

Query: 103 DQVEIVKVIE-RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
           + V + K  +  Q  IG R  S   N   ILTGD+NIV     V + + D   +LF + +
Sbjct: 103 ETVLLPKTTQINQLVIGKRDGSRERNQ--ILTGDENIVEAEGVVFWRIRDAGQFLFKVAD 160

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
              TL+  +ESA+REV+G+         +RQQIA +   ++Q+ +D Y++GI I  + + 
Sbjct: 161 AEGTLRVAAESALREVIGQNPIQSALSDKRQQIAQQTEVVLQRLLDKYEAGITITQVQLL 220

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
              PP  V DAF++VQRA  D++R   E+  Y N +L  ARGEA HI + + AY ++++ 
Sbjct: 221 RIDPPPAVIDAFNDVQRARADQERARNEAEAYRNDILPHARGEAEHITQEAAAYGEQVVD 280

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID---KKQSVMPYLPLN 338
            A+GEA  FL++   Y     +  +R+YLE ++ +LK++ +VI+D       V+PYLPL 
Sbjct: 281 LARGEAQSFLAVAAAYEQHKDVTLRRLYLEGVDELLKRSGRVIVDLSAHGGGVVPYLPLM 340

Query: 339 E 339
           E
Sbjct: 341 E 341


>gi|30249264|ref|NP_841334.1| Band 7 protein [Nitrosomonas europaea ATCC 19718]
 gi|30180583|emb|CAD85196.1| Band 7 protein [Nitrosomonas europaea ATCC 19718]
          Length = 396

 Score =  176 bits (447), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 104/295 (35%), Positives = 173/295 (58%), Gaps = 8/295 (2%)

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVK 109
           G V I+ LL  ++      YIV   +R V LRFGK   +  +PGL      P++ VE V 
Sbjct: 59  GFVAIVALLALAWIG-SGFYIVDEGQRGVVLRFGK-HVETTMPGLRWHIPSPVEAVESVN 116

Query: 110 VIE-RQQKIGGRSA--SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
           + + R  +IG R+   S      LILT D+NIV + F+V Y++  P  +LFN  +P  T+
Sbjct: 117 IGQVRTVEIGYRNNVRSKVLKESLILTDDENIVDIQFAVQYILNSPENFLFNNRDPESTV 176

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
            QV+E+A+R+V+G      +    R+++  +   L+Q+ +D Y+ GI IN +++++A PP
Sbjct: 177 LQVAETAIRQVIGTSKMDFVLYEGREEVTAKTTELMQEILDRYQIGISINRVTMQNAQPP 236

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            +V  AFD+  +A QD +R   E   Y+N V+  ARG A+ + E +  YK R++  A+G+
Sbjct: 237 EQVQAAFDDAVKAGQDRERQRNEGQAYANDVIPRARGGAARLLEEAQGYKQRVVAAAEGD 296

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ--SVMPYLPLNE 339
           A RF  +  +Y  AP + R+R+Y +T++ +L    K++ID+++  S + YLPL++
Sbjct: 297 ASRFTQVQTEYAKAPEVTRERMYFDTIQQVLSSTSKILIDQEKGGSNLLYLPLDK 351


>gi|322513965|ref|ZP_08067040.1| FtsH protease regulator HflK [Actinobacillus ureae ATCC 25976]
 gi|322120191|gb|EFX92149.1| FtsH protease regulator HflK [Actinobacillus ureae ATCC 25976]
          Length = 394

 Score =  176 bits (447), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 100/305 (32%), Positives = 169/305 (55%), Gaps = 11/305 (3%)

Query: 48  KSYGSVYIILLLIGSFC-AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVE 106
           +++G    + L+  +        Y V   ER V  RFGK  N + +PGL+     ID+V 
Sbjct: 65  QNFGKFLPLALIFATIVWGVSGFYTVKEAERGVVTRFGKLHN-IVMPGLNWKPTLIDEVT 123

Query: 107 IVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
            V  IER  ++          SG +LT D+N+V +  +V Y V DP  YLF++ +  ++L
Sbjct: 124 PVN-IERVSEL--------KTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFSVRDADDSL 174

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
           KQ ++SA+R V+G     DI  + R  +  +    ++  +  Y  G+L+  ++ + A PP
Sbjct: 175 KQATDSALRYVIGHMSMDDILTTGRATVREKTWQTLRDIIKTYDMGLLVTDVNFQSARPP 234

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            EV DAFD+  +A++DE R + E+  Y+      ARG+A  I E + AYKD+I+ EA+GE
Sbjct: 235 EEVKDAFDDAIKAQEDEQRLIREAEAYARGREPIARGQAQRIVEQATAYKDQIVLEAKGE 294

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQT 346
            +RF  +  +Y ++P ++R+R+Y+ETME ++K   KVI+D   + +  LP++   ++   
Sbjct: 295 VERFSKLLPEYKSSPKVMRERLYIETMEKVMKNTPKVIMDGNGNNLNVLPIDRLLAKPAA 354

Query: 347 KREIR 351
              +R
Sbjct: 355 SESVR 359


>gi|118594969|ref|ZP_01552316.1| HflK protein [Methylophilales bacterium HTCC2181]
 gi|118440747|gb|EAV47374.1| HflK protein [Methylophilales bacterium HTCC2181]
          Length = 414

 Score =  176 bits (447), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 108/298 (36%), Positives = 175/298 (58%), Gaps = 13/298 (4%)

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVK 109
           G + II+LL+     F   YIV   +R V LRFG+   +V LPG      +PI+ VE V 
Sbjct: 70  GPILIIVLLVWMASGF---YIVDQGQRGVVLRFGE-NTEVSLPGPRWHIPYPIETVETVN 125

Query: 110 VIE-RQQKIGGRSA-SVGS-----NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENP 162
           + + R  ++G RS+ S GS        L+LTGD+NI+ L F+V Y +   + +LFN  + 
Sbjct: 126 LEQVRTIEVGYRSSGSTGSVTNELRESLMLTGDENIIDLQFAVQYNLKSVKDFLFNNRSA 185

Query: 163 GETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIED 222
            ++++  +E+A+REVVG+     +    R++I +  + L+Q  +D Y +GI I ++++++
Sbjct: 186 EKSVRGAAETAIREVVGKSKMDFVLYEGREEIVIGTKALMQDILDRYATGINITSVTMQN 245

Query: 223 ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQE 282
           A PP++V  AFD+  +A+QD +R + E   Y+N ++  A G AS +   +  Y+  I  E
Sbjct: 246 AQPPQQVQAAFDDAVKAKQDLERQINEGQAYANDIIPKASGTASRLIAEANGYRVSIENE 305

Query: 283 AQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
           A G A RF  I  +Y  AP + R R++LE  EGI+    KVI+D+K+S  + YLPL++
Sbjct: 306 ASGNASRFDQILTEYKRAPEVTRTRLFLEAQEGIMSSVSKVIVDQKESNSLLYLPLDK 363


>gi|166710994|ref|ZP_02242201.1| integral membrane protease subunit [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 375

 Score =  176 bits (446), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 102/292 (34%), Positives = 163/292 (55%), Gaps = 13/292 (4%)

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQ 114
           IL+ +     F S  ++   +R V LRFG+  + +  PG +    WPI+ V  V   E  
Sbjct: 52  ILIAVVLMVLFSSFQLIGEQQRGVVLRFGQ-FSRILQPGPNFKLPWPIESVRKVNATE-- 108

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
                      SN   +LT D+NIV +  +V Y ++DPR YLF   N    L+Q ++SA+
Sbjct: 109 -------IKTFSNQVPVLTRDENIVNVSLNVQYQISDPRKYLFGSRNADLVLEQAAQSAV 161

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           RE VGR   ++   + R  +A+  ++ +Q  +D Y +G+ +  +++ DA PP EV  AFD
Sbjct: 162 REQVGRS-ELNTVLNNRGPLAIASKDRLQAALDAYNTGLAVTGVTLPDARPPEEVKPAFD 220

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           EV  A+Q  +R + E+  Y+ +V+  ARG+A+  R  +  YK   I +A+G+ADRF  + 
Sbjct: 221 EVNGAQQVRERLINEAQAYAAKVVPEARGQAARTRTGAEGYKQATISKAEGDADRFTLLQ 280

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQT 346
            QYV AP + RKR++LET++ +L + +KVI    + V+ Y+PL    S+  T
Sbjct: 281 AQYVGAPEVTRKRLWLETVQKVLSENRKVIGSDGRQVI-YVPLPADASKPAT 331


>gi|148257345|ref|YP_001241930.1| protease activity modulator HflK [Bradyrhizobium sp. BTAi1]
 gi|146409518|gb|ABQ38024.1| protease FtsH subunit HflK [Bradyrhizobium sp. BTAi1]
          Length = 379

 Score =  176 bits (446), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 120/351 (34%), Positives = 187/351 (53%), Gaps = 39/351 (11%)

Query: 27  PFDVEAIIRYIKDKFD-LIP-------FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERA 78
           P D+E ++R  +D+    IP                I + L+  F      Y V  +E  
Sbjct: 30  PPDLEDLLRRGQDRLQQFIPGGGFGAVGVLLVVVGAIAIWLLSGF------YRVQSEELG 83

Query: 79  VELRFGKPKNDVFLPGL-HMMFWPIDQVEIVKVIERQQKIGGRSASVGSN---------- 127
           V LRFGK   D   PGL + + +PI+ V + K +    ++   S  + +N          
Sbjct: 84  VVLRFGKYVRD-EQPGLRYHLPYPIETVLLPKAL----RVNSISIGITANDDPGRRGRGG 138

Query: 128 -----SGLILTGDQNIVGLHFSVLYVVTDPRL--YLFNLENPGETLKQVSESAMREVVGR 180
                  L+LTGD+NIV +  +VL+ +       +LFN++NP  T+K V+ESAMREV+GR
Sbjct: 139 RDVPEESLMLTGDENIVDVDVTVLWRIKPKGAADFLFNIQNPEGTVKAVAESAMREVIGR 198

Query: 181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE 240
                I    R  I   V+ L+QKT+D Y SGI I  + ++   PP +V +AF +VQ A 
Sbjct: 199 SNIQPILTGARTVIEQNVQELMQKTLDNYGSGIQITQVQMQKVDPPAQVIEAFRDVQAAR 258

Query: 241 QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA 300
            D +R   E+  Y+N+V+  ARG A+ I + +  YK++ I EA+G++ RF+ +Y +Y  A
Sbjct: 259 ADLERLQNEAQTYANKVVPDARGRAAQILQVAEGYKEQAIAEAKGQSARFIKVYDEYKKA 318

Query: 301 PTLLRKRIYLETMEGILKKAKKVIIDKKQS--VMPYLPLNEAFSRIQTKRE 349
           P + R+RIYLETME +L  ++K+++D   S   +P LPL +   R Q + +
Sbjct: 319 PNVTRERIYLETMERVLSGSEKLVLDGGPSGGPVPLLPLGDLAPRRQGQSQ 369


>gi|307245995|ref|ZP_07528077.1| hypothetical protein appser1_11960 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307254974|ref|ZP_07536793.1| hypothetical protein appser9_12090 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307259412|ref|ZP_07541137.1| hypothetical protein appser11_12090 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306852930|gb|EFM85153.1| hypothetical protein appser1_11960 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306862092|gb|EFM94067.1| hypothetical protein appser9_12090 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306866348|gb|EFM98211.1| hypothetical protein appser11_12090 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
          Length = 408

 Score =  176 bits (446), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 168/293 (57%), Gaps = 11/293 (3%)

Query: 48  KSYGSVYIILLLIGSFCAFQS-IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVE 106
           +++G ++ +  +  +     S  Y +   ER V  RFGK  ND+ +PGL+     +D+V 
Sbjct: 80  QNFGKLFPLAAIFAAIVWGASGFYTIKEAERGVVTRFGK-LNDIVMPGLNWKPTIVDEVI 138

Query: 107 IVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
            V  IER  ++          SG +LT D+N+V +  +V Y V DP  YLF++ +  ++L
Sbjct: 139 PVN-IERVSEL--------KTSGSMLTQDENMVQVEMTVQYRVEDPARYLFSVRDADDSL 189

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
           KQ ++SA+R V+G     DI  + R  +  +    ++  +  Y  G+L+  ++ + A PP
Sbjct: 190 KQATDSALRYVIGHMSMDDILTTGRATVREKTWQTLRDIIKTYDMGLLVTDVNFQSARPP 249

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            EV DAFD+  +A++DE R + E+  Y+      ARG+A  I E + AYKD+I+ EA+GE
Sbjct: 250 EEVKDAFDDAIKAQEDEQRLIREAEAYARGREPIARGQAQRIVEQATAYKDQIVLEAKGE 309

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
            +RF  +  +Y  AP ++R+R+Y+ETME ++K   KVI+D   + +  LP+++
Sbjct: 310 VERFSKLLPEYKAAPQVMRERLYIETMEKVMKNTPKVIMDGNGNNLNVLPMDK 362


>gi|120555678|ref|YP_960029.1| HflK protein [Marinobacter aquaeolei VT8]
 gi|120325527|gb|ABM19842.1| protease FtsH subunit HflK [Marinobacter aquaeolei VT8]
          Length = 394

 Score =  176 bits (445), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 155/285 (54%), Gaps = 11/285 (3%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           I  +L+  +  +QS Y V   ERAV LRFG+  N    PGL      ID V  V+V    
Sbjct: 73  IAAILVAGYVIYQSFYTVDEQERAVVLRFGE-YNRTEEPGLRFKVPLIDTVNKVRVT--- 128

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
                 S     +SG +LT D+N+V +   V Y V D R Y+ N+ +  + L   ++SA+
Sbjct: 129 ------SIRTAESSGQMLTQDENLVTVDLQVQYRVGDARAYVLNVRDSNQALAFATDSAL 182

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           R  VG     D+    R ++A+ V   +Q  +  Y +G+ I  +++E   PP  V DAF 
Sbjct: 183 RHEVGSSSLDDVLTEGRAELAVRVEQRLQSFLRDYGTGLEIVRVNVESTQPPAPVQDAFR 242

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           EVQRA +DE R  EE+  Y N+++  ARG+A  + E + AYK  +I+ A+GE  RF  + 
Sbjct: 243 EVQRAREDEQRLKEEAETYRNKIVPEARGQAQRMIEEANAYKQEVIERARGETARFNQLL 302

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLN 338
             Y  AP + R+R+Y++ +E +L  + K+++D + S  M YLPL+
Sbjct: 303 AVYEQAPVVTRERMYIQALEQVLGNSSKILVDTESSGNMMYLPLD 347


>gi|146283978|ref|YP_001174131.1| HflK protein [Pseudomonas stutzeri A1501]
 gi|145572183|gb|ABP81289.1| HflK protein [Pseudomonas stutzeri A1501]
 gi|327482305|gb|AEA85615.1| HflK protein [Pseudomonas stutzeri DSM 4166]
          Length = 392

 Score =  176 bits (445), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 98/276 (35%), Positives = 170/276 (61%), Gaps = 13/276 (4%)

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVG 125
           F +IYIV   E+AV LRFGK  ++   PGL++ F PID+ +  + + R++          
Sbjct: 86  FNAIYIVDEQEQAVVLRFGK-YHETVGPGLNIYFPPIDR-KFQENVTRERSY-------- 135

Query: 126 SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVD 185
           S  G +LT D+NI+ +  +V Y +++ + ++ +++ P  +L+  ++SA+R VVG      
Sbjct: 136 SKQGQMLTEDENIIEVPLTVQYKISNLQSFVLSVDQPEISLQHATDSAVRHVVGSTAMDQ 195

Query: 186 IFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDR 245
           +    R+ +A EV+  +Q+ +D Y +GI++  ++I+ A+ PREV +AFD+V RA +DE R
Sbjct: 196 VLTEGREVMAGEVKERLQRFLDNYGTGIVVTQVNIQSAAAPREVQEAFDDVIRAREDEQR 255

Query: 246 FVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLR 305
              ++  Y+N V+  ARG+A  + E +  Y+D +I  A GEADRF  +  +Y  AP + R
Sbjct: 256 EKNQAESYANGVIPEARGQAQRMLEEASGYRDAVISRATGEADRFSKLVAEYRKAPEVTR 315

Query: 306 KRIYLETMEGILKKAKKVII--DKKQSVMPYLPLNE 339
           +R+YLETM+ ++    KV++  D  Q+++ YLPL++
Sbjct: 316 ERLYLETMQEVMSNTSKVMVSGDGGQNLL-YLPLDK 350


>gi|303250175|ref|ZP_07336377.1| protein HflK [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|302651238|gb|EFL81392.1| protein HflK [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
          Length = 396

 Score =  176 bits (445), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 168/293 (57%), Gaps = 11/293 (3%)

Query: 48  KSYGSVYIILLLIGSFCAFQS-IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVE 106
           +++G ++ +  +  +     S  Y +   ER V  RFGK  ND+ +PGL+     +D+V 
Sbjct: 68  QNFGKLFPLAAIFAAIVWGASGFYTIKEAERGVVTRFGK-LNDIVMPGLNWKPTFVDEVI 126

Query: 107 IVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
            V  IER  ++          SG +LT D+N+V +  +V Y V DP  YLF++ +  ++L
Sbjct: 127 PVN-IERVSEL--------KTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFSVRDADDSL 177

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
           KQ ++SA+R V+G     DI  + R  +  +    ++  +  Y  G+L+  ++ + A PP
Sbjct: 178 KQATDSALRYVIGHMSMDDILTTGRATVREKTWQTLRDIIKTYDMGLLVTDVNFQSARPP 237

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            EV DAFD+  +A++DE R + E+  Y+      ARG+A  I E + AYKD+I+ EA+GE
Sbjct: 238 EEVKDAFDDAIKAQEDEQRLIREAEAYARGREPIARGQAQRIVEQATAYKDQIVLEAKGE 297

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
            +RF  +  +Y  AP ++R+R+Y+ETME ++K   KVI+D   + +  LP+++
Sbjct: 298 VERFSKLLPEYKAAPQVMRERLYIETMEKVMKNTPKVIMDGNGNNLNVLPMDK 350


>gi|237654040|ref|YP_002890354.1| HflK protein [Thauera sp. MZ1T]
 gi|237625287|gb|ACR01977.1| HflK protein [Thauera sp. MZ1T]
          Length = 433

 Score =  176 bits (445), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 101/304 (33%), Positives = 171/304 (56%), Gaps = 9/304 (2%)

Query: 41  FDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF- 99
           F    F   +G +  ++L++        +Y V  ++RAV LR G+       PGL     
Sbjct: 86  FSFKQFRGGFGVLAALVLVV---WLASGLYTVDANQRAVVLRLGEYVATT-EPGLRWRLP 141

Query: 100 WPIDQVEIVKVIE-RQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVVTDPRLYL 156
            P +  EIV +   R  ++G R +         L+LT D+NI+ + F+V YV+  P  Y+
Sbjct: 142 APFETHEIVDLTGVRTVEVGYRGSERNKVLRESLMLTDDENIINIQFAVQYVLNSPENYI 201

Query: 157 FNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILIN 216
           FN   P E + Q +E+AMRE+VG+     +    R++IA     L+Q+ +D Y++GI ++
Sbjct: 202 FNNRFPDEAVAQAAETAMREIVGKSRMDFVLYEGREEIATTAHELMQRILDRYETGIQVS 261

Query: 217 TISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYK 276
            +++++A PP +V  AFD+  +A QD +R   E   Y+N V+  ARG AS + E + AY+
Sbjct: 262 RVTMQNAQPPEQVQAAFDDAVKAGQDRERQKNEGEAYANDVVPRARGTASRLVEEANAYR 321

Query: 277 DRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYL 335
           +R++  A+GEA RF  ++ +Y  AP + R+R+YL+TM+ ++    KV++D K    +  L
Sbjct: 322 ERVVANAEGEASRFSQVFAEYNRAPEVTRERLYLDTMQQVMSSTSKVMVDAKGNGNLLML 381

Query: 336 PLNE 339
           PL++
Sbjct: 382 PLDK 385


>gi|229588077|ref|YP_002870196.1| putative phage-like protein [Pseudomonas fluorescens SBW25]
 gi|229359943|emb|CAY46797.1| putative phage-related protein [Pseudomonas fluorescens SBW25]
          Length = 391

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 94/277 (33%), Positives = 168/277 (60%), Gaps = 13/277 (4%)

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVG 125
           + ++Y+V   E+AV LRFGK    V  PGL++ F PID+ + ++ + R++          
Sbjct: 83  YSAVYVVDEQEQAVVLRFGKYYETVG-PGLNIYFPPIDK-KYMENVTRERAY-------- 132

Query: 126 SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVD 185
           +  G +LT D+NIV +  +V Y +++ + ++ N++ P  +L+  +ESA+R VVG      
Sbjct: 133 TKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQPEISLQHATESALRHVVGSTAMDQ 192

Query: 186 IFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDR 245
           +    R+ +A E++  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V RA +DE R
Sbjct: 193 VLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSAAAPREVQEAFDDVIRAREDEQR 252

Query: 246 FVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLR 305
              ++  Y+N V+  ARG+A  I E +  Y+D ++  A+GEADRF  +  +Y  AP + R
Sbjct: 253 SRNQAETYANGVVPEARGQAQRILEDANGYRDEVVSRAKGEADRFTKLVAEYRKAPEVTR 312

Query: 306 KRIYLETMEGILKKAKKVIIDKK---QSVMPYLPLNE 339
           +R+YL+TM+ +     KV++      Q+ + YLPL++
Sbjct: 313 ERLYLDTMQEVFSNTSKVLVTGSKGGQNNLLYLPLDK 349


>gi|307261558|ref|ZP_07543226.1| hypothetical protein appser12_11190 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306868681|gb|EFN00490.1| hypothetical protein appser12_11190 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 408

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 168/293 (57%), Gaps = 11/293 (3%)

Query: 48  KSYGSVYIILLLIGSFCAFQS-IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVE 106
           +++G ++ +  +  +     S  Y +   ER V  RFGK  ND+ +PGL+     +D+V 
Sbjct: 80  QNFGKLFPLAAIFAAIVWGASGFYTIKEAERGVVTRFGK-LNDIVMPGLNWKPTFVDEVI 138

Query: 107 IVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
            V  IER  ++          SG +LT D+N+V +  +V Y V DP  YLF++ +  ++L
Sbjct: 139 PVN-IERVSEL--------KTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFSVRDADDSL 189

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
           KQ ++SA+R V+G     DI  + R  +  +    ++  +  Y  G+L+  ++ + A PP
Sbjct: 190 KQATDSALRYVIGHMSMDDILTTGRATVREKTWQTLRDIIKTYDMGLLVTDVNFQSARPP 249

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            EV DAFD+  +A++DE R + E+  Y+      ARG+A  I E + AYKD+I+ EA+GE
Sbjct: 250 EEVKDAFDDAIKAQEDEQRLIREAEAYARGREPIARGQAQRIVEQATAYKDQIVLEARGE 309

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
            +RF  +  +Y  AP ++R+R+Y+ETME ++K   KVI+D   + +  LP+++
Sbjct: 310 VERFSKLLPEYKAAPQVMRERLYIETMETVMKNTPKVIMDGNGNNLNVLPMDK 362


>gi|297538137|ref|YP_003673906.1| HflK protein [Methylotenera sp. 301]
 gi|297257484|gb|ADI29329.1| HflK protein [Methylotenera sp. 301]
          Length = 390

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 115/344 (33%), Positives = 183/344 (53%), Gaps = 35/344 (10%)

Query: 21  NGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGS----------------VYIILLLIGSFC 64
           N +G P  D++ ++R +  K + + F K  GS                +  ++LLI    
Sbjct: 11  NNEGPP--DLDQVMRDLSRKINNM-FGKGGGSQPTSSNGGNINLPILPIIAVILLIWLAT 67

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE-RQQKIGGRSA 122
            F   Y+V    + V  RFGK  +D   PG      +PI++V +V + + R+ ++G R+ 
Sbjct: 68  GF---YMVDSGSKGVVQRFGKMTDDTTEPGPRWHLPYPIEKVTVVNMEQVRRLEVGYRTT 124

Query: 123 SVGSN-------SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMR 175
             G           L+LT D+NI+ L F+V Y + + + YLFN     + +   +ESA+R
Sbjct: 125 GEGGGGKTKQPREALMLTEDENIIDLQFAVQYNLNNAKYYLFNNRATDDAVMSAAESAIR 184

Query: 176 EVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDE 235
           EVVG+    D+     Q+   +    +Q  +D YK+G+ I ++S++ A PP +V +AF++
Sbjct: 185 EVVGKNKLDDLL----QKGLADTSQRMQTILDSYKTGVHIISVSLQSAQPPEQVQEAFED 240

Query: 236 VQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYG 295
           V RA QD  R V E   Y+N V+  +RG+AS +   +  YK +I  EA+G A RF  I  
Sbjct: 241 VNRANQDNQRQVNEGQAYANDVIPKSRGKASRLLAEAAGYKLKIESEARGNASRFEQILA 300

Query: 296 QYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           QY NAP + R+R+YL+  E IL    KV++D+K   M YLPL++
Sbjct: 301 QYNNAPDVTRQRLYLDAQEQILSSVSKVVVDQKAGSMLYLPLDK 344


>gi|190150404|ref|YP_001968929.1| protein HflK [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|307263747|ref|ZP_07545353.1| hypothetical protein appser13_11580 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|189915535|gb|ACE61787.1| protein HflK [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|306870868|gb|EFN02606.1| hypothetical protein appser13_11580 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 408

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 168/293 (57%), Gaps = 11/293 (3%)

Query: 48  KSYGSVYIILLLIGSFCAFQS-IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVE 106
           +++G ++ +  +  +     S  Y +   ER V  RFGK  ND+ +PGL+     +D+V 
Sbjct: 80  QNFGKLFPLAAIFAAIVWGASGFYTIKEAERGVVTRFGK-LNDIVMPGLNWKPTFVDEVI 138

Query: 107 IVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
            V  IER  ++          SG +LT D+N+V +  +V Y V DP  YLF++ +  ++L
Sbjct: 139 PVN-IERVSEL--------KTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFSVRDADDSL 189

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
           KQ ++SA+R V+G     DI  + R  +  +    ++  +  Y  G+L+  ++ + A PP
Sbjct: 190 KQATDSALRYVIGHMSMDDILTTGRATVREKTWQTLRDIIKTYDMGLLVTDVNFQSARPP 249

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            EV DAFD+  +A++DE R + E+  Y+      ARG+A  I E + AYKD+I+ EA+GE
Sbjct: 250 EEVKDAFDDAIKAQEDEQRLIREAEAYARGREPIARGQAQRIVEQATAYKDQIVLEARGE 309

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
            +RF  +  +Y  AP ++R+R+Y+ETME ++K   KVI+D   + +  LP+++
Sbjct: 310 VERFSKLLPEYKAAPQVMRERLYIETMEKVMKNTPKVIMDGNGNNLNVLPMDK 362


>gi|312958654|ref|ZP_07773174.1| membrane protease subunit [Pseudomonas fluorescens WH6]
 gi|311287197|gb|EFQ65758.1| membrane protease subunit [Pseudomonas fluorescens WH6]
          Length = 391

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 94/277 (33%), Positives = 168/277 (60%), Gaps = 13/277 (4%)

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVG 125
           + ++Y+V   E+AV LRFGK    V  PGL++ F PID+ + ++ + R++          
Sbjct: 83  YSAVYVVDEQEQAVVLRFGKYYETVG-PGLNIYFPPIDK-KYMENVTRERAY-------- 132

Query: 126 SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVD 185
           +  G +LT D+NIV +  +V Y +++ + ++ N++ P  +L+  +ESA+R VVG      
Sbjct: 133 TKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQPEISLQHATESALRHVVGSTAMDQ 192

Query: 186 IFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDR 245
           +    R+ +A E++  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V RA +DE R
Sbjct: 193 VLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSAAAPREVQEAFDDVIRAREDEQR 252

Query: 246 FVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLR 305
              ++  Y+N V+  ARG+A  I E +  Y+D ++  A+GEADRF  +  +Y  AP + R
Sbjct: 253 SRNQAETYANGVVPEARGQAQRILEDANGYRDEVVSRAKGEADRFTKLVAEYRKAPEVTR 312

Query: 306 KRIYLETMEGILKKAKKVIIDKK---QSVMPYLPLNE 339
           +R+YL+TM+ +     KV++      Q+ + YLPL++
Sbjct: 313 ERLYLDTMQEVFSNTSKVLVTGSKGGQNNLLYLPLDK 349


>gi|165976500|ref|YP_001652093.1| HflK protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
 gi|165876601|gb|ABY69649.1| HflK protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
          Length = 396

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 168/293 (57%), Gaps = 11/293 (3%)

Query: 48  KSYGSVYIILLLIGSFCAFQS-IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVE 106
           +++G ++ +  +  +     S  Y +   ER V  RFGK  ND+ +PGL+     +D+V 
Sbjct: 68  QNFGKLFPLAAIFAAIVWGASGFYTIKEAERGVVTRFGK-LNDIVMPGLNWKPTFVDEVI 126

Query: 107 IVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
            V  IER  ++          SG +LT D+N+V +  +V Y V DP  YLF++ +  ++L
Sbjct: 127 PVN-IERVSEL--------KTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFSVRDADDSL 177

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
           KQ ++SA+R V+G     DI  + R  +  +    ++  +  Y  G+L+  ++ + A PP
Sbjct: 178 KQATDSALRYVIGHMSMDDILTTGRATVREKTWQTLRDIIKTYDMGLLVTDVNFQSARPP 237

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            EV DAFD+  +A++DE R + E+  Y+      ARG+A  I E + AYKD+I+ EA+GE
Sbjct: 238 EEVKDAFDDAIKAQEDEQRLIREAEAYARGREPIARGQAQRIVEQATAYKDQIVLEARGE 297

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
            +RF  +  +Y  AP ++R+R+Y+ETME ++K   KVI+D   + +  LP+++
Sbjct: 298 VERFSKLLPEYKAAPQVMRERLYIETMEKVMKNTPKVIMDGNGNNLNVLPMDK 350


>gi|94311037|ref|YP_584247.1| HflK protein [Cupriavidus metallidurans CH34]
 gi|93354889|gb|ABF08978.1| modulator for HflB protease specific for phage lambda cII repressor
           [Cupriavidus metallidurans CH34]
          Length = 447

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 102/299 (34%), Positives = 175/299 (58%), Gaps = 11/299 (3%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM-MFWPIDQVEIVKVIER 113
           II  +IG + A    ++V   + AV L+FGK K     PG++  M WPI   E+V +   
Sbjct: 110 IIAAVIGIWLA-SGFFMVQEGQTAVILQFGKFKYSTG-PGINWRMPWPIQSAEVVNLSAV 167

Query: 114 QQKIGGRSASVGSNS---GLILTGDQNIVGLHFSVLYVVTDPRLYLF-NLENPG---ETL 166
           +    GR+ S+  ++     +LT D+NI+ + F+V Y + D   +LF N  + G   E +
Sbjct: 168 RSVEVGRATSIKDSNLKDSSMLTQDENIIDVRFTVQYDIQDASEFLFFNKTDRGGDEELV 227

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
            Q +E+++RE+VGR     +    R+QIA  +   IQ  +  YK+GI + +++++   PP
Sbjct: 228 TQAAETSVREIVGRNKMDAVLYENREQIAQSLAKSIQSILTAYKTGIRVISVNVQSVQPP 287

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            +V  AFD+V +A QD +R + E   Y+N ++  A+G A+ ++E S AY+ R++ +A+G+
Sbjct: 288 EQVQAAFDDVNKASQDRERAISEGQAYANDIIPRAKGTAARLKEESEAYRSRVVAQAEGD 347

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFSRI 344
           A RF S+  +Y  AP + R RIYLETM+ I   + K+++D K  + + YLPL++  +++
Sbjct: 348 AARFRSVQSEYAKAPQVTRDRIYLETMQQIYANSSKILVDAKSGNNLLYLPLDKLMTQV 406


>gi|300312250|ref|YP_003776342.1| transmembrane protease [Herbaspirillum seropedicae SmR1]
 gi|300075035|gb|ADJ64434.1| transmembrane protease protein [Herbaspirillum seropedicae SmR1]
          Length = 450

 Score =  175 bits (444), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 99/292 (33%), Positives = 167/292 (57%), Gaps = 6/292 (2%)

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVI 111
           V +I +++         +IV   + AV   FG+  +   LPG +  + +PI   EIV + 
Sbjct: 99  VGVIAVIVAFLWLASGFFIVQEGQTAVVTTFGRYSHTT-LPGFNWRWPYPIQGHEIVNMS 157

Query: 112 E-RQQKIG--GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
           + R  +IG  G   +      L+LT D+NI+ + F+V Y + +   +LFN  +P ++++Q
Sbjct: 158 QVRTAEIGYRGNVRNKQLKESLMLTDDENIIDIQFAVQYKLKNAAEWLFNNRDPDDSVRQ 217

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
           V+E+A+RE+VGR     +    R+++AL+V   +Q+ +D YKSG+ I  ++++   PP +
Sbjct: 218 VAETAIREIVGRSKMDFVLYEGREKVALDVSQRMQQILDRYKSGVQITNVTMQGVQPPEQ 277

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V  AFD+  +A QD +R   E   Y+N V+  A G AS + E + AY+ R++  A+G+A 
Sbjct: 278 VQAAFDDAVKAGQDRERLKNEGQAYANDVIPRASGAASRLLEEAEAYRSRVVANAEGDAS 337

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNE 339
           RF  +   Y  AP + R R+Y+ETM+ I     KV++D K  S + YLPL++
Sbjct: 338 RFTQVQEAYAKAPAVTRDRMYIETMQQIFANTTKVMVDAKSGSNLLYLPLDK 389


>gi|307250331|ref|ZP_07532280.1| hypothetical protein appser4_11120 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306857606|gb|EFM89713.1| hypothetical protein appser4_11120 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
          Length = 408

 Score =  175 bits (444), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 99/297 (33%), Positives = 169/297 (56%), Gaps = 11/297 (3%)

Query: 48  KSYGSVYIILLLIGSFCAFQS-IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVE 106
           +++G ++ +  +  +     S  Y +   ER V  RFGK  ND+ +PGL+     +D+V 
Sbjct: 80  QNFGKLFPLAAIFAAIVWGASGFYTIKEAERGVVTRFGK-LNDIVMPGLNWKPTFVDEVI 138

Query: 107 IVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
            V  IER  ++          SG +LT D+N+V +  +V Y V DP  YLF++ +  ++L
Sbjct: 139 PVN-IERVSEL--------KTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFSVRDADDSL 189

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
           KQ ++SA+R V+G     DI  + R  +  +    ++  +  Y  G+L   ++ + A PP
Sbjct: 190 KQATDSALRYVIGHMSMDDILTTGRATVREKTWQTLRDIIKTYDMGLLATDVNFQSARPP 249

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            EV DAFD+  +A++DE R + E+  Y+      ARG+A  I E + AYKD+I+ EA+GE
Sbjct: 250 EEVKDAFDDAIKAQEDEQRLIREAEAYARGREPIARGQAQRIVEQATAYKDQIVLEAKGE 309

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSR 343
            +RF  +  +Y  AP ++R+R+Y+ETME ++K   KVI+D   + +  LP+++  ++
Sbjct: 310 VERFSKLLPEYKAAPQVMRERLYIETMEKVMKNTPKVIMDGNGNNLNVLPMDKLLAK 366


>gi|254429144|ref|ZP_05042851.1| HflK protein, putative [Alcanivorax sp. DG881]
 gi|196195313|gb|EDX90272.1| HflK protein, putative [Alcanivorax sp. DG881]
          Length = 390

 Score =  175 bits (444), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 103/291 (35%), Positives = 161/291 (55%), Gaps = 21/291 (7%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           I L+++         + V   ERAV LRFGK  + +  PGL+   W         ++E+ 
Sbjct: 66  IALVIVAIGYGLMGFFQVDQRERAVVLRFGK-FDRIVEPGLN---WR------APILEQY 115

Query: 115 QKIGGRSASVGSN-----SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
           +K+      VG N     +  +LT D NIV +   V Y V DPR +L  +  P E L+  
Sbjct: 116 EKV-----DVGQNRRYEITEEMLTKDTNIVSVTLQVQYQVLDPRPFLLKVAQPEEILEHA 170

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           + SA+R VVG     D+ +  R+ I ++VR  +   +  Y +G+++  + ++    P  V
Sbjct: 171 TSSALRHVVGSSSMDDVLKDNREAIRVQVRERLDDYLTRYDTGLVLRQVVLDKTEAPDAV 230

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
            DAFD+V +A++DEDRF +E+  YSN V+  ARGEA  I E + AYK ++I EA+G+A+R
Sbjct: 231 RDAFDDVSKAKEDEDRFKKEAEAYSNSVIPQARGEAQRIEEEAFAYKQQVIDEAKGDANR 290

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNE 339
           F  +  +Y  AP + R+R+YLETM  +     KV++D  K   + YLPL++
Sbjct: 291 FTDLLTEYRKAPDVTRERLYLETMTQVFSNTSKVLVDVNKGDSLIYLPLDK 341


>gi|307252713|ref|ZP_07534604.1| hypothetical protein appser6_12270 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306859745|gb|EFM91767.1| hypothetical protein appser6_12270 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
          Length = 408

 Score =  175 bits (444), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 168/293 (57%), Gaps = 11/293 (3%)

Query: 48  KSYGSVYIILLLIGSFCAFQS-IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVE 106
           +++G ++ +  +  +     S  Y +   ER V  RFGK  ND+ +PGL+     +D+V 
Sbjct: 80  QNFGKLFPLAAIFAAIVWGASGFYTIKEAERGVVTRFGK-LNDIVMPGLNWKPTFVDEVI 138

Query: 107 IVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
            V  IER  ++          SG +LT D+N+V +  +V Y V DP  YLF++ +  ++L
Sbjct: 139 PVN-IERVSEL--------KTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFSVRDADDSL 189

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
           KQ ++SA+R V+G     DI  + R  +  +    ++  +  Y  G+L+  ++ + A PP
Sbjct: 190 KQATDSALRYVIGHMSMDDILTTGRATVREKTWQTLRDIIKTYDMGLLVTDVNFQSARPP 249

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            EV DAFD+  +A++DE R + E+  Y+      ARG+A  I E + AYKD+I+ EA+GE
Sbjct: 250 EEVKDAFDDAIKAQEDEQRLIREAEAYARGREPIARGQAQRIVEQATAYKDQIVLEAKGE 309

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
            +RF  +  +Y  AP ++R+R+Y+ETME ++K   KVI+D   + +  LP+++
Sbjct: 310 VERFSKLLPEYKAAPQVMRERLYIETMEKVMKNTPKVIMDGNGNNLNVLPMDK 362


>gi|70734072|ref|YP_257712.1| HflK protein [Pseudomonas fluorescens Pf-5]
 gi|68348371|gb|AAY95977.1| HflK protein [Pseudomonas fluorescens Pf-5]
          Length = 392

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 93/285 (32%), Positives = 172/285 (60%), Gaps = 13/285 (4%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           +++ +   + ++Y+V   E+AV LRFGK    V  PGL++ F PID+ + ++ + R++  
Sbjct: 74  VVLAAVWLYSAVYVVDEQEQAVVLRFGKYYETVG-PGLNIYFPPIDR-KYMENVTRERAY 131

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
                   +  G +LT D+NIV +  +V Y +++ + ++ N++ P  +L+  ++SA+R V
Sbjct: 132 --------TKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQPEISLQHATDSALRHV 183

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG      +    R+ +A E++  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V 
Sbjct: 184 VGSTAMDQVLTEGRELMASEIKERLQRFLDNYRTGITVTQVNVQSAAAPREVQEAFDDVI 243

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           RA +DE R   ++  Y+N V+  ARG+A  I E +  Y+D ++  A+GEADRF  +  +Y
Sbjct: 244 RAREDEQRSRNQAETYANGVVPEARGQAQRILEDANGYRDEVVSRAKGEADRFTKLVAEY 303

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVIIDKK---QSVMPYLPLNE 339
             AP + R+R+YL+TM+ +     KV++      Q+ + YLPL++
Sbjct: 304 RKAPEVTRQRLYLDTMQEVFSNTSKVLVTGSKGGQNNLLYLPLDK 348


>gi|121593589|ref|YP_985485.1| HflK protein [Acidovorax sp. JS42]
 gi|222110310|ref|YP_002552574.1| hflk protein [Acidovorax ebreus TPSY]
 gi|120605669|gb|ABM41409.1| protease FtsH subunit HflK [Acidovorax sp. JS42]
 gi|221729754|gb|ACM32574.1| HflK protein [Acidovorax ebreus TPSY]
          Length = 451

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 108/295 (36%), Positives = 168/295 (56%), Gaps = 9/295 (3%)

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
           G +  I +LI     F   +IV   ++AV  +FGK K+ V       + +PI + E+V V
Sbjct: 112 GLIAAIAVLIWLGTGF---FIVQEGQQAVITQFGKYKSTVNAGFNWRLPYPIQRHELVFV 168

Query: 111 IERQQKIGGRSA---SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
            + +    GR +   S G     +LT D+NIV + F+V Y + D R +LF   NP E + 
Sbjct: 169 TQIRSADVGRDSVIKSTGLRESAMLTEDENIVEIKFAVQYRLNDARAWLFESRNPAEAVV 228

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS--P 225
           Q +E+A+REVVG+         +R QIA  VRNL+Q  +D YK G+ +  I+++     P
Sbjct: 229 QAAETAVREVVGKMRMDTALAEERDQIAPRVRNLMQTILDRYKVGVEVVGINLQQGGVRP 288

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           P +V  AFD+V +A Q+ +R   E+  Y+N V+  A G AS + E + AYK RI+ +AQG
Sbjct: 289 PEQVQAAFDDVLKAGQERERAKNEAQAYANDVVPRATGTASRLIEEAAAYKARIVAQAQG 348

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNE 339
           +  RF ++  +Y  AP + R R+YLE+M+ I     KV+++ +Q S + YLPL++
Sbjct: 349 DTQRFSAVLAEYQKAPQVTRDRMYLESMQQIYGNVTKVLVESRQGSNLLYLPLDK 403


>gi|34498986|ref|NP_903201.1| transmembrane protein HflK [Chromobacterium violaceum ATCC 12472]
 gi|34104836|gb|AAQ61193.1| probable transmembrane protein HflK [Chromobacterium violaceum ATCC
           12472]
          Length = 408

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 105/279 (37%), Positives = 163/279 (58%), Gaps = 10/279 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE-RQQKIGGRSASVG-- 125
           YIV   E  V LR G   N +  PGL     +P ++ EIV + E R  ++G R ++    
Sbjct: 81  YIVDAREEGVVLRLGS-YNRLTEPGLQWHAPYPFEKAEIVNLTELRSVEVGYRGSAQNRV 139

Query: 126 SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN---LENPGETL-KQVSESAMREVVGRR 181
               L+LT DQNI+ +  SV Y + D R +LFN    E  G+ L KQ +E+A+REVVGR 
Sbjct: 140 PEESLMLTSDQNIIDVQLSVQYDIKDARAFLFNNAARERDGKDLVKQAAETAIREVVGRN 199

Query: 182 FAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQ 241
               +    R QIA + R LIQ  +D Y +GI I  ++I D  PP+ V  AFD+  +A Q
Sbjct: 200 KVDFVLNEGRAQIAADARKLIQDVLDRYHAGIRIAKVNINDVQPPQAVLAAFDDAVKAGQ 259

Query: 242 DEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAP 301
           D+D+   E   Y+N V+  A+G AS + + +  Y+ ++++ AQG+A+RF  +  +Y  AP
Sbjct: 260 DKDKLRNEGMAYANEVVPKAKGMASRLVQEAEGYQQQVVERAQGDAERFKQVLPEYNKAP 319

Query: 302 TLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNE 339
            ++R R+YL+ M+ I+  + KV++D+K  + + YLPL++
Sbjct: 320 KVMRDRLYLDMMQQIMNNSSKVLVDQKGGNSLLYLPLDK 358


>gi|89094658|ref|ZP_01167595.1| protease subunit HflK [Oceanospirillum sp. MED92]
 gi|89081128|gb|EAR60363.1| protease subunit HflK [Oceanospirillum sp. MED92]
          Length = 400

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 98/287 (34%), Positives = 168/287 (58%), Gaps = 11/287 (3%)

Query: 54  YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIER 113
           +I+LL+     A   +Y V   ER V LR GK    V  PGL      ID V +V V   
Sbjct: 80  WIVLLIALLIWAGMGVYTVDQQERGVVLRLGKYSETVG-PGLQWNPPMIDDVTLVNVTRL 138

Query: 114 QQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESA 173
           + +             L+LT D+NIV +  +V YV++D R ++ ++ +P  +L   +ESA
Sbjct: 139 RTR---------DQRSLMLTEDENIVDVDMTVQYVISDTRNFVLSVRDPESSLSHAAESA 189

Query: 174 MREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAF 233
           +R VVG      I    R+ ++++V++ +Q  M+ Y +G+ I+ ++I++A  P +V DAF
Sbjct: 190 LRHVVGSTDMHSILTQGREALSIQVQDRLQNYMNDYATGLQISKVNIKEAKAPNQVQDAF 249

Query: 234 DEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSI 293
           D+V +A +DE R   E+  Y+N ++  ARG+A  + E + AYK+++I  ++G+A RF ++
Sbjct: 250 DDVIKAREDEQRVKNEAESYANGIIPEARGQAQRMLEEASAYKEQVIARSEGDAKRFTAL 309

Query: 294 YGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNE 339
             +Y  AP + R+R+YL+TM+ +L +  KV++D +  + M YLPL++
Sbjct: 310 LTEYQKAPEVTRERLYLDTMQEVLSQNPKVLVDVEGGNNMMYLPLDK 356


>gi|241764502|ref|ZP_04762523.1| HflK protein [Acidovorax delafieldii 2AN]
 gi|241366086|gb|EER60683.1| HflK protein [Acidovorax delafieldii 2AN]
          Length = 452

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 117/356 (32%), Positives = 189/356 (53%), Gaps = 28/356 (7%)

Query: 12  PTRLSGSNG--NGDGLPPFDVEAIIRYIKDKFDLI-------------------PFFKSY 50
           P   SG  G  NG G  P D++ + R +  K   +                   P  KS 
Sbjct: 47  PAPPSGGRGRDNGSGGQPPDLDELWRDLNRKLGGLFGGKNGGPRGPSGSGGGFQPDMKSA 106

Query: 51  G-SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVK 109
           G  + +I  ++        I+IV   ++AV  RFGK ++         + +PI++ E+V 
Sbjct: 107 GMGIGLIAGIVFVIWMGTGIFIVQEGQQAVITRFGKYQSTKGAGFNWRLPYPIERHELVF 166

Query: 110 VIERQQKIGGRS---ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
           V + +    GR     S G     +LT D+NIV + F+V Y ++D R +LF  +NP + +
Sbjct: 167 VTQIRSADVGRDNVIKSTGLRESAMLTEDENIVEIKFAVQYRLSDARAWLFESKNPADAV 226

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS-- 224
            Q +E+A+REVVG+         +R QIA  VR L+Q  +D YK G+ +  I+++     
Sbjct: 227 VQAAETAVREVVGKMRMDTALAEERDQIAPRVRALMQTILDRYKVGVEVVGINLQQGGVR 286

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  +FD+V +A Q+ +R   E+  Y+N V+  A G A+ ++E + AYK RI+ +AQ
Sbjct: 287 PPEQVQSSFDDVLKAGQERERAKNEAQAYANDVIPRAVGSAARLKEEAAAYKARIVAQAQ 346

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNE 339
           G+A RF +I  +Y  AP + R R+YLE+M+ I     KV+++ +Q S + YLPL++
Sbjct: 347 GDAQRFSAILAEYQKAPQVTRDRMYLESMQQIYGNVTKVLVESRQGSNLLYLPLDK 402


>gi|253999399|ref|YP_003051462.1| HflK protein [Methylovorus sp. SIP3-4]
 gi|313201422|ref|YP_004040080.1| hflk protein [Methylovorus sp. MP688]
 gi|253986078|gb|ACT50935.1| HflK protein [Methylovorus sp. SIP3-4]
 gi|312440738|gb|ADQ84844.1| HflK protein [Methylovorus sp. MP688]
          Length = 394

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 110/329 (33%), Positives = 180/329 (54%), Gaps = 22/329 (6%)

Query: 19  NGNGDGLPPFDVEAIIRYIKDKFDLI--------PFFKSYGSVYIILLLIGSFCAF---Q 67
           N N DG P  D++ ++R    K + +           +S GS   +L ++G         
Sbjct: 9   NRNNDGPP--DLDEVLRQFSRKLNGLFGRSPKGGQSPQSEGSGIPVLPIVGLIAVIWFAT 66

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLH-MMFWPIDQVEIVKVIE-RQQKIGGRSASVG 125
             YIV    R V LRFGK   +  LPG    M +P++ V+++ + + R  ++G RSA  G
Sbjct: 67  GFYIVDQGSRGVVLRFGK-HVETTLPGPRWHMPYPVESVDVINMEQVRTIEVGYRSAEGG 125

Query: 126 SN------SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVG 179
           S         L+LT D+NI+ L F+V Y + +    LFN  +  E+++ ++E+A+RE+VG
Sbjct: 126 SGRSKELRESLMLTDDENIIDLQFAVQYNLKNVEEALFNNRSAEESVRGIAETAIREIVG 185

Query: 180 RRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRA 239
           +          R+++A+E + L+Q+ +D Y +GI +  +++++A PP +V  AFD+  +A
Sbjct: 186 KSKMDFALYEGREEVAVEAKKLMQEILDRYNTGINVVNVTMQNAQPPEQVQAAFDDAVKA 245

Query: 240 EQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVN 299
            QD +R   E   Y+N ++  ARG AS + E +  YK R+  EAQG A RF  +  QY  
Sbjct: 246 GQDLERQKNEGQAYANDIIPKARGTASRLLEEAAGYKLRVENEAQGNASRFEQVLTQYQR 305

Query: 300 APTLLRKRIYLETMEGILKKAKKVIIDKK 328
           AP + R+R+YL+  E IL    KV++D+K
Sbjct: 306 APEVTRQRLYLDAQEQILSNVSKVVVDQK 334


>gi|77456753|ref|YP_346258.1| HflK [Pseudomonas fluorescens Pf0-1]
 gi|77380756|gb|ABA72269.1| protease FtsH subunit HflK [Pseudomonas fluorescens Pf0-1]
          Length = 389

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 94/277 (33%), Positives = 167/277 (60%), Gaps = 13/277 (4%)

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVG 125
           + ++Y+V   E+AV LRFGK    V  PGL++ F PID+ + ++ + R++          
Sbjct: 83  YSAVYVVDEQEQAVVLRFGKYYETVG-PGLNIYFPPIDK-KYMENVTRERAY-------- 132

Query: 126 SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVD 185
           +  G +LT D+NIV +  +V Y +++ + ++ N++ P  +L+  ++SA+R VVG      
Sbjct: 133 TKQGQMLTEDENIVEVPLTVQYKISNLQDFVLNVDQPEISLQHATDSALRHVVGSTAMDQ 192

Query: 186 IFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDR 245
           +    R+ +A E++  +Q+ +D Y++GI +  ++++ A+ PREV +AFD+V RA +DE R
Sbjct: 193 VLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSAAAPREVQEAFDDVIRAREDEQR 252

Query: 246 FVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLR 305
              ++  Y+N V+  ARG+A  I E +  Y+D  +  A+GEADRF  +  +Y  AP + R
Sbjct: 253 SRNQAETYANGVVPEARGQAQRILEDANGYRDETVSRAKGEADRFTKLVAEYRKAPEVTR 312

Query: 306 KRIYLETMEGILKKAKKVII---DKKQSVMPYLPLNE 339
           +R+YL+TM+ +     KV++      QS + YLPL++
Sbjct: 313 QRLYLDTMQEVFSSTSKVLVTGNKNGQSNLLYLPLDK 349


>gi|94500520|ref|ZP_01307051.1| HflK protein [Oceanobacter sp. RED65]
 gi|94427310|gb|EAT12289.1| HflK protein [Oceanobacter sp. RED65]
          Length = 385

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 99/290 (34%), Positives = 165/290 (56%), Gaps = 12/290 (4%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           IIL+L+G    + S+Y +   +R V L  GK  +    PGL           ++  +E  
Sbjct: 69  IILVLVGVLI-YNSVYTIDEQQRGVVLTLGK-YDRTLEPGLQF---------VIPFVESV 117

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
           Q++   S     +  L+LT D+N+V +  +V Y V DP  +   +E+P  TL+  +ESA+
Sbjct: 118 QQVNVTSVRNSESKELMLTQDENVVEVAMNVQYRVADPVAFSLRIEDPVRTLEHAAESAL 177

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           R  VG      I  S R  +A  V   +Q  ++ Y +GI ++ ++I++AS P ++  AFD
Sbjct: 178 RHEVGSTNMDPILTSGRAFLADSVLTRLQNYLENYSTGIYVDRVNIKEASAPSQLQAAFD 237

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +V  A+QD++RF  E+  Y+N V+  ARG+A  + E + AY+ R++  A+GEADRF+ +Y
Sbjct: 238 DVINAKQDKERFTSEAEAYANTVIPEARGKAQRMLEEASAYRSRVVSRAEGEADRFVKLY 297

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSR 343
            +Y  AP + R+R+YL+ +  + K A KV++D +  + M YLPL++   R
Sbjct: 298 NEYRKAPQVTRERLYLDAIGNVYKNASKVLVDVEGGNNMMYLPLDKIMER 347


>gi|58580535|ref|YP_199551.1| integral membrane protease subunit [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|58425129|gb|AAW74166.1| integral membrane protease subunit [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 392

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 101/292 (34%), Positives = 162/292 (55%), Gaps = 13/292 (4%)

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQ 114
           IL+ +     F S  ++   +R V LRFG+  + +  PG +    WPI+ V  V   E  
Sbjct: 69  ILIAVVLMVLFSSFQLIGEQQRGVVLRFGQ-FSRILQPGPNFKLPWPIESVRKVNATE-- 125

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
                      SN   +LT D+NIV +  +V Y ++DPR YLF   N    L+Q ++SA+
Sbjct: 126 -------IKTFSNQVPVLTRDENIVNVSLNVQYQISDPRKYLFGSRNADLVLEQAAQSAV 178

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           RE VGR   ++   + R  +A+  ++ +Q  +D Y +G+ +  +++ DA PP EV  AFD
Sbjct: 179 REQVGRS-DLNTVLNNRGPLAIASKDRLQAALDAYNTGLAVTGVTLPDARPPEEVKPAFD 237

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           EV  A+Q  +R + E+  Y+ +V+  ARG+ +  R  +  YK   I +A+G+ADRF  + 
Sbjct: 238 EVNGAQQVRERLINEAQAYAAKVVPEARGQGARTRTGAEGYKQATISKAEGDADRFTLLQ 297

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQT 346
            QYV AP + RKR++LET++ +L + +KVI    + V+ Y+PL    S+  T
Sbjct: 298 AQYVGAPEVTRKRLWLETVQKVLSENRKVIGSDGRQVI-YVPLPADASKPAT 348


>gi|302038992|ref|YP_003799314.1| FtsH protease activity modulator HflK [Candidatus Nitrospira
           defluvii]
 gi|300607056|emb|CBK43389.1| FtsH protease activity modulator HflK [Candidatus Nitrospira
           defluvii]
          Length = 345

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 100/297 (33%), Positives = 166/297 (55%), Gaps = 10/297 (3%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           ++L+    F  +QS +IV PDE  V  RFG P   V  PG HM    I+ V   KV +  
Sbjct: 39  LLLVAFTVFLIWQSAFIVAPDEEGVVKRFGIPVR-VVDPGPHMKIPIIESVLQPKVAKLH 97

Query: 115 Q-KIGGRSASVG-----SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
           + +IG R    G         L+LTGD NI+ + F V Y +   R YLFN+ +  ET+ +
Sbjct: 98  RVEIGFRKDRQGRQQMVPQEALMLTGDMNILAIEFIVQYKIKSSREYLFNVADIDETIGK 157

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
            +E++MREV+G+    +   + + QI  + + L+Q  +D Y++G+ +  + ++D  PP  
Sbjct: 158 AAEASMREVIGKSKIDEALTTGKAQIQNDTQELLQHILDDYRTGVQVAAVQLQDVDPPEA 217

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           VA AF +V  A++D ++ + ++  Y N +   A+GEA+ +   +  Y    +  +QGE++
Sbjct: 218 VAAAFKDVTNAKEDREKLINQAQGYRNDITPKAKGEAAQLVNQAKGYAQARLNRSQGESN 277

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS--VMPYLPLNEAFSR 343
           RFL+   +Y  A  ++ KRIY+ET+E +L    K ++D K +   +PYLPL+  FS+
Sbjct: 278 RFLATLKEYNQAKDIISKRIYIETLEDVLPHIDKFVLDGKGADRALPYLPLDR-FSK 333


>gi|73541767|ref|YP_296287.1| HflK [Ralstonia eutropha JMP134]
 gi|72119180|gb|AAZ61443.1| HflK [Ralstonia eutropha JMP134]
          Length = 457

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 169/287 (58%), Gaps = 10/287 (3%)

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQKIGGRSASVGSN 127
            ++V   + AV L+FGK K     PG++    WPI   E+V +   +    GRS S+  +
Sbjct: 130 FFMVQEGQTAVILQFGKFKYSTG-PGINWRLPWPIQSAEVVNLSAVRSVEVGRSTSIKDS 188

Query: 128 S---GLILTGDQNIVGLHFSVLYVVTDPRLYLF-NLENPG---ETLKQVSESAMREVVGR 180
           +     +LT D+NI+ + F+V Y + D   +LF N  + G   E + Q +E+++RE+VGR
Sbjct: 189 NLKDSSMLTQDENIIDVRFTVQYAIQDASEFLFFNKTDRGGDEELVTQAAETSVREIVGR 248

Query: 181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE 240
                +    R+QIA  +   IQ  +  YK+GI + +++++   PP +V  AFD+V +A 
Sbjct: 249 NKMDAVLYENREQIAQGLAKSIQSILSAYKTGIRVISVNVQSVQPPEQVQAAFDDVNKAS 308

Query: 241 QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA 300
           QD +R + E   Y+N V+  A+G A+ ++E + AY+ R++ +A+G+A RF S+ G+Y  A
Sbjct: 309 QDRERAISEGQAYANDVIPRAKGTAARLKEEAEAYRARVVAQAEGDASRFRSVQGEYAKA 368

Query: 301 PTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFSRIQT 346
           P + R RIY+ETM+ I   + K+++D +Q S + YLPL++  ++ Q 
Sbjct: 369 PQVTRDRIYIETMQQIYANSNKILVDARQGSNLLYLPLDKLMAQSQA 415


>gi|84622494|ref|YP_449866.1| integral membrane protease subunit [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|188578521|ref|YP_001915450.1| integral membrane protease subunit [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|84366434|dbj|BAE67592.1| integral membrane protease subunit [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|188522973|gb|ACD60918.1| integral membrane protease subunit [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 375

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 101/292 (34%), Positives = 162/292 (55%), Gaps = 13/292 (4%)

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQ 114
           IL+ +     F S  ++   +R V LRFG+  + +  PG +    WPI+ V  V   E  
Sbjct: 52  ILIAVVLMVLFSSFQLIGEQQRGVVLRFGQ-FSRILQPGPNFKLPWPIESVRKVNATE-- 108

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
                      SN   +LT D+NIV +  +V Y ++DPR YLF   N    L+Q ++SA+
Sbjct: 109 -------IKTFSNQVPVLTRDENIVNVSLNVQYQISDPRKYLFGSRNADLVLEQAAQSAV 161

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           RE VGR   ++   + R  +A+  ++ +Q  +D Y +G+ +  +++ DA PP EV  AFD
Sbjct: 162 REQVGRS-DLNTVLNNRGPLAIASKDRLQAALDAYNTGLAVTGVTLPDARPPEEVKPAFD 220

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           EV  A+Q  +R + E+  Y+ +V+  ARG+ +  R  +  YK   I +A+G+ADRF  + 
Sbjct: 221 EVNGAQQVRERLINEAQAYAAKVVPEARGQGARTRTGAEGYKQATISKAEGDADRFTLLQ 280

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQT 346
            QYV AP + RKR++LET++ +L + +KVI    + V+ Y+PL    S+  T
Sbjct: 281 AQYVGAPEVTRKRLWLETVQKVLSENRKVIGSDGRQVI-YVPLPADASKPAT 331


>gi|212704953|ref|ZP_03313081.1| hypothetical protein DESPIG_03020 [Desulfovibrio piger ATCC 29098]
 gi|212671617|gb|EEB32100.1| hypothetical protein DESPIG_03020 [Desulfovibrio piger ATCC 29098]
          Length = 386

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 120/357 (33%), Positives = 192/357 (53%), Gaps = 36/357 (10%)

Query: 4   DKNNSDWRPTRL----SGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLL 59
           D +  D +P R+    SG+ G+ +G   FD    ++ +          K  G + I L+L
Sbjct: 29  DNDTQDEQPRRVRRSPSGNGGDDNG---FDGRNALKKLAG-------MKMPGGMVIWLVL 78

Query: 60  IGSFCAFQS-IYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQV---EIVKVIERQ 114
                   S IYIV+PDE  V LRFGK  +    PG H     PI+ V   ++ +V+  +
Sbjct: 79  GLVGLWLLSGIYIVNPDEEGVVLRFGK-YDRTEGPGPHYALPAPIESVYKPQVTQVL--R 135

Query: 115 QKIGGRSASVGSN-----------SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
            ++G RS    +               +LTGD+NIV + FSV Y + D   YLFN+ +P 
Sbjct: 136 CEVGFRSTGQATTFRQGELRSVPKEASMLTGDENIVNVQFSVQYKINDAVKYLFNITDPT 195

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
             ++  +E+AMREV+G           + +I  +   L+Q+ +D Y++GI +  + ++D 
Sbjct: 196 NLVRNAAEAAMREVIGNSLIDSAITDGKLKIQSDATVLLQQVLDRYEAGIQVLAVQMQDV 255

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP+EV+DAF +V  A +D+ R + E+  Y N +L  ARGEA+ I   + AY+   +Q+A
Sbjct: 256 HPPQEVSDAFKDVASAREDKSRIINEAEAYRNALLPQARGEAAAILNKAEAYRVARLQQA 315

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAK-KVIIDKKQS--VMPYLPL 337
           +GE+ RF ++  +Y  AP + R+R+Y ETME IL  +K K ++D   S  V+P++PL
Sbjct: 316 EGESRRFDALRQEYEKAPDVTRQRLYYETMEEILAASKDKTLLDSGVSGKVLPHMPL 372


>gi|217976791|ref|YP_002360938.1| HflK protein [Methylocella silvestris BL2]
 gi|217502167|gb|ACK49576.1| HflK protein [Methylocella silvestris BL2]
          Length = 368

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 107/298 (35%), Positives = 167/298 (56%), Gaps = 15/298 (5%)

Query: 55  IILLLIG-SFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM-MFWPIDQVEIVKVIE 112
           + L LIG         Y V P E  +   FG+       PGL+  + +PI +VE + V  
Sbjct: 60  LALALIGIGVWLLSGFYTVAPSEVGLNKIFGRYTGKTG-PGLNYNLPFPIGEVEKLPVTT 118

Query: 113 RQQKIGG-------RSASVGSNSGLILTGDQNIVGLHFSVLYVV--TDPRLYLFNLENPG 163
           R     G       R++       L+LTGD+NI  + F V++ +    P  Y FN+ N  
Sbjct: 119 RSTINVGFTYRPDMRTSVDLPEESLMLTGDENIADVKFVVIWQIDPVRPEDYAFNIANQK 178

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           ET+K V+ESAMREV+GR     I  ++R+ I   V+ L+Q+ ++ YK+G+L+  + ++  
Sbjct: 179 ETVKAVAESAMREVIGRSQIQRILTAERKVIEPAVQELMQRILNQYKAGVLVLQVQLQSV 238

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP +V  AF +V  A+QD++R   E+  Y+NRV+  ARG+A+   + +  Y+ + + EA
Sbjct: 239 DPPEQVIAAFRDVTAAQQDQNRMRNEAEAYANRVVPEARGKAAATIQEAEGYRLQTVAEA 298

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK---KQSVMPYLPLN 338
            G+A RF  IY +Y  AP + R+R+YLETME +     KVI+D+   +  V+PYLPL+
Sbjct: 299 TGQAARFDKIYDEYKKAPGVTRERMYLETMERVFGGMDKVIVDQDGDRSGVVPYLPLS 356


>gi|149926260|ref|ZP_01914522.1| HflK [Limnobacter sp. MED105]
 gi|149825078|gb|EDM84290.1| HflK [Limnobacter sp. MED105]
          Length = 431

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 101/297 (34%), Positives = 171/297 (57%), Gaps = 9/297 (3%)

Query: 48  KSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVE 106
           K + +V ++ +L+     F   YIV      V L+FGK  +   +PG      +PI   E
Sbjct: 85  KGFTAVIVVAVLVWLASGF---YIVQEGREGVVLQFGK-YHHTSMPGFQWRLPYPIQSHE 140

Query: 107 IVKVIE-RQQKIGGRS--ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           +V   + R  ++G R+   S      L+LT D+NI+ + F+V Y + D   YLFN  +P 
Sbjct: 141 VVNSSQVRIVEVGYRNDVKSKVLREALMLTEDENIIDIQFAVQYRLKDAGDYLFNTIDPD 200

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           ET+K  +E+A+REVVGR     +    R+QIAL    ++Q+ +D Y +GIL+++++++  
Sbjct: 201 ETVKMAAETAIREVVGRSKMDFVLYEGREQIALNTAEVMQEILDKYGTGILVSSVTVQGV 260

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP +V  AFD+  +A QD +R   +   Y+N V+  ARG A+ + E +  Y++R++ ++
Sbjct: 261 QPPEQVQAAFDDAVKAGQDRERLKNDGEAYANDVIPRARGNAARLLEEANGYRERVVAQS 320

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNE 339
           +G++ RF +I  +Y  AP + R R+Y++ M+ I     KVI+D K  S + YLPL++
Sbjct: 321 EGDSARFKAILTEYEKAPKVTRDRLYIDAMQEIYTNVTKVIVDSKGNSQLLYLPLDK 377


>gi|88798921|ref|ZP_01114503.1| HflK [Reinekea sp. MED297]
 gi|88778401|gb|EAR09594.1| HflK [Reinekea sp. MED297]
          Length = 395

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 97/288 (33%), Positives = 163/288 (56%), Gaps = 10/288 (3%)

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE 112
           + ++L+ + +F  + S Y V   ERAV LR G+  + +  PGLH+    +DQ+       
Sbjct: 73  IALVLVALVAFTIYNSAYTVDESERAVVLRLGE-FHSISPPGLHLKIPFVDQIA------ 125

Query: 113 RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
              KI        S S  +LT D+NIV +  +V Y   D R Y+ N+ +P  T+   +ES
Sbjct: 126 --DKINVTQVREYSLSTAMLTADENIVEVSMTVEYRAADARSYVLNVRDPQSTIAHAAES 183

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           A+R VVG      +  + R Q+   V+  +Q  +D Y  GI ++ + + DA PP  V DA
Sbjct: 184 ALRHVVGSARLEQVLTNGRDQVQALVKERLQNYLDTYDVGIRLDQLKVTDALPPTAVQDA 243

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           FD+V +A +D+ R V E+  YSN+++  A+G+A      + AY+  ++ +A GE++RFL+
Sbjct: 244 FDDVIKAREDQQRLVNEAQAYSNQIVPVAQGQAERQLAEAEAYRQEVVAKATGESNRFLA 303

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNE 339
           +  +Y  AP + R+R+YL+T++ I   + KV++D +  + M YLPL++
Sbjct: 304 LLEEYDKAPEITRQRLYLDTLQEIYSNSSKVLMDVEGGNNMMYLPLDQ 351


>gi|262275153|ref|ZP_06052964.1| HflK protein [Grimontia hollisae CIP 101886]
 gi|262221716|gb|EEY73030.1| HflK protein [Grimontia hollisae CIP 101886]
          Length = 386

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 104/302 (34%), Positives = 167/302 (55%), Gaps = 15/302 (4%)

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
           G + ++  +I     F   Y +   ER V LRFG+  + +  PGL+     ID+V  V V
Sbjct: 61  GVIAVVGAVIWGVSGF---YTIGEAERGVVLRFGE-YDRIVQPGLNWKPTFIDEVTPVNV 116

Query: 111 IERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
               Q I  RS      SG +LT D+N+V +   V Y V DP  YLF++ N  ++L+Q +
Sbjct: 117 ----QAI--RSLR---GSGDMLTKDENVVRVEMDVQYRVADPEKYLFSVTNADDSLRQAT 167

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
           +SA+R V+G      I  S RQ+I       I + +D Y  G+L+  ++ + A PP +V 
Sbjct: 168 DSALRAVIGDAVMDQILTSGRQEIRERTEVEINRIVDRYDMGLLVVDVNFDTARPPEQVK 227

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
           DAFD+   A +DE+RF+ E+  Y N +L  A G A  +++ ++ YK++ + EAQG+  +F
Sbjct: 228 DAFDDAIAAREDEERFIREAEAYRNDILPKATGRAERLKKEALGYKEKTVNEAQGDVAQF 287

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV--MPYLPLNEAFSRIQTKR 348
             +  +Y+ AP + R R+YLETME +     KV+ID ++    + YLPL++  S+   +R
Sbjct: 288 EKLLPEYLAAPEVTRNRLYLETMEKVFGNTSKVLIDSQEGSNNLLYLPLDKLMSQSPAQR 347

Query: 349 EI 350
            +
Sbjct: 348 NV 349


>gi|110835062|ref|YP_693921.1| protease subunit HflK [Alcanivorax borkumensis SK2]
 gi|110648173|emb|CAL17649.1| Protease subunit HflK [Alcanivorax borkumensis SK2]
          Length = 390

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 101/286 (35%), Positives = 158/286 (55%), Gaps = 11/286 (3%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           I L+++         + V   ERAV L+FGK  + +  PGL+      +Q E V V +  
Sbjct: 66  IALVIVAIGYGLMGFFQVDQRERAVVLQFGK-FDRIVEPGLNWRAPIFEQFEKVDVGQ-- 122

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
                R   +      +LT D NIV +   V Y V DPR +L  +  P E L+  + SA+
Sbjct: 123 ----NRRYEITEE---MLTKDTNIVSVTLQVQYQVLDPRPFLLKVAQPEEILQHATSSAL 175

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           R VVG     D+ +  R+ I ++VR  +   ++ Y +G+++  + ++    P  V DAFD
Sbjct: 176 RHVVGSSSMDDVLKDNREAIRVQVRERLDDYLNRYDTGLVLRQVVLDKTEAPDAVRDAFD 235

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +V +A++DEDRF +E+  YSN V+  ARGEA  I E ++AYK ++I EA+G+A RF  + 
Sbjct: 236 DVSKAKEDEDRFKKEAEAYSNAVIPQARGEAQRIEEEALAYKQQVIDEAKGDASRFTDLL 295

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNE 339
            +Y  AP + R+R+YLETM  +     KV++D  K   + YLPL++
Sbjct: 296 TEYRKAPEVTRERLYLETMTQVFSNTSKVMVDVNKGDSLIYLPLDK 341


>gi|258404619|ref|YP_003197361.1| HflK protein [Desulfohalobium retbaense DSM 5692]
 gi|257796846|gb|ACV67783.1| HflK protein [Desulfohalobium retbaense DSM 5692]
          Length = 361

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 116/330 (35%), Positives = 180/330 (54%), Gaps = 26/330 (7%)

Query: 25  LPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFG 84
           +P FD E  +R  K+       FK  G + + +LL     A   IYIV P E  V  RFG
Sbjct: 25  MPQFDWEEKLRKFKN-------FKGSG-IKVGILLALLLWATTGIYIVEPAEVGVVQRFG 76

Query: 85  KPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQ-KIGGRSAS-VGSNS----------GLI 131
              + +  PG H    +PI+ V+   V +  + +IG R A   GS S           L+
Sbjct: 77  A-FSRMTQPGPHYHLPFPIETVQTPAVSQVNRIEIGFRGAGEPGSYSQTQFRQIPEEALM 135

Query: 132 LTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQR 191
           LTGD+NI+ + F V Y + + R YLFN+    +++K  +E+AMREV+GR          +
Sbjct: 136 LTGDENIISVQFIVQYQIKNARNYLFNIVEQHKSVKDAAEAAMREVIGRNRIDTALTEGK 195

Query: 192 QQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESN 251
            +I  + R L+Q+ +D Y SGI +  + ++D  PP +V DAF +V  A +D+ RF+ E+ 
Sbjct: 196 TEIQNDTRGLLQEILDSYNSGISVVAVQMQDVHPPDQVVDAFKDVASAREDKTRFINEAQ 255

Query: 252 KYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLE 311
            Y N ++   RG+ + I   + A+K+  I++A+G++ RFL +  +Y  A  +  +R+YLE
Sbjct: 256 AYRNDIIPRTRGDVAEITREAEAFKESKIRQAKGDSARFLKLLAEYKKAEAITSERLYLE 315

Query: 312 TMEGILKK--AKKVII--DKKQSVMPYLPL 337
           TME +L     +K II  D  +SV+PYLPL
Sbjct: 316 TMEKVLANPSTEKTIISKDAMESVVPYLPL 345


>gi|289664147|ref|ZP_06485728.1| integral membrane protease subunit [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 392

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 102/292 (34%), Positives = 160/292 (54%), Gaps = 13/292 (4%)

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQ 114
           IL+ +     F S  ++   +R V LRFG+  + V  PG +    WPI+ V  V   E  
Sbjct: 69  ILVAVVLMVLFSSFQLIGEQQRGVVLRFGQ-FSRVLQPGPNFKLPWPIESVRKVNATE-- 125

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
                      SN   +LT D+NIV +  +V Y ++DPR YLF   N    L+Q ++SA+
Sbjct: 126 -------IKTFSNQVPVLTRDENIVNVSLNVQYQISDPRKYLFGSRNADLVLEQAAQSAV 178

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           RE VGR   ++   + R  +A+  ++ +Q  +D Y +G+ +  +++ DA PP EV  AFD
Sbjct: 179 REQVGRS-DLNTVLNNRGPLAIASKDRLQAALDAYNTGLAVTGVTLPDARPPEEVKPAFD 237

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           EV  A+Q  +R + E+  Y+ RV+  ARG+ +  R  +  YK   I +A+G ADRF  + 
Sbjct: 238 EVNGAQQVRERLINEAQAYAARVVPEARGQGARTRTGAEGYKQATISKAEGGADRFTLLQ 297

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQT 346
            QY  AP + RKR++LET++ +L + +KVI    + V+ Y+PL    S+  T
Sbjct: 298 AQYAGAPDVTRKRLWLETVQKVLSENRKVIGSDGRQVI-YVPLPADASKPAT 348


>gi|114330966|ref|YP_747188.1| HflK protein [Nitrosomonas eutropha C91]
 gi|114307980|gb|ABI59223.1| protease FtsH subunit HflK [Nitrosomonas eutropha C91]
          Length = 396

 Score =  173 bits (439), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 113/341 (33%), Positives = 183/341 (53%), Gaps = 25/341 (7%)

Query: 22  GDGLPPFDVEAIIRYIKDKFDLI-----------------PFFKSYGSVYIILLLIGSFC 64
           G+  PP D+E ++R    K + +                 P   S   + II  L+    
Sbjct: 13  GNSGPP-DLEEVMRSFNQKINELFGRKGRGDSNGDSDGKDPDGPSSTGIGIIGFLLLVAW 71

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE-RQQKIGGRSA 122
           A    YIV    R V LRFGK   +   PGL      PI+ VE V + + R  +IG R+ 
Sbjct: 72  AGSGFYIVDEGHRGVVLRFGK-HVETTQPGLRWHVPSPIESVEDVNIAQVRTVEIGYRNN 130

Query: 123 --SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGR 180
             S      LILT D+NIV + F+V Y++  P  +LF    P +++ QV+E+A+REV+G 
Sbjct: 131 VRSKVLKESLILTDDENIVDIQFAVQYILNSPEDFLFTNREPEDSVLQVAETAIREVIGT 190

Query: 181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE 240
                +    R+++A     L+QK +D Y+ GI IN +++++A PP +V  AFD+  +A 
Sbjct: 191 SKMDFVLYEGREEVAARTTVLMQKILDRYQIGISINRVTMQNAQPPEQVQAAFDDAVKAN 250

Query: 241 QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA 300
           QD +R   E   Y+N V+  ARG A+ + E +  YK R+I  ++G+A RF  +  +Y  A
Sbjct: 251 QDRERQRNEGQAYANDVIPRARGAAARLLEEAEGYKQRVITASEGDASRFEQVLVEYAKA 310

Query: 301 PTLLRKRIYLETMEGILKKAKKVIIDKKQSV--MPYLPLNE 339
           P + R+R+Y++T++ +L    K++ID+++    + YLPL++
Sbjct: 311 PEVTRERMYIDTVQHVLSSTSKILIDQEKGGGNLLYLPLDK 351


>gi|240949563|ref|ZP_04753902.1| HflK protein [Actinobacillus minor NM305]
 gi|240296004|gb|EER46670.1| HflK protein [Actinobacillus minor NM305]
          Length = 390

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 99/301 (32%), Positives = 169/301 (56%), Gaps = 13/301 (4%)

Query: 45  PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQ 104
           P  K   ++  + + +     F   Y V   ER V  RFGK  +D+ +PGL+     ID+
Sbjct: 64  PLGKFLPAIIALSVFVWGASGF---YTVQEAERGVITRFGK-LHDIVMPGLNWKPTLIDE 119

Query: 105 VEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           V  V  IER  ++        + SG +LT D+N+V +  +V Y + DP  +LFN+ NP +
Sbjct: 120 VIPVN-IERVSEL--------NTSGSMLTQDENMVQVEMTVQYRIEDPAKFLFNVNNPRD 170

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
           +LKQ ++SA+R V+G     +I  + R  +  +  N ++  +  Y  G+LI  ++ + A 
Sbjct: 171 SLKQATDSALRYVIGHMKMDEILTTGRATVREKTWNALRDIIKTYDMGLLITDVNFQYAR 230

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP EV  AFD+  +A++DE R + E+  Y+      ARG+A  I E + AYK++++ EA+
Sbjct: 231 PPEEVKAAFDDAIKAQEDEQRLIREAEAYARGKEPIARGQAQRIVEQATAYKEKVVLEAK 290

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRI 344
           GE +R + +  +Y  AP L R+R+Y++TME ++K   K+I++   + +  LP+++ F   
Sbjct: 291 GEVERLVKLLPEYKAAPELTRERLYIQTMEKVMKNTPKIIMESNANNLNVLPIDKFFGNT 350

Query: 345 Q 345
           Q
Sbjct: 351 Q 351


>gi|85710754|ref|ZP_01041815.1| Membrane protease, stomatin/prohibitin family protein [Idiomarina
           baltica OS145]
 gi|85695158|gb|EAQ33095.1| Membrane protease, stomatin/prohibitin family protein [Idiomarina
           baltica OS145]
          Length = 387

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 105/297 (35%), Positives = 165/297 (55%), Gaps = 14/297 (4%)

Query: 48  KSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEI 107
           K  G + ++ ++I     F   Y V   +R V LRFG   + +   GLH     +D VE 
Sbjct: 59  KGIGIIAVLAVIIWFIAGF---YTVKEADRGVVLRFGN-FHTLVESGLHWRPVFVDTVEH 114

Query: 108 VKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
           V V          +    S  G +LT D+N+V +   V Y V DPR YLFN++N  + L 
Sbjct: 115 VDV---------NNIRSDSTEGFMLTQDENVVVVQLDVQYRVVDPRNYLFNVDNADQVLS 165

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
           + ++SA+R VVG     ++    R+ +     +L+++T+D Y  G+ I  I++  A PP 
Sbjct: 166 RATDSALRYVVGHTTMDEVLTRGREDVRARTLDLLERTIDPYSMGLQIVDINLLPARPPE 225

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
           EV +AFD+   A++DE+RF+ E+  Y+  V   ARG+   + + + AYK++II EAQGE 
Sbjct: 226 EVKEAFDDAIAAQEDEERFIREAEAYAREVEPLARGQVRRMLQEAQAYKEQIILEAQGEV 285

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSR 343
            RF  +  QY NAP + R+RIYL+T++ +  K  KV++D + S  M YLPL++   +
Sbjct: 286 ARFNELLPQYENAPQVTRERIYLDTLQDLYAKTPKVLVDVEGSNNMMYLPLDKILEK 342


>gi|307297271|ref|ZP_07577077.1| HflK protein [Thermotogales bacterium mesG1.Ag.4.2]
 gi|306916531|gb|EFN46913.1| HflK protein [Thermotogales bacterium mesG1.Ag.4.2]
          Length = 325

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 102/300 (34%), Positives = 169/300 (56%), Gaps = 10/300 (3%)

Query: 46  FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGL--HMMFWPID 103
           FF S   V ++++ I +       ++V PD+  +  RFGK  N V  PGL  H+ F PI+
Sbjct: 23  FFWSGLFVLLVIVAIVAVYFLSGFFLVGPDQVGLIKRFGKFTNSVG-PGLGYHLPF-PIE 80

Query: 104 QVEIVKVIE-RQQKIGGRSASVGS-----NSGLILTGDQNIVGLHFSVLYVVTDPRLYLF 157
            V ++     R+Q+IG R+   G+     N  L+LTGD NIV +   V Y V DP    F
Sbjct: 81  SVVVIDTSNLRKQEIGFRTIRTGTYQTYANESLMLTGDGNIVSVELVVQYYVGDPAKLAF 140

Query: 158 NLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINT 217
            + + G+ ++  +ES +RE V       I  ++R  I++     +Q+ +D   +GI++  
Sbjct: 141 TIVDDGDIVRFTTESVLREEVASSTIDSILTTERDTISIRTAERVQEELDRLDTGIIVKN 200

Query: 218 ISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKD 277
           + +++ +PP++V  AFD+V  A+QD+++ + E+ KY+N ++  A GEA+ I + +  Y  
Sbjct: 201 VFLQEVAPPQQVITAFDDVNSAKQDKEKLIYEAEKYTNDIIPKAEGEAAQIIKDAEGYAQ 260

Query: 278 RIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPL 337
             I  A+GEA+RFL I  +Y  AP + R R+YLET+  IL +A K ++  + SV+  L L
Sbjct: 261 ERILNAEGEAERFLEILEEYEKAPDVTRTRMYLETLNKILSEASKTVVLDQSSVLKLLDL 320


>gi|330831011|ref|YP_004393963.1| HflK protein [Aeromonas veronii B565]
 gi|328806147|gb|AEB51346.1| HflK protein [Aeromonas veronii B565]
          Length = 383

 Score =  172 bits (437), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 114/347 (32%), Positives = 182/347 (52%), Gaps = 20/347 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG------SVY 54
           M++++  ++ +     G+NG   G P  D++ ++R +  +F  +      G       + 
Sbjct: 1   MAWNEPGNNGKDRDPWGNNGKNQGPP--DLDEMLRKVSRRFGGLFGGGKSGGDVGRFGIS 58

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           I L++          Y +   ER   LRFGK  + +  PGL      IDQV  V V    
Sbjct: 59  IALVVAVVVWVVSGFYTIREAERGAVLRFGK-FSHIVEPGLRWKPTFIDQVIPVDV---- 113

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
                 S      SG +LT D+N+V +   V Y V +P  YLF++ N  E+L Q ++SA+
Sbjct: 114 -----ESVRSLPASGFMLTQDENVVRVEMDVQYRVVNPEQYLFSVTNADESLGQATDSAL 168

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           R VVG     D+  + R+++  E   +I   ++ Y+ G+ I  ++   A PP EV DAFD
Sbjct: 169 RYVVGHTRMDDVLTTGREKVRQETWQVIDGIIEPYQMGLQIVDVNFLPARPPEEVKDAFD 228

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +   A++DE RF+ E+  Y+  V   ARG+   + + + AYK +I+ +AQGE  RF  + 
Sbjct: 229 DAISAQEDEQRFIREAEAYAREVEPKARGQVKRLEQEAEAYKSQIVLKAQGEVARFNELL 288

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIID--KKQSVMPYLPLNE 339
            QY+ AP L R+RIYLETME + ++A KV++D     + M YLPL++
Sbjct: 289 PQYLAAPELTRERIYLETMEELYQQANKVVVDMPAGNNSMIYLPLDK 335


>gi|192973060|gb|ACF06959.1| HflK protein [uncultured Roseobacter sp.]
          Length = 393

 Score =  172 bits (437), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 102/292 (34%), Positives = 164/292 (56%), Gaps = 19/292 (6%)

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVG 125
           F S Y V P+E++VEL  G+  N++   GL+   WP    E   V   + +  G + S  
Sbjct: 93  FASFYTVKPEEQSVELFLGE-FNEIGTNGLNFAPWPFVTYEKFNVTTNRTESLGLNDSRD 151

Query: 126 SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVD 185
           S  GL+LT D+NIV + F V++ + +   +LF+L+ P ++++ +SE+AMREV+ +     
Sbjct: 152 SGLGLMLTTDENIVDIDFQVVWNIKNSSDFLFSLKEPEQSIRAISEAAMREVIAQSELAP 211

Query: 186 IFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR---------------EVA 230
           I    R  I   VR LIQKT+D  ++GI +  ++     PP                 V 
Sbjct: 212 ILNRDRAAIEANVRQLIQKTLDERQTGISVVRVNFNKVDPPSRQVIVTAADGSQKRVSVI 271

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
           DAF +VQ AEQ+ D+   +++ Y+N+ L  ARG A+ + E++  Y+  ++  A GEA +F
Sbjct: 272 DAFRDVQAAEQERDQRERQADAYANQRLAEARGAAAQLLEAAEGYRASVVNAALGEASQF 331

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK---KQSVMPYLPLNE 339
            ++  +Y  AP + R+R+Y+ET+E +L    K+I+D     Q V+PYLPLNE
Sbjct: 332 SAVLTEYKEAPEVTRRRLYIETLEKVLGNVDKIIMDNGEGGQGVVPYLPLNE 383


>gi|78046731|ref|YP_362906.1| putative integral membrane protease subunit HflK [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|78035161|emb|CAJ22806.1| putative integral membrane protease subunit HflK [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
          Length = 375

 Score =  172 bits (437), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 100/292 (34%), Positives = 161/292 (55%), Gaps = 13/292 (4%)

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQ 114
           IL+ +     F S  ++   +R V LRFG+  + +  PG +    WPI+ V  V   E  
Sbjct: 52  ILVAVVLMVLFSSFQLIGEQQRGVVLRFGQ-FSRILQPGPNFKLPWPIESVRKVNATE-- 108

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
                      SN   +LT D+NIV +  +V Y ++DPR YLF   N    L+Q ++SA+
Sbjct: 109 -------IKTFSNQVPVLTRDENIVNVSLNVQYQISDPRKYLFGSRNADLVLEQAAQSAV 161

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           RE VGR   ++   + R  +A+  ++ +Q  +D Y +G+ +  +++ DA PP EV  AFD
Sbjct: 162 REQVGRS-DLNTVLNNRGPLAIASKDRLQAALDAYNTGLAVTGVTLPDARPPEEVKPAFD 220

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           EV  A+Q  +R + E+  Y+ +V+  ARG+ +  R  +  YK   I +A+G+ADRF  + 
Sbjct: 221 EVNGAQQVRERLINEAQAYAAKVVPEARGQGARTRTGAEGYKQATISKAEGDADRFTLLQ 280

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQT 346
            QY  AP + RKR++LET++ +L + +KVI    + V+ Y+PL    S+  T
Sbjct: 281 AQYAGAPEVTRKRLWLETVQKVLSENRKVIGSDGRQVI-YVPLPADASKPAT 331


>gi|319779668|ref|YP_004130581.1| HflK protein [Taylorella equigenitalis MCE9]
 gi|317109692|gb|ADU92438.1| HflK protein [Taylorella equigenitalis MCE9]
          Length = 438

 Score =  172 bits (437), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 120/347 (34%), Positives = 185/347 (53%), Gaps = 27/347 (7%)

Query: 16  SGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPD 75
           S   GN   +PP   +     I  KF    FF     V II LLI    +    YIV   
Sbjct: 57  SKRRGNFGRVPPGGPKKPTSKILSKFG---FF-----VIIIGLLIAWLIS--GFYIVKEG 106

Query: 76  ERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE-RQQKIGGRSASVGS--NSGLI 131
           +  V  +FGK    V  PG       PI+ VEIV +   R   +G R  +        L+
Sbjct: 107 QVGVVTQFGKYSRTV-APGFQWHIPTPIENVEIVDISRVRSFSVGYRDNARNKVLPEALM 165

Query: 132 LTGDQNIVGLHFSVLYVV-----------TDPRLYLFNLENPGETLKQVSESAMREVVGR 180
           LT D+NIV + F V Y +           +    YLF    P E+++Q +E+AMRE+VG+
Sbjct: 166 LTEDENIVDVQFDVQYRLKADMQGTNGKNSPAANYLFETRAPDESVRQAAETAMREIVGK 225

Query: 181 RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE 240
           +    I    R Q A++VR L+Q+ +D YK+GI + T++I++  PP +V  AF++  +A 
Sbjct: 226 QSMNKILYESRTQAAIDVRKLMQQILDRYKTGIEVITVAIQNVQPPEQVQAAFEDAIKAG 285

Query: 241 QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA 300
           QD +R   E   Y+++V+  ARG AS I++ +  YK  +IQ+A GEA+RF  I  ++ N+
Sbjct: 286 QDYERQKNEGYAYASKVIPEARGRASRIQQEAEGYKAVVIQKATGEAERFKKIETEFTNS 345

Query: 301 PTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQT 346
           P + R+R+YL +ME +LK   K+++D K  S + YLP+++  +  +T
Sbjct: 346 PEITRERMYLSSMEELLKNTPKILVDSKNNSPLLYLPIDKLSASTRT 392


>gi|238897720|ref|YP_002923399.1| HflK [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
 gi|229465477|gb|ACQ67251.1| HflK [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 410

 Score =  172 bits (436), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 107/343 (31%), Positives = 179/343 (52%), Gaps = 23/343 (6%)

Query: 10  WRPTRLSGSNG-NGDGLPPFDVEAIIRYIKDKFDLIP----------FFKSYGSVYIILL 58
           W      GSN  NG G    D+  ++R +  K + I                   + I++
Sbjct: 16  WGSGGDKGSNKQNGRGKSSIDLNDLLRQLSQKLNTIAKGNSNNNKESKNSKLNPRFFIIV 75

Query: 59  LIGSFCAFQS--IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQK 116
           L+     + +   Y V   ER V  R GK  N    PGL+     ID+V  V V      
Sbjct: 76  LLAVIVGWSASGFYTVKEAERGVVTRLGK-LNHTVQPGLNWSPTFIDKVTPVNV------ 128

Query: 117 IGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMRE 176
               S    + SG++LT D+N+V +  +V Y VTDP  YLF++ +P ++L+Q ++SA+R 
Sbjct: 129 ---ESVRELAASGVMLTSDENVVRIEMNVQYRVTDPAAYLFSVTHPDDSLRQATDSAVRG 185

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
           V+G+     I    R  +  + + ++++T+  YK GI +  ++ + A PP EV  AFD+ 
Sbjct: 186 VIGKYTMDKILTEGRTIVRSDTQRVLEETIRPYKMGITLLDVNFQAARPPEEVKAAFDDA 245

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
             A ++E +++ E+  Y+N V   A G+A  + E + AYKDR + EAQGE   F  +  +
Sbjct: 246 IAARENEQQYIREAEAYANEVQPRANGKAQRLLEDAKAYKDRTVLEAQGEVAGFAKLLPE 305

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           Y +AP + R+R+Y++TME +L   KK++++ K + +  LPL++
Sbjct: 306 YKSAPQITRERLYIDTMENVLSHTKKILVNDKGNHLMVLPLDQ 348


>gi|317403346|gb|EFV83859.1| HflK protein [Achromobacter xylosoxidans C54]
          Length = 434

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 117/370 (31%), Positives = 194/370 (52%), Gaps = 45/370 (12%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI------------------- 44
           + N S+  P R     GNGDG P  D++ + R   ++   +                   
Sbjct: 19  NNNGSEPPPKR---PQGNGDGPP--DLDEVWRDFNNRIGSLFGRKGGGGNNRPGGNRGGM 73

Query: 45  ----PFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
               P     G   I L+ +G + A    YIV   + AV  +FGK K+         + +
Sbjct: 74  TPPSPRGARIGLGVIALVAVGIWAA-SGFYIVQEGQVAVVTQFGKYKSTSQAGFQWRLPY 132

Query: 101 PIDQVEIVKVIE-RQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVVTDPRL--- 154
           PI   E+V V + R  ++G R  +        L+LT D+NIV + F V Y     RL   
Sbjct: 133 PIQSHEMVNVSQLRTFEVGFRGGARNKVLPEALMLTTDENIVDMQFVVQY-----RLRAD 187

Query: 155 ----YLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYK 210
               YLF   +P ++++Q SE+AMREVVG++    +    R  +A +V+ L+Q+ +D Y+
Sbjct: 188 GAPDYLFMTRDPDDSVRQASETAMREVVGKQSMDFVLYEGRTTVASQVQALMQQILDRYQ 247

Query: 211 SGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRE 270
           +G+ ++T++I++  PP +V  AFD+  +A QD +R + E   Y+N+V+  A G+AS + E
Sbjct: 248 TGVQVSTVAIQNVQPPEQVQAAFDDAVKAGQDRERQINEGQAYANQVVPLASGQASRMME 307

Query: 271 SSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQ 329
            +  Y+ ++  +AQG   RF SI  +Y  +P ++R+R+YLE+M+ I  +A KV++D K  
Sbjct: 308 QAEGYRAKVTGDAQGNTARFTSILAEYEKSPVVMRQRMYLESMQDIFTRASKVMVDTKSN 367

Query: 330 SVMPYLPLNE 339
           + M YLPL++
Sbjct: 368 NNMLYLPLDK 377


>gi|126666953|ref|ZP_01737929.1| HflK protein [Marinobacter sp. ELB17]
 gi|126628669|gb|EAZ99290.1| HflK protein [Marinobacter sp. ELB17]
          Length = 395

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 102/282 (36%), Positives = 152/282 (53%), Gaps = 11/282 (3%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           +L+  +  FQS Y V   ERAV LRFG+  +    PGL      ID V          K+
Sbjct: 79  ILVVGYVVFQSFYTVDEQERAVVLRFGE-YDRTETPGLQFKVPLIDDV---------TKV 128

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
           G  +      SG +LT D+N+V +   V Y V D + Y+ N+ +  + L   ++SA+R  
Sbjct: 129 GVTNVRTAQTSGQMLTQDENLVTVELQVQYRVGDAKSYVLNVRDSNQALAFATDSALRHE 188

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG     ++    R Q+ + V   +QK +  Y +G+ I  +++E   PP  V DAF EVQ
Sbjct: 189 VGSATLDEVLTEGRAQLGVMVEQRLQKFLVDYGTGLEIVRVNLESTQPPPAVQDAFREVQ 248

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
           RA +DE R  EE+  Y N+V+  ARGEA  + E + AYK ++ + A GE  RFL +   Y
Sbjct: 249 RAREDEQRVKEEAETYRNKVVPEARGEAQRMIEEANAYKAQVTERANGETARFLELLAVY 308

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLN 338
             AP + R+R+YL+TME +   + KV++D + S  M  LPL+
Sbjct: 309 QLAPVVTRERMYLQTMETVFSNSSKVLVDTESSGNMMLLPLD 350


>gi|237745518|ref|ZP_04575998.1| HflK protein [Oxalobacter formigenes HOxBLS]
 gi|229376869|gb|EEO26960.1| HflK protein [Oxalobacter formigenes HOxBLS]
          Length = 423

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 167/293 (56%), Gaps = 8/293 (2%)

Query: 52  SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLP-GLHMMF-WPIDQVEIVK 109
           ++ +ILL+   F      Y V   +  V + FG+     F P G++    WPI   E+V 
Sbjct: 88  ALGLILLIATVFWLGTGFYSVQEGQTGVVMTFGRFSR--FAPSGINWRIPWPIQSHEVVN 145

Query: 110 VIE-RQQKIGGRSASVGSN--SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
           V + R  ++G R+          L+LT D+NIV + F+V Y + D   ++FN  +  + +
Sbjct: 146 VSQVRTVEVGYRNNLRNKKLEEALMLTNDENIVDIQFAVQYKLKDAADWVFNNRDQEDMV 205

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
           +QV+ESA+REVVG +    +    R QIA++ + ++Q+  D Y+SG+L+  ++++   PP
Sbjct: 206 RQVAESAIREVVGGKKMDFVLYEGRDQIAMDAQKIMQEIFDQYRSGVLVTNVTMQGVQPP 265

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            +V  AFD+  +A QD +R   E   Y+N V+  ARG A+ ++E + AY+ +++  A+G+
Sbjct: 266 EQVQAAFDDAVKAGQDRERLKNEGQAYANDVIPRARGAAARLKEEAEAYRHKVVANAEGD 325

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLN 338
           A RF  I  +Y  AP + R R+YLETM+ I     K+++D K  + + YLPL+
Sbjct: 326 ASRFRQIVAEYQKAPAVTRDRMYLETMQQIFANTTKMMVDAKTGNNLLYLPLD 378


>gi|296534830|ref|ZP_06897172.1| FtsH protease regulator HflK [Roseomonas cervicalis ATCC 49957]
 gi|296264841|gb|EFH11124.1| FtsH protease regulator HflK [Roseomonas cervicalis ATCC 49957]
          Length = 340

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 103/284 (36%), Positives = 155/284 (54%), Gaps = 15/284 (5%)

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGL-HMMFWPIDQVEIVKVIERQQ-KIGGR------ 120
           IY V PDE+ V +RFG   +    PGL + + WP++ V   +V    +  IG R      
Sbjct: 41  IYRVQPDEQGVVMRFGA-FHRTTQPGLNYRIPWPVESVTTPRVTRINRIDIGFRAPNDTP 99

Query: 121 -----SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMR 175
                SA       L+LTGD+NI+ + F+V + + +   YLFN  NP +T+K  +ES MR
Sbjct: 100 LTRPVSARDVLEESLMLTGDENIIDIDFAVFWRIRNAGEYLFNTRNPDQTVKSAAESVMR 159

Query: 176 EVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDE 235
           EVVG+          R  I   VR  +Q  +D Y SGI +  + +    PP EV D F +
Sbjct: 160 EVVGQTPIQPALTEARADIETRVRTGVQFILDQYGSGIELTQVQLLKVDPPAEVIDTFRD 219

Query: 236 VQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYG 295
           VQRA  D +R   ++  Y N ++  ARGE   + + +  +++  +  A+GEA RF+S+  
Sbjct: 220 VQRANADRERLRNQAEAYRNEIIPQARGEGQRMIQEAEGFRESTVARARGEAARFVSVLT 279

Query: 296 QYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLN 338
            Y  A  +  +RIY+ETME IL++  K++ID + Q V+PYLPL+
Sbjct: 280 AYQTARDVTVRRIYMETMEEILRRNPKLVIDDRLQGVVPYLPLD 323


>gi|325929473|ref|ZP_08190598.1| protease FtsH subunit HflK [Xanthomonas perforans 91-118]
 gi|325929488|ref|ZP_08190613.1| protease FtsH subunit HflK [Xanthomonas perforans 91-118]
 gi|325540143|gb|EGD11760.1| protease FtsH subunit HflK [Xanthomonas perforans 91-118]
 gi|325540158|gb|EGD11775.1| protease FtsH subunit HflK [Xanthomonas perforans 91-118]
          Length = 336

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 100/292 (34%), Positives = 161/292 (55%), Gaps = 13/292 (4%)

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQ 114
           IL+ +     F S  ++   +R V LRFG+  + +  PG +    WPI+ V  V   E  
Sbjct: 13  ILVAVVLMVLFSSFQLIGEQQRGVVLRFGQ-FSRILQPGPNFKLPWPIESVRKVNATE-- 69

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
                      SN   +LT D+NIV +  +V Y ++DPR YLF   N    L+Q ++SA+
Sbjct: 70  -------IKTFSNQVPVLTRDENIVNVSLNVQYQISDPRKYLFGSRNADLVLEQAAQSAV 122

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           RE VGR   ++   + R  +A+  ++ +Q  +D Y +G+ +  +++ DA PP EV  AFD
Sbjct: 123 REQVGRS-DLNTVLNNRGPLAIASKDRLQAALDAYNTGLAVTGVTLPDARPPEEVKPAFD 181

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           EV  A+Q  +R + E+  Y+ +V+  ARG+ +  R  +  YK   I +A+G+ADRF  + 
Sbjct: 182 EVNGAQQVRERLINEAQAYAAKVVPEARGQGARTRTGAEGYKQATISKAEGDADRFTLLQ 241

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQT 346
            QY  AP + RKR++LET++ +L + +KVI    + V+ Y+PL    S+  T
Sbjct: 242 AQYAGAPEVTRKRLWLETVQKVLSENRKVIGSDGRQVI-YVPLPADASKPAT 292


>gi|21241909|ref|NP_641491.1| integral membrane protease subunit [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|21107296|gb|AAM36027.1| integral membrane protease subunit [Xanthomonas axonopodis pv.
           citri str. 306]
          Length = 375

 Score =  172 bits (435), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 98/283 (34%), Positives = 158/283 (55%), Gaps = 13/283 (4%)

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQ 114
           IL+ +     F S  ++   +R V LRFG+  + +  PG +    WPI+ V  V   E  
Sbjct: 52  ILVAVVLMVLFSSFQLIGEQQRGVVLRFGQ-FSRILQPGPNFKLPWPIESVRKVNATE-- 108

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
                      SN   +LT D+NIV +  +V Y ++DPR YLF   N    L+Q ++SA+
Sbjct: 109 -------IKTFSNQVPVLTRDENIVNVSLNVQYQISDPRKYLFGSRNADLVLEQAAQSAV 161

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           RE VGR   ++   + R  +A+  ++ +Q  +D Y +G+ +  +++ DA PP EV  AFD
Sbjct: 162 REQVGRS-DLNTVLNNRGPLAIASKDRLQAALDAYNTGLAVTGVTLPDARPPEEVKPAFD 220

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           EV  A+Q  +R + E+  Y+ +V+  ARG+ +  R  +  YK   I +A+G+ADRF  + 
Sbjct: 221 EVNGAQQVRERLINEAQAYAAKVVPEARGQGARTRTGAEGYKQATISKAEGDADRFTLLQ 280

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPL 337
            QY  AP + RKR++LET++ +L + +KVI    + V+ Y+PL
Sbjct: 281 AQYAGAPEVTRKRLWLETVQKVLSENRKVIGSDGRQVI-YVPL 322


>gi|294665747|ref|ZP_06731020.1| integral membrane protease subunit [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292604483|gb|EFF47861.1| integral membrane protease subunit [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 375

 Score =  172 bits (435), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 98/283 (34%), Positives = 158/283 (55%), Gaps = 13/283 (4%)

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQ 114
           IL+ +     F S  ++   +R V LRFG+  + +  PG +    WPI+ V  V   E  
Sbjct: 52  ILVAVVLMVLFSSFQLIGEQQRGVVLRFGQ-FSRILQPGPNFKLPWPIESVRKVNATE-- 108

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
                      SN   +LT D+NIV +  +V Y ++DPR YLF   N    L+Q ++SA+
Sbjct: 109 -------IKTFSNQVPVLTRDENIVNVSLNVQYQISDPRKYLFGSRNADLVLEQAAQSAV 161

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           RE VGR   ++   + R  +A+  ++ +Q  +D Y +G+ +  +++ DA PP EV  AFD
Sbjct: 162 REQVGRS-DLNTVLNNRGPLAIASKDRLQAALDAYNTGLAVTGVTLPDARPPEEVKPAFD 220

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           EV  A+Q  +R + E+  Y+ +V+  ARG+ +  R  +  YK   I +A+G+ADRF  + 
Sbjct: 221 EVNGAQQVRERLINEAQAYAAKVVPEARGQGARTRTGAEGYKQATISKAEGDADRFTLLQ 280

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPL 337
            QY  AP + RKR++LET++ +L + +KVI    + V+ Y+PL
Sbjct: 281 AQYAGAPDVTRKRLWLETVQKVLSENRKVIGSDGRQVI-YVPL 322


>gi|54293475|ref|YP_125890.1| protease subunit HflK [Legionella pneumophila str. Lens]
 gi|53753307|emb|CAH14754.1| protease subunit HflK [Legionella pneumophila str. Lens]
          Length = 380

 Score =  172 bits (435), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 102/273 (37%), Positives = 156/273 (57%), Gaps = 10/273 (3%)

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQ 115
           +LL+     A   I+IV P E+AV LRFGK    V  PG H +   I   +IV  ++R  
Sbjct: 61  VLLIAFILWALSGIFIVDPAEQAVILRFGKYAETVG-PGPHWIPRFISS-KIVMNVDRML 118

Query: 116 KIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMR 175
                     S S  +LT D+N+V +  +V Y + D   YLFN+ NP E+L+Q + SA+R
Sbjct: 119 DY--------SYSAQMLTSDENLVSVSLAVQYRINDLSEYLFNVANPEESLQQATSSALR 170

Query: 176 EVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDE 235
           +VVG      I    R+     V+  + KT++ YK+GILI  +S + A  P  V DAFD+
Sbjct: 171 QVVGTTTLDQIITEGREVWGGRVQETLTKTLESYKTGILIVNVSPQPARAPESVQDAFDD 230

Query: 236 VQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYG 295
             +A++DE RF E++  Y+ +V+  A G+AS I++ + AY  +++  AQGE   FL++  
Sbjct: 231 AIKAQEDEKRFKEQAYAYAAKVVPIAEGKASRIQQEAEAYSKQVVLRAQGEVAEFLALLP 290

Query: 296 QYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK 328
           QY  AP +  KR+YLE M+ ++ K+  +I+D K
Sbjct: 291 QYNAAPQVTAKRMYLEAMQKVMNKSSTIIVDSK 323


>gi|294624326|ref|ZP_06703027.1| integral membrane protease subunit [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292601372|gb|EFF45408.1| integral membrane protease subunit [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 375

 Score =  172 bits (435), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 98/283 (34%), Positives = 158/283 (55%), Gaps = 13/283 (4%)

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQ 114
           IL+ +     F S  ++   +R V LRFG+  + +  PG +    WPI+ V  V   E  
Sbjct: 52  ILVAVVLMVLFSSFQLIGEQQRGVVLRFGQ-FSRILQPGPNFKLPWPIESVRKVNATE-- 108

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
                      SN   +LT D+NIV +  +V Y ++DPR YLF   N    L+Q ++SA+
Sbjct: 109 -------IKTFSNQVPVLTRDENIVNVSLNVQYQISDPRKYLFGSRNADLVLEQAAQSAV 161

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           RE VGR   ++   + R  +A+  ++ +Q  +D Y +G+ +  +++ DA PP EV  AFD
Sbjct: 162 REQVGRS-DLNTVLNNRGPLAIASKDRLQAALDAYNTGLAVTGVTLPDARPPEEVKPAFD 220

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           EV  A+Q  +R + E+  Y+ +V+  ARG+ +  R  +  YK   I +A+G+ADRF  + 
Sbjct: 221 EVNGAQQVRERLINEAQAYAAKVVPEARGQGARTRTGAEGYKQATISKAEGDADRFTLLQ 280

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPL 337
            QY  AP + RKR++LET++ +L + +KVI    + V+ Y+PL
Sbjct: 281 AQYAGAPEVTRKRLWLETVQKVLSENRKVIGSDGRQVI-YVPL 322


>gi|323139004|ref|ZP_08074064.1| HflK protein [Methylocystis sp. ATCC 49242]
 gi|322395758|gb|EFX98299.1| HflK protein [Methylocystis sp. ATCC 49242]
          Length = 382

 Score =  172 bits (435), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 109/304 (35%), Positives = 166/304 (54%), Gaps = 25/304 (8%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIER---------QQKIGGR 120
           Y V P+E  + L FGK +        + +  PI  V  + V +R         +    GR
Sbjct: 80  YTVGPNEIGLNLIFGKYRGKTQAGLNYNLPSPIGSVIKLAVTDRNVTDVGFREEAPAEGR 139

Query: 121 SASVGS---------NSGLILTGDQNIVGLHFSVLYVV--TDPRLYLFNLENPGETLKQV 169
             + G+            L+LTGD+NI  + F V++ +    P  Y FN+ NP  T+K V
Sbjct: 140 RRAPGNVVARGPEAPEESLMLTGDENIADVKFRVVWQIDPAKPEDYAFNVANPPLTVKAV 199

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           +ESAMRE+VG+     I  + R+ I    + L+QK +D Y SG+++  + +    PP+ V
Sbjct: 200 AESAMREIVGQSQIQKILTADRKLIEPACQALMQKVLDDYHSGVMVLQVLLLSVDPPQSV 259

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
             AF +V  A+QD  R   E+  Y+NRV+  ARG A+ I + + AY+++ + EA+G+A R
Sbjct: 260 IAAFRDVTAAQQDLQRLGNEAEAYANRVVPEARGAAAEILQKAEAYREQTVAEARGQAAR 319

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ----SVMPYLPLNEAFSRIQ 345
           F  IY QY NAP L R+R+Y+ETME +L  A+KVI+D       SV P++PL  +F+  Q
Sbjct: 320 FEKIYEQYKNAPALTRQRLYIETMERVLGGAEKVILDDPSKGGASVAPFVPL-PSFAPFQ 378

Query: 346 TKRE 349
             R+
Sbjct: 379 GGRK 382


>gi|289667514|ref|ZP_06488589.1| putative integral membrane protease subunit HflK [Xanthomonas
           campestris pv. musacearum NCPPB4381]
          Length = 375

 Score =  172 bits (435), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 102/296 (34%), Positives = 166/296 (56%), Gaps = 18/296 (6%)

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVI 111
           + + ++LI  F +FQ   ++   +R V LRFG+  + +  PG +    WPI+ V  V   
Sbjct: 52  ILVAVVLIVLFSSFQ---LIGEQQRGVVLRFGQ-FSRILQPGPNFKLPWPIESVRKVNAT 107

Query: 112 ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSE 171
           E             SN   +LT D+NIV +  +V Y ++DPR YLF   N    L+Q ++
Sbjct: 108 E---------IKTFSNQVPVLTRDENIVNVSLNVQYQISDPRKYLFGSRNADLVLEQAAQ 158

Query: 172 SAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231
           SA+RE VGR   ++   + R  +A+  ++ +Q  +D Y +G+ +  +++ DA PP EV  
Sbjct: 159 SAVREQVGRS-DLNTVLNNRGPLAIASKDRLQAALDAYNTGLAVTGVTLPDARPPEEVKP 217

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           AFDEV  A+Q  +R + E+  Y+ +V+  ARG+ +  R  +  YK   I +A+G+ADRF 
Sbjct: 218 AFDEVNGAQQVRERLINEAQAYAAKVVPEARGQGARTRTGAEGYKQATISKAEGDADRFT 277

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILKKAKKVI-IDKKQSVMPYLPLNEAFSRIQT 346
            +  QY  AP + RKR++LET++ +L + +KVI  D +Q +  Y+PL    S+  T
Sbjct: 278 LLQAQYAGAPDVTRKRLWLETVQKVLSENRKVIGSDGRQLI--YVPLPADASKPAT 331


>gi|187478826|ref|YP_786850.1| HflK protein [Bordetella avium 197N]
 gi|115423412|emb|CAJ49946.1| HflK protein [Bordetella avium 197N]
          Length = 433

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 100/276 (36%), Positives = 164/276 (59%), Gaps = 6/276 (2%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE-RQQKIGGRSASVGS-- 126
           YIV   + AV  +FGK K+         + +PI   E+V + + R  ++G R  +     
Sbjct: 101 YIVQEGQVAVVTQFGKYKSTAQAGFQWRLPYPIQSQELVNISQLRTFEVGFRGGARNKVL 160

Query: 127 NSGLILTGDQNIVGLHFSVLYVVTDPRL--YLFNLENPGETLKQVSESAMREVVGRRFAV 184
              L+LT D+NIV + F V Y +       YLF + +P E+++Q +E+AMRE+VGR+   
Sbjct: 161 PEALMLTTDENIVDMQFVVQYRLRADGAPDYLFKMRDPDESVRQAAETAMREIVGRKPMD 220

Query: 185 DIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDED 244
            +    R ++A EV+ L+Q+ +D Y +GI I+T++I++  PP +V  AFD+  +A QD +
Sbjct: 221 FVLYEGRTEVASEVQALMQQILDRYSAGIQISTVAIQNVQPPEQVQAAFDDAVKAGQDRE 280

Query: 245 RFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLL 304
           R + E   Y+N+V+  A G+AS + E +  YK +++ +AQG   RF +I  +Y  +P ++
Sbjct: 281 RQINEGQAYANQVVPLAGGQASRMLEQAEGYKAKVVGDAQGNTARFSAILTEYEKSPQVM 340

Query: 305 RKRIYLETMEGILKKAKKVIIDK-KQSVMPYLPLNE 339
           R R+YLETM+ I   A KV++D  K + M YLPL++
Sbjct: 341 RNRMYLETMQQIFSHASKVMVDAGKSNNMLYLPLDK 376


>gi|239815185|ref|YP_002944095.1| HflK protein [Variovorax paradoxus S110]
 gi|239801762|gb|ACS18829.1| HflK protein [Variovorax paradoxus S110]
          Length = 456

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 105/295 (35%), Positives = 173/295 (58%), Gaps = 9/295 (3%)

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
           G V  + +LI     F   +IV+  ++AV  +FG+ K+ V       + +PI + E+V V
Sbjct: 111 GLVAAVAVLIWLGTGF---FIVNEGQQAVVTQFGRYKSTVNAGFNWRLPYPIQRHEVVVV 167

Query: 111 IERQQKIGGRSA---SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
            + +    GR A   S G     +LT D+NIV + F+V Y +++ + +L+  ++P ET+ 
Sbjct: 168 TQIRSTDVGRDAIVRSTGLRESAMLTEDENIVEIKFAVQYRLSNAQAWLYESKSPAETIV 227

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS--P 225
           QV+ES++REVVG+         +R QIA  VR L+Q  +D YK G+ +  I+++     P
Sbjct: 228 QVAESSVREVVGKMKMDAALAEERDQIAPRVRQLMQTILDRYKIGVEVVGINLQQGGVRP 287

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           P +V  AFD+V +A Q+ +R   ++  Y+N+V+  A G +S ++E S AYK RI+ +AQG
Sbjct: 288 PEQVQAAFDDVLKAGQERERTKNDAQAYANQVVPLAAGTSSRLKEESEAYKARIVAQAQG 347

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNE 339
           +A RF ++  +Y  AP + R R+Y + M+ I     KV++D KQ S + YLPL++
Sbjct: 348 DAGRFSAVLAEYQKAPQVTRDRMYTDAMQQIYASTTKVLVDTKQGSNLLYLPLDK 402


>gi|119776155|ref|YP_928895.1| hflK protein [Shewanella amazonensis SB2B]
 gi|119768655|gb|ABM01226.1| hflK protein [Shewanella amazonensis SB2B]
          Length = 377

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 110/327 (33%), Positives = 174/327 (53%), Gaps = 12/327 (3%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDE 76
           G+ G  D  PP D++ + R I  +F        +G + +I+ L  +       Y +   E
Sbjct: 15  GNKGGNDKGPP-DLDEVFRNISKRFGGKGNGLGFGGLGLIIALGAAVWFLSGFYTIKTAE 73

Query: 77  RAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQ 136
           R V LRFG+   +V  PGL      ID+V  V V  R+             SG ILT D+
Sbjct: 74  RGVHLRFGEYIGEVG-PGLRWKATFIDEVYPVDVEARRTIPA---------SGSILTSDE 123

Query: 137 NIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIAL 196
           N+V +  +V Y VTD   Y+F+  +   +L++ ++SA+R VVG     DI  + R +I  
Sbjct: 124 NVVLVELAVQYKVTDAYQYMFSAVDANSSLREATDSALRYVVGHSKMDDILTTGRDKIRT 183

Query: 197 EVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNR 256
           +    +++ ++ YK G+ I  ++   A PP EV DAFD+   A++DE RF+ E+  Y   
Sbjct: 184 DTWAELERIIEPYKLGLTIMDVNFLPARPPEEVKDAFDDAIAAQEDEQRFIREAEAYQRE 243

Query: 257 VLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGI 316
           V   ARG+   I E + AYK++++Q+AQG   RF  +  +Y  AP + R+R+Y+E ME +
Sbjct: 244 VEPRARGQEQRIAEDARAYKEQVVQQAQGAVARFEKLLPEYKAAPEVTRQRMYIEAMEEV 303

Query: 317 LKKAKKVIIDKKQSV-MPYLPLNEAFS 342
           L    KV+ID K +  + YLPL++  +
Sbjct: 304 LSGNNKVLIDAKNNGNLLYLPLDKMIT 330


>gi|325920233|ref|ZP_08182187.1| protease FtsH subunit HflK [Xanthomonas gardneri ATCC 19865]
 gi|325549287|gb|EGD20187.1| protease FtsH subunit HflK [Xanthomonas gardneri ATCC 19865]
          Length = 341

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 159/283 (56%), Gaps = 13/283 (4%)

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQ 114
           IL+ +     F S  ++   +R V LRFG+  + +  PG +    WP++ V  V   E  
Sbjct: 13  ILVAVVLMVLFSSFQLIGEQQRGVVLRFGQ-FSRILQPGPNFKLPWPVESVRKVNATE-- 69

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
                      SN   +LT D+NIV +  +V Y ++DPR YLF   N    L+Q ++SA+
Sbjct: 70  -------IKTFSNQVPVLTRDENIVNVSLNVQYQISDPRKYLFGSRNADLVLEQAAQSAV 122

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           RE VGR   ++   + R  +A+  ++ +Q  +D Y +G+ +  +++ DA PP EV  AFD
Sbjct: 123 REQVGRS-DLNTVLNNRGPLAIASKDRLQAALDAYNTGLSVTGVTLPDARPPEEVKPAFD 181

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           EV  A+Q  +R + E+  Y+ +V+  ARG+ +  R  +  YK   + +A+G+ADRF  + 
Sbjct: 182 EVNGAQQVRERLINEAQAYAAKVVPEARGQGARTRTGAEGYKQATVSKAEGDADRFTLLQ 241

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPL 337
            QY NAP + RKR++LET++ +L + +KVI    + V+ Y+PL
Sbjct: 242 EQYANAPEVTRKRLWLETVQKVLSENRKVIGSDGRQVI-YVPL 283


>gi|283851337|ref|ZP_06368619.1| HflK protein [Desulfovibrio sp. FW1012B]
 gi|283573287|gb|EFC21265.1| HflK protein [Desulfovibrio sp. FW1012B]
          Length = 377

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 105/304 (34%), Positives = 174/304 (57%), Gaps = 17/304 (5%)

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVK 109
           G   I++L++  F     IYIV PDE  +  RFG        PG H    +P++ V+  K
Sbjct: 42  GGPKIVILVLAVFWLASGIYIVEPDEAGIVQRFGAYAYSTG-PGPHYHLPFPVETVKTPK 100

Query: 110 VIE-RQQKIG-----GRSASVGSNSG-----LILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
           V + R+ ++G     GR  +   N       L+LTGD+NIV + F V Y V +P  YLF 
Sbjct: 101 VSQVRRVEVGFHSNYGRDGASLQNKAVPEESLMLTGDENIVDVQFIVQYQVNNPVNYLFK 160

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           +++P +TLK  +E+AMREV+G      +  + + ++  + + L+Q  ++ Y SG+ +  +
Sbjct: 161 IDHPDQTLKSAAEAAMREVMGDAKIDSVLTAGKLKVQTDAKALLQAMLNRYDSGMDVLAV 220

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
            ++D  PPREV DAF +V  A +D+ R V E++ Y+N +L  ARG A+ I   + AY+++
Sbjct: 221 QLQDVHPPREVVDAFKDVASAREDKVRLVNEADAYANDILPKARGRAAAILNEAAAYREQ 280

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKA--KKVII--DKKQSVMPY 334
           +I+ A+G ADRF ++  +Y  A  + R R+Y+E ME +L     +K+++  D  +  +PY
Sbjct: 281 VIRRAKGGADRFSALRVEYEKAKDITRDRLYIEGMETLLSNPGLEKLVLSDDAARQAVPY 340

Query: 335 LPLN 338
           L L+
Sbjct: 341 LSLD 344


>gi|54296517|ref|YP_122886.1| protease subunit HflK [Legionella pneumophila str. Paris]
 gi|53750302|emb|CAH11696.1| protease subunit HflK [Legionella pneumophila str. Paris]
 gi|307609290|emb|CBW98765.1| protease subunit HflK [Legionella pneumophila 130b]
          Length = 380

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 102/273 (37%), Positives = 156/273 (57%), Gaps = 10/273 (3%)

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQ 115
           +LL+     A   I+IV P E+AV LRFGK    V  PG H +   I   +IV  ++R  
Sbjct: 61  VLLIAFILWALSGIFIVDPAEQAVILRFGKYAETVG-PGPHWIPRFISS-KIVMNVDRVL 118

Query: 116 KIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMR 175
                     S S  +LT D+N+V +  +V Y + D   YLFN+ NP E+L+Q + SA+R
Sbjct: 119 DY--------SYSAQMLTSDENLVSVSLAVQYRINDLSEYLFNVANPEESLQQATSSALR 170

Query: 176 EVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDE 235
           +VVG      I    R+     V+  + KT++ YK+GILI  +S + A  P  V DAFD+
Sbjct: 171 QVVGTTTLDQIITEGREVWGGRVQETLTKTLESYKTGILIVNVSPQPARAPESVQDAFDD 230

Query: 236 VQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYG 295
             +A++DE RF E++  Y+ +V+  A G+AS I++ + AY  +++  AQGE   FL++  
Sbjct: 231 AIKAQEDEKRFKEQAYAYAAKVVPIAEGKASRIQQEAEAYSKQVVLRAQGEVAEFLALLP 290

Query: 296 QYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK 328
           QY  AP +  KR+YLE M+ ++ K+  +I+D K
Sbjct: 291 QYNAAPQVTAKRMYLEAMQKVMNKSSTIIVDSK 323


>gi|319763706|ref|YP_004127643.1| hflk protein [Alicycliphilus denitrificans BC]
 gi|330824031|ref|YP_004387334.1| HflK protein [Alicycliphilus denitrificans K601]
 gi|317118267|gb|ADV00756.1| HflK protein [Alicycliphilus denitrificans BC]
 gi|329309403|gb|AEB83818.1| HflK protein [Alicycliphilus denitrificans K601]
          Length = 458

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 107/295 (36%), Positives = 167/295 (56%), Gaps = 9/295 (3%)

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
           G + +I +LI     F   +IV   ++AV  +FGK K+ V       + +PI + E+V V
Sbjct: 116 GLIAVIAVLIWLGTGF---FIVQEGQQAVITQFGKYKSTVNAGFNWRLPYPIQRHELVFV 172

Query: 111 IERQQKIGGRSA---SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
            + +    GR     S G     +LT D+NIV + F+V Y + D R +LF   NP + + 
Sbjct: 173 TQIRSVDVGRDTIIKSTGLRESAMLTEDENIVEIKFAVQYRLNDARAWLFESRNPADAVV 232

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS--P 225
           QV+E+A+REVVG+         +R QIA  VRNL+Q  +D YK G+ +  I+++     P
Sbjct: 233 QVAETAVREVVGKMRMDTALAEERDQIAPRVRNLMQTILDRYKIGVEVVGINLQQGGVRP 292

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           P +V  AFD+V +A Q+ +R   E+  Y+N V+  A G AS + E + AYK R++ +AQG
Sbjct: 293 PEQVQAAFDDVLKAGQERERAKNEAQAYANDVVPRAAGTASRLAEEAAAYKARVVAQAQG 352

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNE 339
           +  RF  I  +Y  A  + R R+Y+ETM+ I     KV+++ +Q S + YLPL++
Sbjct: 353 DTQRFSDILTEYQKAQQVTRDRMYIETMQQIYSNVTKVLVESRQGSNLLYLPLDK 407


>gi|148360900|ref|YP_001252107.1| protease subunit HflK [Legionella pneumophila str. Corby]
 gi|296106034|ref|YP_003617734.1| membrane protease subunit HflK [Legionella pneumophila 2300/99
           Alcoy]
 gi|148282673|gb|ABQ56761.1| protease subunit HflK [Legionella pneumophila str. Corby]
 gi|295647935|gb|ADG23782.1| membrane protease subunit HflK [Legionella pneumophila 2300/99
           Alcoy]
          Length = 380

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 102/273 (37%), Positives = 156/273 (57%), Gaps = 10/273 (3%)

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQ 115
           +LL+     A   I+IV P E+AV LRFGK    V  PG H +   I   +IV  ++R  
Sbjct: 61  VLLIAFILWALSGIFIVDPAEQAVILRFGKYAETVG-PGPHWIPRFISS-KIVMNVDRVL 118

Query: 116 KIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMR 175
                     S S  +LT D+N+V +  +V Y + D   YLFN+ NP E+L+Q + SA+R
Sbjct: 119 DY--------SYSAQMLTSDENLVSVSLAVQYRINDLSEYLFNVANPEESLQQATSSALR 170

Query: 176 EVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDE 235
           +VVG      I    R+     V+  + KT++ YK+GILI  +S + A  P  V DAFD+
Sbjct: 171 QVVGTTTLDQIITEGREVWGGRVQETLTKTLESYKTGILIVNVSPQPARAPESVQDAFDD 230

Query: 236 VQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYG 295
             +A++DE RF E++  Y+ +V+  A G+AS I++ + AY  +++  AQGE   FL++  
Sbjct: 231 AIKAQEDEKRFKEQAYAYAAKVVPIAEGKASRIQQEAEAYSKQVVLRAQGEVAEFLALLP 290

Query: 296 QYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK 328
           QY  AP +  KR+YLE M+ ++ K+  +I+D K
Sbjct: 291 QYNAAPQVTAKRMYLEAMQKVMNKSSTIIVDSK 323


>gi|157826649|ref|YP_001495713.1| protease activity modulator HflK [Rickettsia bellii OSU 85-389]
 gi|157801953|gb|ABV78676.1| Protease activity modulator HflK [Rickettsia bellii OSU 85-389]
          Length = 336

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 97/303 (32%), Positives = 175/303 (57%), Gaps = 18/303 (5%)

Query: 49  SYGSVYIILLLIGSFCAF--QSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVE 106
           ++ +  IIL+ + SF  +    IY V   E A   RFG+     +  GL+       + E
Sbjct: 36  NFSTKTIILVALASFVLWLASGIYEVKEGEEAAVTRFGRFVRKGY-AGLNYRLPAPFEKE 94

Query: 107 IVKVIERQQKI------------GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRL 154
           IV+ +++ ++I            GG + ++   S ++LTGD+NIV L+  V++ +++   
Sbjct: 95  IVEKVKQSRRIEIGYRTNNFVRSGGDTKNIAGES-IMLTGDENIVALNCDVMWHISNLED 153

Query: 155 YLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGIL 214
           ++FN++ P ET+K   ESA+REV+G      +   Q+Q+I  ++  L QK +D Y +G++
Sbjct: 154 FMFNIQKPEETVKSTVESAVREVIGNTPITWVLSDQKQEITHKIETLAQKILDSYNAGVM 213

Query: 215 INTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIA 274
           I  + +  A PP EV DA+ +VQ ++ D+++ + ++  Y+N+VL  ARG A+ I E + A
Sbjct: 214 IEKVQLLKAEPPAEVIDAYRDVQTSKADKEKEINQAQAYNNKVLPEARGAAARIIEEAEA 273

Query: 275 YKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPY 334
           Y++ II +A+G++ RF +IY QY     + R R+YLE  E +L  + K II+   +++P+
Sbjct: 274 YREEIISKAEGDSQRFSAIYKQYAANKQVTRDRLYLEVAEEVLSGSNKTIIN--NALLPH 331

Query: 335 LPL 337
           + +
Sbjct: 332 MAI 334


>gi|237747716|ref|ZP_04578196.1| membrane protease subunit HflK [Oxalobacter formigenes OXCC13]
 gi|229379078|gb|EEO29169.1| membrane protease subunit HflK [Oxalobacter formigenes OXCC13]
          Length = 419

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 95/297 (31%), Positives = 167/297 (56%), Gaps = 6/297 (2%)

Query: 52  SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKV 110
           ++ I+  +  +F      ++V   +  + + FG+  +    PG +    WPI   E+V V
Sbjct: 83  ALCILFGIAAAFWLATGFFVVQEGQTGIVMTFGRFSH-FAAPGFNWRKPWPIQSHEVVNV 141

Query: 111 IE-RQQKIGGRSASVGS--NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
            + R  ++G R+          L+LT D+NIV + F+V Y + +   ++FN  +  + ++
Sbjct: 142 SQVRTVEVGYRTTLKNKRLEEALMLTNDENIVDIQFAVQYKLKNASDWVFNNRDQEDMVR 201

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
           QV+E+A+REVVG +    +    R QIA E + L+Q+  D Y +G+L+ +++++   PP 
Sbjct: 202 QVAETAIREVVGGKKMDFVLYEGRDQIASEAQKLMQQIFDQYHAGVLVTSVTMQGVQPPE 261

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
           EV  AFD+  +A QD +R   E   Y+N V+  A+G A+ ++E +  Y+ R+I  A+G+ 
Sbjct: 262 EVQAAFDDAVKAGQDRERLKNEGQAYANEVVPRAKGAAARLKEEAEGYRQRVIANAEGDT 321

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSR 343
            RF  I  +Y  AP + R R+YLETM+ I     K+++D KK + + YLPL++  S+
Sbjct: 322 SRFKQIVREYQKAPAVTRDRMYLETMQEIFSNTTKLMVDSKKGNQLLYLPLDKLISQ 378


>gi|94429025|gb|ABF18941.1| HflK [uncultured bacterium pFosLip]
          Length = 375

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 103/294 (35%), Positives = 167/294 (56%), Gaps = 18/294 (6%)

Query: 54  YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE 112
           YI+++L+         Y V   ER V  RFG    +  +PGLH    +PI+ V++V    
Sbjct: 53  YILVILLIVAWGLTGFYRVDEAERGVVQRFGA-YTESTMPGLHWHLPFPIETVDLV---- 107

Query: 113 RQQKIGGRSASVGSNSGL---ILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
                   +A+  SN      +LT D+  V +   V Y  TDP  Y FN+ +P +TL+ V
Sbjct: 108 --------NANQVSNYAYRTEMLTADEQYVNIDMVVQYRRTDPVAYSFNVADPEQTLQDV 159

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           +ESA+REVVG      +  ++R +IA   +  +Q T+D Y +G+ + +IS+E+ + P  V
Sbjct: 160 TESALREVVGTSELEVLIAARRDEIASRTQEALQSTLDSYGAGLTVTSISLENVNYPDSV 219

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
             A D+ Q+A  D +RF  E+++Y+  V+  ARGEA+ + E + AY+DR+I +A+GEA R
Sbjct: 220 QAAVDDAQKARNDSERFQLEADRYARDVVPRARGEAARVLEDAKAYRDRVIADAEGEAAR 279

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFS 342
           F  +  +Y  AP + R+R+Y++ +E I  ++ KV ID   S  + YLPL++  +
Sbjct: 280 FELLLEEYQKAPRVTRERLYIDAIEDIYSRSSKVFIDSDGSGNLLYLPLDKMLN 333


>gi|304311746|ref|YP_003811344.1| HflK protein [gamma proteobacterium HdN1]
 gi|301797479|emb|CBL45699.1| HflK protein [gamma proteobacterium HdN1]
          Length = 383

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 104/280 (37%), Positives = 160/280 (57%), Gaps = 11/280 (3%)

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y +   E+ V LR GK    V   GLH     ID+V  V V+ +Q  +        S  
Sbjct: 69  VYRLDQAEQGVILRLGKYHTTVGA-GLHWNPPLIDKVFKVNVM-KQNNV--------SLQ 118

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
             +LT D+N+V +  +V Y V DP+LY   + +  + L + +ESA+R VVG      I  
Sbjct: 119 ATMLTEDENLVDIALNVQYQVHDPKLYFLKIGSAEDALMRAAESALRHVVGGTEMDSIIT 178

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             RQ +A EV   +Q+ +D Y +G+L+   +IEDA PP+EV  AFD+V +A++DE R   
Sbjct: 179 EGRQVMAQEVTVRLQELLDRYSTGLLVTKANIEDAHPPKEVKAAFDDVIKAKEDESRLQN 238

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           E+  Y+N ++  ARG+A    E + AYK  ++  A+GEA+RF ++  +YV AP + R+R+
Sbjct: 239 EAQAYANGIVPEARGQAQRKLEEANAYKSEVVSRAEGEANRFTALRSEYVKAPEITRERM 298

Query: 309 YLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTK 347
           YL+ ME +L    KV++D  K + + YLPLN A +  Q +
Sbjct: 299 YLDAMEQVLSSNSKVVVDVNKTNNVLYLPLNGANAPSQKQ 338


>gi|126172809|ref|YP_001048958.1| HflK protein [Shewanella baltica OS155]
 gi|125996014|gb|ABN60089.1| HflK protein [Shewanella baltica OS155]
          Length = 379

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 110/342 (32%), Positives = 178/342 (52%), Gaps = 24/342 (7%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFD-----LIPFFKSYGSVYIILL 58
           +K N  W      G+ G  D  PP D++ + R +  +F      L   F S+ S+ IIL 
Sbjct: 8   NKGNDPW------GNKGGNDKGPP-DLDEVFRNLSKRFGGKGNGLGQSFSSF-SLIIILA 59

Query: 59  LIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIG 118
           +          Y +   ER V LRFGK   ++  PGLH     IDQ+  V +        
Sbjct: 60  VAVVVWGLSGFYTIKEAERGVALRFGKHAGEIG-PGLHWKATFIDQIYPVDI-------- 110

Query: 119 GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVV 178
            +S      SG +LT D+N+V +   V Y + D   YLF+  +   +L++ ++SA+R V+
Sbjct: 111 -QSVRSIPASGSMLTSDENVVKVELDVQYRILDAYSYLFSAVDANASLREATDSALRYVI 169

Query: 179 GRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQR 238
           G     DI  + R  I  +    +++ ++ YK G+ +  ++   A PP EV DAFD+   
Sbjct: 170 GHNKMDDILTTGRDAIRRDTWKELERILEPYKLGLAVVDVNFLPARPPEEVKDAFDDAIS 229

Query: 239 AEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYV 298
           A++DE RF+ E+  Y+  +   ARGE   + + + AYK+R + EA+G+  RF  +  +Y 
Sbjct: 230 AQEDEQRFIREAEAYAREIEPKARGEVERMAQQANAYKEREVLEARGKVARFELLLPEYQ 289

Query: 299 NAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
            AP + RKR+YL+TM+ ++    KV+ID K +  + YLPL++
Sbjct: 290 AAPDVTRKRLYLDTMQQVMTDTNKVLIDAKNNGNLMYLPLDK 331


>gi|188582025|ref|YP_001925470.1| HflK protein [Methylobacterium populi BJ001]
 gi|179345523|gb|ACB80935.1| HflK protein [Methylobacterium populi BJ001]
          Length = 379

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 120/342 (35%), Positives = 182/342 (53%), Gaps = 25/342 (7%)

Query: 27  PFDVEAIIRYIKDKFDLIPFFKSYGSVYIIL----LLIGSFCAFQSIYIVHPDERAVELR 82
           P D+E ++R  +D+   +     +G    IL    L++G++      YIV P+E  +   
Sbjct: 35  PPDLEDLLRRGQDRLRGVMPGGGFGGGKGILVAAGLVLGAWL-LTGFYIVKPNEVGINTI 93

Query: 83  FGKPKNDVFLPGLHMMF-WPIDQVEIVKV-IERQQKIGGRSASVGS------NSGLILTG 134
           FG+        GL   F +PI  V+   V I     IG  +A   +         L+LTG
Sbjct: 94  FGRYTGQSG-EGLRYNFPYPIGSVQKPNVGIVNSIPIGYINAGNTTRQRDVPEESLMLTG 152

Query: 135 DQNIVGLHFSVLYVVTDPRL--YLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQ 192
           D+NIV + F V + V   +   Y+FNL NP  T+K ++ESAMREV+GRR    I  +++ 
Sbjct: 153 DENIVDIDFEVQWRVNPLKAEDYVFNLANPDGTIKAIAESAMREVIGRRNIQAILTNEQS 212

Query: 193 QIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNK 252
            IA EV+ ++Q  +D Y +G+ I  + +   +PP EV  AF +V  A+Q   +   E+  
Sbjct: 213 SIAQEVKEIVQGALDEYGAGVRIEVVQLTSVTPPPEVRPAFIDVNAAQQYAQQVRNEAET 272

Query: 253 YSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLET 312
           Y++RV+  ARG AS + +++ AY+ +   EA G+A RF  +Y  Y  AP ++R+RI+LET
Sbjct: 273 YASRVVPEARGNASKVVQAAEAYRSQATSEATGQASRFRQVYDSYKVAPDVIRERIFLET 332

Query: 313 MEGILKKAKKVIIDKK--------QSVMPYLPLNEAFSRIQT 346
           ME +L    KVIID+           V+P LPL E   R QT
Sbjct: 333 MEKVLGSVNKVIIDQNGGVAGANSAGVLPVLPLMEN-GRTQT 373


>gi|330720973|gb|EGG99140.1| HflK protein [gamma proteobacterium IMCC2047]
          Length = 398

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 99/292 (33%), Positives = 167/292 (57%), Gaps = 13/292 (4%)

Query: 51  GSVYIILLLIGSFC--AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIV 108
           G   I  +L+G     A    Y +   ER V LR GK    V  PGL    + ID+V  V
Sbjct: 71  GGGLITFVLVGVLVLWAIAGFYTIDQQERGVVLRLGKYLETV-QPGLQWNPFLIDKVAKV 129

Query: 109 KVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
            V + +            + G +LT D+NIV +  +V Y+V++P+ +  N+++P  +L  
Sbjct: 130 NVTKVRSH---------ESRGTMLTEDENIVDVSLAVQYIVSNPKDFYLNVKDPELSLSH 180

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
            ++SA+R VVG      +    R+ +A++V+  +Q  +D Y +G+ I+ ++IE+A  PRE
Sbjct: 181 ATDSALRHVVGSSEMHGVLTEGREILAVDVQERLQDYIDSYGAGLRISKVNIENAQAPRE 240

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V  AFD+V +A +DE+R   E+  Y N ++  ARG A  + E + AYK ++I EAQG+A 
Sbjct: 241 VQAAFDDVIKAREDEERSKNEAETYRNGIVPEARGYAQRLLEEANAYKAQVIAEAQGDAS 300

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNE 339
           RF  +Y +Y  AP + R+R+Y++ ++ ++  + KV++D +  + M YLPL++
Sbjct: 301 RFTKLYEEYKKAPEVTRERLYIDALQKVMSTSSKVLVDVEGGNNMMYLPLDK 352


>gi|332284646|ref|YP_004416557.1| hypothetical protein PT7_1393 [Pusillimonas sp. T7-7]
 gi|330428599|gb|AEC19933.1| hypothetical protein PT7_1393 [Pusillimonas sp. T7-7]
          Length = 433

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 165/285 (57%), Gaps = 8/285 (2%)

Query: 71  IVHPDERAVELRFGKPKNDVFLPGLHM-MFWPIDQVEIVKVIE-RQQKIGGRSASVGS-- 126
           IV   + AV  +FGK       PGL   + +PI+  + V + + R  ++G R  +     
Sbjct: 100 IVQEGQVAVVTKFGK-YTKTLPPGLQWRLPYPIEAHQSVNIAQLRTFEVGYRGNARNKVL 158

Query: 127 NSGLILTGDQNIVGLHFSVLY--VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAV 184
              L+LT D+NIV L F V Y  +      YLF    P E+++Q +E+AMRE+VG++   
Sbjct: 159 PESLMLTTDENIVDLQFVVQYRLMPNGAPDYLFKTSQPDESVRQAAETAMREIVGKKPMD 218

Query: 185 DIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDED 244
            +  S R ++A EV+ L Q  +D Y++GI I+T++I++  PP +V  AFD+  +A QD +
Sbjct: 219 FVLYSGRTEVATEVQTLAQSILDRYQTGIQISTVAIQNVQPPEQVQAAFDDAVKAGQDRE 278

Query: 245 RFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLL 304
           R + E N Y+N+VL  A+G+ + + + +  YK  +I +A G+  RF SI  ++  AP + 
Sbjct: 279 RQINEGNAYANKVLPEAQGQVARMMQEAEGYKATVIGDATGDTARFTSIEAEFAKAPDIT 338

Query: 305 RKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQTKR 348
           R+R+YL TM+ IL+   K++ID + S  M YLPL++  ++    R
Sbjct: 339 RERMYLSTMQEILQNTSKIMIDSQASNNMLYLPLDKIMNQAAGDR 383


>gi|325917814|ref|ZP_08179996.1| protease FtsH subunit HflK [Xanthomonas vesicatoria ATCC 35937]
 gi|325535988|gb|EGD07802.1| protease FtsH subunit HflK [Xanthomonas vesicatoria ATCC 35937]
          Length = 340

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 98/283 (34%), Positives = 159/283 (56%), Gaps = 13/283 (4%)

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQ 114
           IL+ +     F S  ++   +R V LRFG+  + +  PG +    WPI+ V  V   E  
Sbjct: 13  ILVAVVLMVLFSSFQLIGEQQRGVVLRFGQ-FSRILQPGPNFKLPWPIESVRKVNATE-- 69

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
                      SN   +LT D+NIV +  +V Y ++DPR YLF   N    L+Q ++SA+
Sbjct: 70  -------IKTFSNQVPVLTRDENIVNVSLNVQYQISDPRKYLFGSRNADLVLEQAAQSAV 122

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           RE VGR   ++   + R  +A+  ++ +Q  +D Y +G+ +  +++ DA PP EV  AFD
Sbjct: 123 REQVGRS-DLNTVLNNRGPLAIASKDRLQLALDAYNTGLAVTGVTLPDARPPEEVKPAFD 181

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           EV  A+Q  +R + E+  Y+ +V+  ARG+ +  R  +  YK  +I +A+G+ADRF  + 
Sbjct: 182 EVNGAQQVRERLINEAQAYAAKVVPEARGQGARTRTGAEGYKQAVISKAEGDADRFTLLQ 241

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPL 337
            QY  AP + RKR++LET++ +L + +KVI    + V+ Y+PL
Sbjct: 242 EQYAGAPEVTRKRLWLETVQKVLSENRKVIGSDGRQVI-YVPL 283


>gi|289209103|ref|YP_003461169.1| HflK protein [Thioalkalivibrio sp. K90mix]
 gi|288944734|gb|ADC72433.1| HflK protein [Thioalkalivibrio sp. K90mix]
          Length = 406

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 109/297 (36%), Positives = 172/297 (57%), Gaps = 19/297 (6%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFG---KPKNDVFLPGLHMMFWPIDQVEIVKVI 111
           II L++     F   +I+   ER V LRFG   + KN    PG H+ + PI+++EIV V 
Sbjct: 81  IIALVVWLASGF---HIISEGERGVVLRFGAFQEVKNPG--PGWHLPY-PIERIEIVNV- 133

Query: 112 ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSE 171
           +  + I  R+        L+LTGD+NI+ +  +V Y + D   +LFN+ NP  T+  V E
Sbjct: 134 DNVRTIEHRA--------LMLTGDENIIDIDIAVQYRILDLVDFLFNVRNPDITVDHVME 185

Query: 172 SAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231
           SA+RE VGR     I    R +IA   R ++Q+++D Y +G+ +  +S++ A PP  V +
Sbjct: 186 SAIRERVGRSNLDFILGEGRGEIASSARVVMQESLDSYGAGVTVTAVSMQQAQPPEPVQE 245

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           AF +  RA +DE RF  E+  Y+N V+  ARG+A+ I E + AY+D++I  A G+A RF 
Sbjct: 246 AFADAIRAREDEVRFRNEAEAYANGVIPRARGQAARIIEEAEAYRDQVIARADGDASRFD 305

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQTK 347
            +  +Y   P + R R+YLE +E +L+ ++KV++D   S  +  LPL++ F    T+
Sbjct: 306 QLLVEYQQYPEVTRDRLYLEAVEAVLEDSRKVMLDVGSSNNLMMLPLDQLFRGTGTR 362


>gi|257094482|ref|YP_003168123.1| HflK protein [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
 gi|257047006|gb|ACV36194.1| HflK protein [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
          Length = 422

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 97/274 (35%), Positives = 156/274 (56%), Gaps = 4/274 (1%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE-RQQKIGGRSASVGS-- 126
           YIV   +  + L+FG+ K          + +PI   E+V V   R  +IG R +      
Sbjct: 92  YIVDASQVGLVLQFGRYKESTDSGLRWRLPYPIQSHELVNVSGVRTLEIGYRGSEKNKVL 151

Query: 127 NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDI 186
              L+LT D+NI+ + F+V Y++ DP  Y+F   +  + + QV+E+A+REVVG+     +
Sbjct: 152 KEALMLTDDENIINIQFAVQYILKDPVDYVFTNRHADDAVMQVAETAIREVVGKNKMDFV 211

Query: 187 FRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRF 246
               R  +A     L+Q+ +D YK+GILI+ +++++A PP +V  AFD+  +A QD +R 
Sbjct: 212 LYEGRDTVAANASKLMQEILDRYKTGILISKVTMQNAQPPEQVQAAFDDAVKASQDRERQ 271

Query: 247 VEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRK 306
             E   Y+N V+  ARG A+ + E +  YK R+I  A+G+A RF  I  +Y  AP + R 
Sbjct: 272 KNEGQAYANDVIPKARGTAARLTEEAEGYKKRVIATAEGDASRFRQINTEYAKAPEVTRS 331

Query: 307 RIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNE 339
           R+Y+ETM+ +     KV++D K Q  + YLPL++
Sbjct: 332 RMYIETMQQVYSNTSKVMVDAKGQGNLLYLPLDK 365


>gi|117619279|ref|YP_855469.1| HflK protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117560686|gb|ABK37634.1| HflK protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 383

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 114/348 (32%), Positives = 181/348 (52%), Gaps = 21/348 (6%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG-------SV 53
           M++++  ++ +     G+NG   G P  D++ ++R +  +F  +      G        +
Sbjct: 1   MAWNEPGNNGKDRDPWGNNGKNQGPP--DLDEMLRKVSRRFGGLLGGGKSGGGDVGKFGL 58

Query: 54  YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIER 113
            I L++          Y +   ER V LRFG+  ++V  PGL      ID+V  V V   
Sbjct: 59  SIALMVAVVVWVVSGFYTIREAERGVVLRFGEYSHNVD-PGLRWKPTFIDRVIPVDV--- 114

Query: 114 QQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESA 173
                  S      SG +LT D+N+V +   V Y V DP  YLF++ N  E+L Q ++SA
Sbjct: 115 ------ESVRSLPASGFMLTQDENVVRVEMDVQYRVVDPEQYLFSVTNADESLSQATDSA 168

Query: 174 MREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAF 233
           +R VVG     D+  + R+++  E   +I   ++ Y  G+ I  ++   A PP EV DAF
Sbjct: 169 LRYVVGHTRMDDVLTTGREKVRQETWQVIDSIIEPYHMGLQIVDVNFLPARPPEEVKDAF 228

Query: 234 DEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSI 293
           D+   A++DE RF+ E+  Y+  V   ARG+   + + + AYK +I+ +A+GE  RF  +
Sbjct: 229 DDAISAQEDEQRFIREAEAYAREVEPKARGQVKRLEQEAEAYKSQIVLKAKGEVARFNEL 288

Query: 294 YGQYVNAPTLLRKRIYLETMEGILKKAKKVIID--KKQSVMPYLPLNE 339
             QY  AP L R RIYLETME + ++A KV++D     + M YLPL++
Sbjct: 289 LPQYQAAPELTRDRIYLETMEELYQQANKVVVDMPAGNNSMIYLPLDK 336


>gi|322831158|ref|YP_004211185.1| HflK protein [Rahnella sp. Y9602]
 gi|321166359|gb|ADW72058.1| HflK protein [Rahnella sp. Y9602]
          Length = 432

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 97/270 (35%), Positives = 153/270 (56%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     IDQV  V V          S    + SG
Sbjct: 107 YTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDQVRAVNV---------ESVRELAASG 156

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YLF++ NP ++L Q ++SA+R V+G+     I   
Sbjct: 157 VMLTSDENVVRVEMNVQYRVTDPEAYLFSVANPDDSLSQATDSALRGVIGKYTMDKILTE 216

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  YK GI I  ++ + A PP EV  +FD    A + E + + E
Sbjct: 217 GRTTVRSDTQRVLEETIRPYKMGITIQDVNFQTARPPEEVKASFDNAIAAREREQQSIRE 276

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N++   A GEA  + E + AYKDR + EAQGE  RF  +  +Y  AP + R+R+Y
Sbjct: 277 AEAYANQIQPLANGEAQRLLEDAKAYKDRTVLEAQGEVARFSKLLPEYKAAPEITRERLY 336

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV++  K + +  LPL++
Sbjct: 337 IETMEKVLSHTRKVLVSDKGNNLMVLPLDQ 366


>gi|52840729|ref|YP_094528.1| protease subunit HflK [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|52627840|gb|AAU26581.1| HflK protein [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
          Length = 380

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 102/273 (37%), Positives = 156/273 (57%), Gaps = 10/273 (3%)

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQ 115
           +LL+     A   I+IV P E+AV LRFGK    V  PG H +   I   +IV  ++R  
Sbjct: 61  VLLIAFILWALSGIFIVDPAEQAVILRFGKYVETVG-PGPHWIPRFISS-KIVMNVDRVL 118

Query: 116 KIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMR 175
                     S S  +LT D+N+V +  +V Y + D   YLFN+ NP E+L+Q + SA+R
Sbjct: 119 DY--------SYSAQMLTSDENLVSVSLAVQYRINDLSEYLFNVANPEESLQQATSSALR 170

Query: 176 EVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDE 235
           +VVG      I    R+     V+  + KT++ YK+GILI  +S + A  P  V DAFD+
Sbjct: 171 QVVGTTTLDQIITEGREVWGGRVQETLTKTLESYKTGILIVNVSPQPARAPESVQDAFDD 230

Query: 236 VQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYG 295
             +A++DE RF E++  Y+ +V+  A G+AS I++ + AY  +++  AQGE   FL++  
Sbjct: 231 AIKAQEDEKRFKEQAYAYAAKVVPIAEGKASRIQQEAEAYSKQVVLRAQGEVAEFLALLP 290

Query: 296 QYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK 328
           QY  AP +  KR+YLE M+ ++ K+  +I+D K
Sbjct: 291 QYNAAPQVTAKRMYLEAMQKVMNKSSTIIVDSK 323


>gi|82701579|ref|YP_411145.1| HflK protein [Nitrosospira multiformis ATCC 25196]
 gi|82409644|gb|ABB73753.1| protease FtsH subunit HflK [Nitrosospira multiformis ATCC 25196]
          Length = 399

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 97/274 (35%), Positives = 160/274 (58%), Gaps = 4/274 (1%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE-RQQKIGGRSA--SVGS 126
           YIV+  +R + LRFGK            + +PI+ VE V V + R  +IG R+   S   
Sbjct: 81  YIVNEGQRGIVLRFGKYVESTQAGLRWHLPYPIEVVEPVNVSQVRTVEIGYRNNVRSKVL 140

Query: 127 NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDI 186
              L+LT D+NI+ + F+V Y++ +P  +LF   +P   + Q +E+A+RE++G+     +
Sbjct: 141 KESLMLTDDENIIDIQFAVQYILKNPEDFLFTNRDPENAVLQAAETAIREIIGKSKMDFV 200

Query: 187 FRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRF 246
               R+Q+A +   L+Q  +D YK GI I+ +++++A PP +V  AFD+  +A QD +R 
Sbjct: 201 LYEGREQVAAKATELMQDILDRYKIGIAISKVTMQNAQPPEQVQAAFDDAVKAGQDRERQ 260

Query: 247 VEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRK 306
             E   Y+N V+  A+G A+ + E +  YK R+I  ++GEA RF  +  +Y  AP + R 
Sbjct: 261 KNEGQAYANDVIPKAKGNAARLLEEAEGYKQRVIASSEGEASRFKQVLVEYSKAPGVTRD 320

Query: 307 RIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNE 339
           R+YL+ ME +L    KVI+D+K  + + YLPL++
Sbjct: 321 RLYLDMMEQVLSNTSKVIVDQKNGNNLLYLPLDK 354


>gi|303328308|ref|ZP_07358746.1| HflK protein [Desulfovibrio sp. 3_1_syn3]
 gi|302861638|gb|EFL84574.1| HflK protein [Desulfovibrio sp. 3_1_syn3]
          Length = 388

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 104/301 (34%), Positives = 172/301 (57%), Gaps = 28/301 (9%)

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPID-----QVEIVKVIERQQKIGGRSAS 123
           IYI++PDE+ V LRFGK +     PG H   WP+      + ++ +V+  + ++G RS  
Sbjct: 87  IYIINPDEQGVVLRFGKYER-TEGPGPHYA-WPVPIETVYKPQVTQVL--RSEVGFRS-- 140

Query: 124 VGSNSGL-------------ILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
           VG ++               +LTGD+NIV + FSV Y ++DP  YLFN+  P   ++  +
Sbjct: 141 VGQSATFQQGQVRTIPEEASMLTGDENIVNVQFSVQYKISDPVQYLFNVSAPAALVRNAA 200

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
           E+AMREV+G           + +I  E   L+Q+ ++ Y +GI +  + ++D  PP++V 
Sbjct: 201 EAAMREVIGNSQIDSAITDGKLKIQSEATQLLQQILNRYGAGIHVIAVQLQDVHPPQDVI 260

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
           +AF +V  A +D+ R + E+  Y N +L  ARG+A+ +R  + AY    ++ A+G+A RF
Sbjct: 261 EAFKDVASAREDKSRIINEAEAYRNELLPKARGQAAAMRNQAEAYSATRVRNAEGDASRF 320

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKA-KKVIIDKKQS--VMPYLPLNEAFSRIQTK 347
            ++  +Y  AP + ++R+Y ETME IL  A +KV++D   +   +PYLPL  + S  QT 
Sbjct: 321 DALRVEYEKAPKVTKQRLYYETMEDILAGAGEKVLMDGAAAARALPYLPL-PSLSAPQTP 379

Query: 348 R 348
           +
Sbjct: 380 K 380


>gi|261856597|ref|YP_003263880.1| HflK protein [Halothiobacillus neapolitanus c2]
 gi|261837066|gb|ACX96833.1| HflK protein [Halothiobacillus neapolitanus c2]
          Length = 378

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 98/287 (34%), Positives = 160/287 (55%), Gaps = 12/287 (4%)

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQKIGGRSASV 124
              IYI+   +R VEL+FGK   D    G H    +PI  V  V V E + K    ++  
Sbjct: 65  LSGIYIIDAGQRGVELQFGK-YTDTTRAGPHWHLPYPIGTVVKVNVDELRDKQLKMTS-- 121

Query: 125 GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAV 184
                  LT D+NIV +     ++VTDP  YLFN+ +P  TL  V +SA+REV+G +   
Sbjct: 122 -------LTNDENIVEVRIGSQFLVTDPVKYLFNVRDPDGTLSDVMQSAIREVIGSKKMD 174

Query: 185 DIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDED 244
           ++    R +I   VR+ +Q  +D Y +G+ + +++++D  PP  V  AF++  RA +DE 
Sbjct: 175 NVLTEGRAEIVSLVRDRMQNLLDGYDTGLKVQSVNLQDIQPPEAVQPAFEDAIRAREDEQ 234

Query: 245 RFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLL 304
           R++ E++ Y+N+V+  ARG A+ I E +  Y+ ++  EA G+A RF  +   Y  AP + 
Sbjct: 235 RYISEASAYANKVVPRARGAAAQILEQAKGYESKVTNEALGDASRFEQLLKSYKLAPDIA 294

Query: 305 RKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFSRIQTKREI 350
           R+R+YL+ + G+L K K +++D    + + YLPL    +R  + + I
Sbjct: 295 RERMYLDAVSGVLSKNKSIVVDSGSGNNVFYLPLGSNDARAPSGKAI 341


>gi|319794351|ref|YP_004155991.1| hflk protein [Variovorax paradoxus EPS]
 gi|315596814|gb|ADU37880.1| HflK protein [Variovorax paradoxus EPS]
          Length = 457

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 104/295 (35%), Positives = 172/295 (58%), Gaps = 9/295 (3%)

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
           G V  + +LI     F   +IV+  ++AV  +FG+ K+ V       + +PI + E+V  
Sbjct: 113 GLVAAVAVLIWLGTGF---FIVNEGQQAVVTQFGRYKSTVNAGFNWRLPYPIQRHEVVVT 169

Query: 111 IERQQKIGGRSA---SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
            + +    GR A   S G     +LT D+NIV + F+V Y +++ + +L+  ++P ET+ 
Sbjct: 170 TQIRSTDVGRDAIVRSTGLRESAMLTEDENIVEIKFAVQYRLSNAQAWLYESKSPAETIV 229

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS--P 225
           QV+ES++REVVG+         +R QIA  VR L+Q  +D YK G+ +  I+++     P
Sbjct: 230 QVAESSVREVVGKMKMDAALAEERDQIAPRVRQLMQTILDRYKIGVEVVGINLQQGGVRP 289

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           P +V  AFD+V +A Q+ +R   ++  Y+N+V+  A G +S ++E S AYK RI+ +AQG
Sbjct: 290 PEQVQAAFDDVLKAGQERERTKNDAQAYANQVVPLASGTSSRLKEESEAYKARIVAQAQG 349

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNE 339
           +A RF ++  +Y  AP + R R+Y + M+ I     KV++D KQ S + YLPL++
Sbjct: 350 DAGRFSAVLAEYQKAPQVTRDRMYTDAMQQIYASTTKVLVDTKQGSNLLYLPLDK 404


>gi|21230508|ref|NP_636425.1| integral membrane protease subunit [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66769498|ref|YP_244260.1| integral membrane protease subunit [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188992689|ref|YP_001904699.1| Putative integral membrane protease subunit HflK [Xanthomonas
           campestris pv. campestris str. B100]
 gi|21112077|gb|AAM40349.1| integral membrane protease subunit [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66574830|gb|AAY50240.1| integral membrane protease subunit [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167734449|emb|CAP52659.1| Putative integral membrane protease subunit HflK [Xanthomonas
           campestris pv. campestris]
          Length = 380

 Score =  170 bits (430), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 99/286 (34%), Positives = 162/286 (56%), Gaps = 16/286 (5%)

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVI 111
           V I ++L+  F +FQ   ++   +R V LRFG+  + +  PG      WPI+ V  V   
Sbjct: 52  VLIAVVLMVLFSSFQ---LIGEQQRGVVLRFGQ-FSRILQPGPSFKLPWPIESVRKVNAT 107

Query: 112 ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSE 171
           E             SN   +LT D+NIV +  +V Y ++DPR YLF   N    L+Q ++
Sbjct: 108 E---------IKTFSNQVPVLTRDENIVNVSLNVQYQISDPRKYLFGSRNADLVLEQAAQ 158

Query: 172 SAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231
           SA+RE VGR   ++   + R  +A+  ++ +Q  ++ Y +G+ +  +++ DA PP EV  
Sbjct: 159 SAVREQVGRS-DLNTVLNNRGPLAIASKDRLQAALNAYNTGLSVTGVTLPDARPPEEVKP 217

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           AFDEV  A+Q  +R + E+  Y+ +V+  ARG+ +  R  +  YK  +I +A+G+ADRF 
Sbjct: 218 AFDEVNGAQQVRERLINEAQAYAAKVVPEARGQGARTRTGAEGYKQAVISKAEGDADRFT 277

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPL 337
            +  QY  AP + RKR++LET++ +L + +KVI    + V+ Y+PL
Sbjct: 278 LLQEQYAGAPDVTRKRLWLETVQKVLSENRKVIGSDGRQVI-YVPL 322


>gi|91205987|ref|YP_538342.1| protease activity modulator HflK [Rickettsia bellii RML369-C]
 gi|91069531|gb|ABE05253.1| Protease activity modulator HflK [Rickettsia bellii RML369-C]
          Length = 336

 Score =  169 bits (429), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 97/303 (32%), Positives = 175/303 (57%), Gaps = 18/303 (5%)

Query: 49  SYGSVYIILLLIGSFCAF--QSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVE 106
           ++ +  IIL+ + SF  +    IY V   E A   RFG+     +  GL+       + E
Sbjct: 36  NFSTKTIILVALASFVLWLASGIYEVKEGEEAAVTRFGRFVRKGY-AGLNYRLPAPFEKE 94

Query: 107 IVKVIERQQKI------------GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRL 154
           IV+ +++ ++I            GG + ++   S ++LTGD+NIV L+  V++ +++   
Sbjct: 95  IVEKVKQSRRIEIGYRTNNFVRSGGDTKNIAGES-IMLTGDENIVALNCDVMWHISNLED 153

Query: 155 YLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGIL 214
           ++FN++ P ET+K   ESA+REV+G      +   Q+Q+I  ++  L QK +D Y +G++
Sbjct: 154 FMFNVQKPEETVKSTVESAVREVIGNTPISWVLSDQKQEITHKIETLAQKILDSYNAGVM 213

Query: 215 INTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIA 274
           I  + +  A PP EV DA+ +VQ ++ D+++ + ++  Y+N+VL  ARG A+ I E + A
Sbjct: 214 IEKVQLLKAEPPAEVIDAYRDVQTSKADKEKEINQAQAYNNKVLPEARGAAARIIEEAEA 273

Query: 275 YKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPY 334
           Y++ II +A+G++ RF +IY QY     + R R+YLE  E +L  + K II+   +++P+
Sbjct: 274 YREEIISKAEGDSQRFSAIYKQYAANKQVTRDRLYLEVAEEVLSGSNKTIIN--NALLPH 331

Query: 335 LPL 337
           + +
Sbjct: 332 MAI 334


>gi|27364696|ref|NP_760224.1| HflK protein [Vibrio vulnificus CMCP6]
 gi|37681253|ref|NP_935862.1| HflK protein [Vibrio vulnificus YJ016]
 gi|320155089|ref|YP_004187468.1| HflK protein [Vibrio vulnificus MO6-24/O]
 gi|27360841|gb|AAO09751.1| HflK protein [Vibrio vulnificus CMCP6]
 gi|37200004|dbj|BAC95833.1| HflK protein [Vibrio vulnificus YJ016]
 gi|319930401|gb|ADV85265.1| HflK protein [Vibrio vulnificus MO6-24/O]
          Length = 399

 Score =  169 bits (429), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 106/301 (35%), Positives = 165/301 (54%), Gaps = 17/301 (5%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           +I +L+  F  F   Y +   ER V LR GK  + +  PGL+     ID+V  V V    
Sbjct: 78  VIAVLVWVFAGF---YTIGEAERGVVLRLGK-YDRIVDPGLNWRPRFIDEVTPVNV---- 129

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
           Q I  RS     +SG +LT D+N+V +   V Y V DP  YLF + N  ++L+Q ++SA+
Sbjct: 130 QAI--RSLR---SSGTMLTKDENVVTVSMDVQYRVADPYKYLFRVTNADDSLRQATDSAL 184

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           R V+G      I  S RQQI    +  + + +D Y  G++I  ++ + A PP +V DAFD
Sbjct: 185 RAVIGDSLMDSILTSGRQQIRQSTQQTLNQIIDSYDMGLVIVDVNFQSARPPEQVKDAFD 244

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +   A +DE+RF+ E+  Y N +L  A G A  +++ +  Y +R I EA G+  +F  + 
Sbjct: 245 DAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYSERTINEALGQVAQFEKLL 304

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAF---SRIQTKREI 350
            +Y  AP + R R+YL+TME +     KV+ID + S  + YLP+++     S+  TKR+ 
Sbjct: 305 PEYQAAPKVTRDRLYLDTMEEVYSSTSKVLIDSESSGNLLYLPIDKLAGQDSQTDTKRKT 364

Query: 351 R 351
           +
Sbjct: 365 K 365


>gi|24372196|ref|NP_716238.1| hflK protein [Shewanella oneidensis MR-1]
 gi|24346105|gb|AAN53683.1|AE015507_9 hflK protein [Shewanella oneidensis MR-1]
          Length = 381

 Score =  169 bits (429), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 109/342 (31%), Positives = 181/342 (52%), Gaps = 23/342 (6%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFF---KSYGSVYIILLLI 60
           +K N  W      G+ G  D  PP D++ + R +  +F         ++  S  +I++L 
Sbjct: 8   NKGNDPW------GNKGGNDKGPP-DLDEVFRNLSKRFGGNGNGSSGQNLSSFSLIIILA 60

Query: 61  GSFCAF--QSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIG 118
            +F  +    +Y +   ER V LRFG+   +V  PGLH     ID++  V V        
Sbjct: 61  IAFVVWGLSGLYTIKEAERGVALRFGQHNGEVG-PGLHWKPTFIDEIYPVDV-------- 111

Query: 119 GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVV 178
            +S     +SG +LT D+N+V +   V Y ++D   YLF+  +   +L++ ++SA+R V+
Sbjct: 112 -QSVRSVPSSGSMLTSDENVVKVELDVQYRISDAYAYLFSAVDANASLREATDSALRYVI 170

Query: 179 GRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQR 238
           G     DI  + R  I  +    +++ ++ YK G+ I  ++   A PP EV DAFD+   
Sbjct: 171 GHNKMDDILTTGRDAIRRDTWKELERILEPYKLGLAIVDVNFLPARPPEEVKDAFDDAIS 230

Query: 239 AEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYV 298
           A++DE RF+ E+  Y+  +   ARGE   + + + AYK+R I EA+G+  RF  +  +Y 
Sbjct: 231 AQEDEQRFIREAEAYAREIEPKARGEVERMAQQANAYKEREILEARGKVARFELLLPEYQ 290

Query: 299 NAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
            AP + RKR+YL+ M+ ++    KVIID K +  + YLPL++
Sbjct: 291 AAPEVTRKRLYLDAMQQVMTDTNKVIIDAKNNGNLMYLPLDK 332


>gi|114773227|ref|ZP_01450462.1| HflK protein [alpha proteobacterium HTCC2255]
 gi|114546346|gb|EAU49255.1| HflK protein [alpha proteobacterium HTCC2255]
          Length = 391

 Score =  169 bits (428), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 104/295 (35%), Positives = 159/295 (53%), Gaps = 18/295 (6%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           +I+ +I  F      Y +   ER V LRFG+  N +  PGL      +DQV  + V    
Sbjct: 69  VIVWVISGF------YTIREAERGVVLRFGE-FNKLVDPGLQWKPTFVDQVIPIDV---- 117

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
                +S    S++G +LT D+N+V +   + Y V DP+ ++F++ NP ++L Q  +SA+
Sbjct: 118 -----QSIRDQSSAGSMLTEDENVVRVQMEMQYRVVDPKKFIFSVVNPEQSLSQALDSAI 172

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           R VVG     D+  S R+     V   +Q  ++ Y  G+ I  ++  DA PP EV DAFD
Sbjct: 173 RYVVGHSIMDDVLTSGREVTRQRVWEELQAIIEPYDMGVSIIDMNFRDARPPEEVKDAFD 232

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +   A++DE RF+ E+  Y+  +   ARG+ + + E + AYK R+  EAQGE  RF  + 
Sbjct: 233 DAIAAQEDEIRFIREAEAYAREIEPRARGQVNRMNEEASAYKQRVTLEAQGEIARFEELL 292

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ--SVMPYLPLNEAFSRIQTK 347
            QY  AP + R+RIYLETME +     K+++D +     M YLPL++   R  T 
Sbjct: 293 PQYEAAPEVTRQRIYLETMEELFSNTSKIMVDNQNGGGSMMYLPLDKIMDRQNTN 347


>gi|134094498|ref|YP_001099573.1| HflKC membrane-associated complex associates with HflC, part of
           modulator for protease specific for FtsH phage lambda
           cII repressor [Herminiimonas arsenicoxydans]
 gi|133738401|emb|CAL61446.1| protein HflK [Herminiimonas arsenicoxydans]
          Length = 431

 Score =  169 bits (428), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 159/291 (54%), Gaps = 8/291 (2%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP--IDQVEIVKVIE 112
           +I +++         +IV   +  V L FGK  +    P      WP  I   E V V +
Sbjct: 91  VIAVIVAFLWLVSGFFIVQEGQTGVVLTFGKYSH--MTPAGFNWRWPAPIQSHETVNVSQ 148

Query: 113 -RQQKIGGRSA--SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
            R  ++G R +  +      L+LT D+NI+ + F+V Y + +   ++FN    GE +KQV
Sbjct: 149 VRTVEVGYRGSVKNKQHQESLMLTEDENIIDIQFAVQYTLKNASDWVFNNREQGEMVKQV 208

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           +E+A+REVVGR     +    R++IA +   L+Q+ +D YK+G+ I  ++++   PP +V
Sbjct: 209 AETAIREVVGRSKMDFVLYEGREKIAFDTSQLMQQIVDRYKAGVQITNVTMQGVQPPEQV 268

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
             +FD+  +A QD +R   E   Y+N V+  ARG AS + E S AY+  +   AQGEA R
Sbjct: 269 QASFDDAVKAGQDRERQKNEGQAYANDVIPRARGAASRLMEESEAYRSSVTANAQGEASR 328

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNE 339
           F  +  +Y  AP + R R+YLETM+ I     KV++D K  + + YLPL++
Sbjct: 329 FKQVLVEYQKAPAVTRDRMYLETMQKIFSSTTKVMVDAKGGNNLIYLPLDK 379


>gi|67459560|ref|YP_247184.1| protease activity modulator HflK [Rickettsia felis URRWXCal2]
 gi|67005093|gb|AAY62019.1| Protease activity modulator HflK [Rickettsia felis URRWXCal2]
          Length = 346

 Score =  169 bits (427), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 101/311 (32%), Positives = 180/311 (57%), Gaps = 17/311 (5%)

Query: 41  FDLIPFFKSYGSVYIILLLIGSFCAF--QSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
           FD   F  ++ S  IIL ++     +    IY +   E A  +RFG+     + PGL+  
Sbjct: 37  FDKFQFQFNFNSKTIILAVVAVIALWLASGIYEIKEGEEAAVIRFGRFVRKGY-PGLNYH 95

Query: 99  F-WPIDQVEIVKVIE-RQQKIGGR---SASVGSNS-------GLILTGDQNIVGLHFSVL 146
              P +++ + KV + R+ +IG R   SA  GS++        ++LTGD+NIV L+  V+
Sbjct: 96  LPAPFEKIIVEKVKQSRRIEIGYRTNSSARSGSDNTKNIASESIMLTGDENIVALNCDVM 155

Query: 147 YVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTM 206
           + + +   ++FN++ P ET+K   ESA+REV+G      +   Q+Q+I  ++  L QK +
Sbjct: 156 WHINNLEDFIFNVQRPEETVKATVESAVREVIGNTPISWVLSDQKQEITYKIEKLAQKIL 215

Query: 207 DYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEAS 266
           D Y +G++I  + +  A PP EV DA+ +VQ ++ D+++ + ++  Y+N++L  ARG A+
Sbjct: 216 DSYNAGVMIEKVQLLKAEPPAEVIDAYRDVQTSKADKEKEINQAQAYNNKILPEARGAAA 275

Query: 267 HIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID 326
            I + +  YK+ +I +A+G++ RF +IY QY     + R R+YLE +E IL  + K II+
Sbjct: 276 KIIQEAEGYKEEVISKAEGDSQRFNAIYKQYTIGRQVTRDRLYLEVVEEILGGSNKTIIN 335

Query: 327 KKQSVMPYLPL 337
              +++P++ +
Sbjct: 336 --NALLPHMAI 344


>gi|260774595|ref|ZP_05883507.1| HflK protein [Vibrio metschnikovii CIP 69.14]
 gi|260610389|gb|EEX35596.1| HflK protein [Vibrio metschnikovii CIP 69.14]
          Length = 394

 Score =  169 bits (427), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 97/286 (33%), Positives = 158/286 (55%), Gaps = 11/286 (3%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           +I +L  +   F   Y +   ER V LR G+  + V  PGL+     ID+V  V +    
Sbjct: 72  VIAVLAVAIWFFSGFYTIGEAERGVVLRLGQ-YDRVVNPGLNWRPRFIDEVTPVNI---- 126

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
           Q I   SAS     G++LT D+N+V +   V Y + DP  YL+ + NP ++L Q ++SA+
Sbjct: 127 QAIRSLSAS-----GIMLTKDENVVNVAMDVQYRIVDPYKYLYRVVNPDDSLHQATDSAL 181

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           R V+G      I    RQQI    +  + + +D Y  G+L+  ++ + + PP +V DAFD
Sbjct: 182 RAVIGDSLMDSILTVGRQQIRQSTQQTLNQIIDDYDMGLLVVGVNFQSSRPPEQVKDAFD 241

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +   A +DE+RF+ E+  Y N +L  A G A  ++  ++ Y +RII EA G+  +F  + 
Sbjct: 242 DAIAAREDEERFIREAEAYMNEILPQATGRAERVKREALGYSERIINEAFGQVAQFEKLL 301

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
            +Y  AP + R R+YL+TME +   + K++ID + S  + YLP+++
Sbjct: 302 PEYQAAPEVTRNRMYLDTMEQVYTNSSKILIDSESSGNLLYLPIDK 347


>gi|121607077|ref|YP_994884.1| HflK protein [Verminephrobacter eiseniae EF01-2]
 gi|121551717|gb|ABM55866.1| HflK protein [Verminephrobacter eiseniae EF01-2]
          Length = 452

 Score =  169 bits (427), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 105/302 (34%), Positives = 169/302 (55%), Gaps = 7/302 (2%)

Query: 45  PFFKSYG-SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPID 103
           P  KS G  V +I  ++         +IV   ++AV  +FG  K+ V       + +PI+
Sbjct: 103 PDMKSAGVGVGLIAGIVFVIWMGTGFFIVQEGQQAVITQFGMYKSTVGAGFNWRLPYPIE 162

Query: 104 QVEIVKVIERQQKIGGRS---ASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
           + E+V V + + +  GR     S G     +LT D+NIV + F+V Y + D R +LF  +
Sbjct: 163 RHELVFVTQIRSEDVGRDNIIKSTGLRESAMLTADENIVEIKFAVQYRLNDARAWLFESK 222

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
           NP + + Q +E+A+REVVG+         +R QIA  VR L+Q  +D YK G+ +  I++
Sbjct: 223 NPRDAVVQAAETAVREVVGKMRMDTALAEERDQIAPRVRTLMQTILDRYKVGVEVVGINL 282

Query: 221 EDAS--PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
           +     PP +V  +FD+V +A Q+ +R   E+  Y+N V+  A G AS + E + AYK R
Sbjct: 283 QQGGVKPPEQVQASFDDVLKATQERERAKNEAQAYANDVIPRAVGSASRLSEEADAYKAR 342

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPL 337
           I+ +AQG+A RF S+  +Y  AP + R R+YL+ M+ +     KV+I+ +Q   + YLPL
Sbjct: 343 IVAQAQGDAQRFSSVLAEYQKAPQVTRDRMYLDAMQQVYGNVTKVLIESRQGTNLLYLPL 402

Query: 338 NE 339
           ++
Sbjct: 403 DK 404


>gi|15603999|ref|NP_220514.1| HFLK protein (hflK) [Rickettsia prowazekii str. Madrid E]
 gi|3860690|emb|CAA14591.1| HFLK PROTEIN (hflK) [Rickettsia prowazekii]
 gi|292571715|gb|ADE29630.1| Protease activity modulator HflK [Rickettsia prowazekii Rp22]
          Length = 344

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 99/311 (31%), Positives = 181/311 (58%), Gaps = 17/311 (5%)

Query: 41  FDLIPFFKSYGSVYIILLLIGSFCAF---QSIYIVHPDERAVELRFGKPKNDVFLPGLHM 97
           FD + F  ++ +  IIL  +G+         IY +   E A  +RFG+     + PGL+ 
Sbjct: 37  FDKLQFPFNFNTKTIILA-VGAMVILWLVSGIYEIKEGEEAAVIRFGRFVRKGY-PGLNY 94

Query: 98  MF-WPIDQVEIVKVIE-RQQKIGGRSASVGSNSG--------LILTGDQNIVGLHFSVLY 147
            F  P + + + KV + R+ +IG R+ S   + G        ++LTGD+NIV L+  V++
Sbjct: 95  HFPSPFENIIVEKVKQSRRIEIGYRTNSSMRSGGDKNIVSESIMLTGDENIVSLNCDVMW 154

Query: 148 VVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMD 207
            +++   ++FN++ P ET+K   ES++REV+G      +   Q+Q+I  ++  L QK +D
Sbjct: 155 HISNLEDFIFNVQRPEETVKATVESSIREVIGNTPISWVLSDQKQEITYKIEKLAQKILD 214

Query: 208 YYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH 267
            Y +G++I  + +  A PP EV DA+ +VQ ++ D+++ + ++  Y+N++L  ARG A+ 
Sbjct: 215 SYNAGVMIEKVQLLKAEPPSEVIDAYRDVQTSKADKEKEINQAQAYNNKILPEARGTAAK 274

Query: 268 IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDK 327
           I + +  Y++ +I +A+G++ RF +IY QY     + R R+YLE +E IL  + K II+ 
Sbjct: 275 IIQEAEGYREEVISKAEGDSQRFNAIYKQYATGRQVTRDRLYLEVVEEILGGSNKTIIN- 333

Query: 328 KQSVMPYLPLN 338
             +++P++ +N
Sbjct: 334 -NALLPHMLIN 343


>gi|220904139|ref|YP_002479451.1| HflK protein [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
 gi|219868438|gb|ACL48773.1| HflK protein [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
          Length = 387

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 103/304 (33%), Positives = 165/304 (54%), Gaps = 21/304 (6%)

Query: 52  SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQV---EI 107
           + ++I L +        IYI++PDE+ V LRFGK  N    PG H  +  PI+ V   ++
Sbjct: 72  AFFLIGLAVVGLWLLSGIYIINPDEQGVVLRFGK-YNRTEGPGPHYAWPAPIESVYKPQV 130

Query: 108 VKVIERQQKIGGRSASVG-----------SNSGLILTGDQNIVGLHFSVLYVVTDPRLYL 156
            +V+  + ++G RS               S    +LTGD+NIV + FSV Y + DP  YL
Sbjct: 131 TQVL--RSEVGFRSVGQSTTFQQGQVRTVSEEASMLTGDENIVNVQFSVQYKIGDPVQYL 188

Query: 157 FNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILIN 216
           FN+  P   ++  +E+AMREV+G           + +I  E   L+Q  +D Y +GI + 
Sbjct: 189 FNVSAPTALVRNAAEAAMREVIGNSQIDSAITDGKLKIQSEATQLLQTILDRYGAGIQVL 248

Query: 217 TISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYK 276
            + ++D  PP+EV DAF +V  A +D+ R + E+  Y N +L  ARG+A+ +   + +Y 
Sbjct: 249 AVQLQDVHPPQEVIDAFKDVASAREDKSRIINEAEAYRNELLPKARGQAAAMLNEAESYH 308

Query: 277 DRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKA-KKVIIDKKQS--VMP 333
              ++ A+GE  RF ++  ++  AP +  +R+Y ETME IL  A +KV++D   +   +P
Sbjct: 309 AVRVRTAEGETSRFDALSAEHRKAPKVTEQRLYYETMEDILAGADEKVLMDAPAASRALP 368

Query: 334 YLPL 337
           YL L
Sbjct: 369 YLNL 372


>gi|332530168|ref|ZP_08406116.1| HflK protein [Hylemonella gracilis ATCC 19624]
 gi|332040360|gb|EGI76738.1| HflK protein [Hylemonella gracilis ATCC 19624]
          Length = 492

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 106/284 (37%), Positives = 160/284 (56%), Gaps = 8/284 (2%)

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
           G +  I LLI     F   +IV   ++AV  +FG+  + V       + +PI + E+V V
Sbjct: 149 GLIASIALLIWLGTGF---FIVQEGQQAVVTQFGRYHSTVGAGFNWRLPYPIQRHELVFV 205

Query: 111 IERQQKIGGRSA---SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
            + +    GR     S G     +LT D+NIV + F+V Y + D R YLF   +P   + 
Sbjct: 206 TQIRSVDVGRDVVIRSTGLRESAMLTEDENIVEIKFAVQYRLNDARAYLFESRDPSAAVV 265

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS--P 225
           Q +E+A+REVVG+         +R QIA  +RNL+Q+ +D YK GI I  I+++     P
Sbjct: 266 QAAETAVREVVGKMKMDLALSEERDQIAPRLRNLMQQILDRYKVGIEIVGINLQQGGVRP 325

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           P +V  AFD+V +A Q+ +R   E+  Y+N V+  A G AS ++E S AYK RI+ +AQG
Sbjct: 326 PEQVQAAFDDVLKAGQERERLKNEAQAYANDVVPRAVGTASRLKEESEAYKARIVAQAQG 385

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ 329
           +A RF S+  +Y  AP + R R+Y+ETM+ I     KV+++ KQ
Sbjct: 386 DAQRFRSVLAEYQRAPQVTRDRLYIETMQEIYGNVTKVLVETKQ 429


>gi|296446924|ref|ZP_06888860.1| HflK protein [Methylosinus trichosporium OB3b]
 gi|296255599|gb|EFH02690.1| HflK protein [Methylosinus trichosporium OB3b]
          Length = 371

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 102/287 (35%), Positives = 157/287 (54%), Gaps = 19/287 (6%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ-----------QKIG 118
           Y V P+E  + + FGK +        + +  P+  V  + V +R             + G
Sbjct: 75  YTVGPNEVGLNMIFGKYRGKTQAGLNYNLPSPVGSVVKLAVTDRNAVDIGFREQPATRRG 134

Query: 119 GRSASVGSNSGLILTGDQNIVGLHFSVLYVV--TDPRLYLFNLENPGETLKQVSESAMRE 176
           G          L+LTGD+NI  + F V + +    P  + FN+ +P  T+K V+ESAMRE
Sbjct: 135 GPQTPDAPEESLMLTGDENIADVKFRVFWQIDPAKPEDFAFNVADPPATVKAVAESAMRE 194

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
           +VG+     I  + R+ I    + L+QK +D Y SG+L+  + +    PP  V  AF +V
Sbjct: 195 IVGQSQIQKILTADRKLIEPACQQLMQKVLDEYHSGVLVLQVLLLSVDPPASVIAAFRDV 254

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
             A+QD  R   E+  Y+NRV+  ARG ++ I + S AY+++++ EA+G+A RF  IY +
Sbjct: 255 TAAQQDLQRLGNEAEAYANRVVPEARGASARILQESEAYREQVVAEARGQASRFDQIYAE 314

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS------VMPYLPL 337
           Y  APT+ R+R+Y+ETME +L  A KVI+D+  S      V+PYLPL
Sbjct: 315 YKKAPTITRQRLYIETMERVLGGADKVILDETASGATSAGVVPYLPL 361


>gi|224826456|ref|ZP_03699558.1| HflK protein [Lutiella nitroferrum 2002]
 gi|224601557|gb|EEG07738.1| HflK protein [Lutiella nitroferrum 2002]
          Length = 404

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 102/297 (34%), Positives = 164/297 (55%), Gaps = 8/297 (2%)

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
           G V   L ++ +       Y+V   E  V LR G+  +         + +P ++VEIV +
Sbjct: 51  GGVGAALGVVVALWLASGFYVVDAREEGVVLRLGRYHHTAEAGLQWHLPYPFEKVEIVNL 110

Query: 111 IE-RQQKIGGRSASVG--SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL----ENPG 163
            E R  ++G R+++        L+LT DQNI+ +  SV Y V D R +LFN      +  
Sbjct: 111 TEVRSIEVGYRNSAKNRVPEESLMLTEDQNIIDVQLSVQYDVRDARAFLFNNATGDRDAK 170

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           + +KQ +E+A+RE+VGR     +    R QIA E + LIQ  +D Y  G+ I  ++I D 
Sbjct: 171 DIVKQAAETAIREIVGRNKVDFVLNEGRAQIAAETQRLIQSVVDRYALGVHIAKVNINDV 230

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP EV  AF++  +A QD+D+   E   Y+N V+  A G A+ + E + AYK R++  A
Sbjct: 231 QPPGEVQAAFEDAVKAGQDKDKLRNEGLAYANDVVPKAEGLAARLTEEAEAYKQRVVARA 290

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNE 339
           +G+A RF  +  +Y  AP ++R R+Y + M+ I+  + KV++D+K  S + YLPL++
Sbjct: 291 EGDAARFKQVLSEYNKAPKVMRDRLYFDMMQQIMTSSSKVLVDQKGGSNLLYLPLDK 347


>gi|124267178|ref|YP_001021182.1| hypothetical protein Mpe_A1989 [Methylibium petroleiphilum PM1]
 gi|124259953|gb|ABM94947.1| conserved hypothetical transmembrane protein [Methylibium
           petroleiphilum PM1]
          Length = 435

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 104/304 (34%), Positives = 165/304 (54%), Gaps = 13/304 (4%)

Query: 45  PFFKSYGSVYIILLLIGSFCAF----QSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF- 99
           P  +S G   I + LIG+  A        +IV   ++ V + FG+  + V   G    F 
Sbjct: 92  PDLRSAG---IGIGLIGAVVALIWLGSGFFIVQEGQQGVVMSFGRYSHTV-EAGFQWRFP 147

Query: 100 WPIDQVEIVKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYL 156
           +P    E+V V + +    GR++ V   G     +LT D+NIV + F+V Y + D + YL
Sbjct: 148 YPFQSAEVVNVTQLRSVEVGRNSVVQATGLRDSSMLTQDENIVDIRFTVQYRLKDSKDYL 207

Query: 157 FNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILIN 216
           F   N  E +   SESA+RE+VGR     +   QR  IA ++   IQ  +D  K+GILI+
Sbjct: 208 FENRNADEAVVLASESAVREIVGRSNMDSVLYEQRDAIATDLVKSIQAQLDRLKTGILIS 267

Query: 217 TISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYK 276
            ++++  +PP +V  AFD+  +A  D  RF  E   Y+N V+  A+G AS +RE +  YK
Sbjct: 268 NVNVQSVAPPEQVQAAFDDAVKAGADRSRFKNEGQAYANDVIPKAQGTASRLREEAEGYK 327

Query: 277 DRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYL 335
            R+I +A+G+A RF  +  +Y  AP + R R+Y++TM  +     K++I+ +  S + YL
Sbjct: 328 ARVIAQAEGDASRFKQVLTEYQKAPAVTRDRLYVDTMREVYSNVSKIMIESRTGSNLLYL 387

Query: 336 PLNE 339
           PL++
Sbjct: 388 PLDK 391


>gi|254516811|ref|ZP_05128869.1| HflK protein [gamma proteobacterium NOR5-3]
 gi|219674316|gb|EED30684.1| HflK protein [gamma proteobacterium NOR5-3]
          Length = 382

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 100/289 (34%), Positives = 169/289 (58%), Gaps = 14/289 (4%)

Query: 54  YIILLLIGSFC-AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE 112
           +I+LL   +   A   +Y +   ERAV LRFGK  +    PGL      ID V +V + +
Sbjct: 59  FIVLLFGAALVWALMGLYQIDEQERAVVLRFGK-YHSTARPGLQWNPPLIDDVILVNITK 117

Query: 113 RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
                  R+AS      ++LT D+NIV +  SV YV+ D + Y+  + +P  +L+Q ++S
Sbjct: 118 V------RAASFRE---IMLTQDENIVEVRMSVQYVIDDVKDYVLQVRDPENSLQQAAKS 168

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           A+R VVG      +    R +IA EV   +Q  +  Y +GI ++ ++++D+ PP +V  A
Sbjct: 169 ALRHVVGGMTMDLVLTEGRTRIATEVDERLQDYLTSYTTGIRLSAVNVDDSKPPSQVQAA 228

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           FD+V +A +DE+R   E+  Y+N ++  ARG+A    E + AY++++I  A+GEADRF +
Sbjct: 229 FDDVIKAREDEERVKNEAQSYANGIVPEARGQAQRQIEEASAYREQVIANAEGEADRFKN 288

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
           +  +Y  AP + R+R+YL+ ++ +L    K+++D +   +VM YLPL++
Sbjct: 289 LLAEYRKAPVVTRERLYLDAVQNVLTNTSKIMVDVEGGNNVM-YLPLDK 336


>gi|217076750|ref|YP_002334466.1| HflK protein [Thermosipho africanus TCF52B]
 gi|217036603|gb|ACJ75125.1| HflK protein [Thermosipho africanus TCF52B]
          Length = 309

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 104/295 (35%), Positives = 164/295 (55%), Gaps = 15/295 (5%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKV-IE 112
           II+L+  S   +Q    V P E A+   FGK  +    PG+H    +P     IV V   
Sbjct: 13  IIILIYLSIGVYQ----VGPSEVALIKTFGKYTHSTG-PGIHFHLPYPFQSHVIVDVETI 67

Query: 113 RQQKIGGRS-ASVGSNS-------GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGE 164
           R+++IG R+  S G  S        L+LTGD NI+ +  +V Y + DP  + FN+ N  E
Sbjct: 68  RKEEIGFRTIESYGKISYRTVNEEALMLTGDGNIISVEAAVQYRIKDPVKFAFNVINGKE 127

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
            ++  +ES +RE +  R   D+   +R +IALE    +Q+ +D Y SGILIN + +++ +
Sbjct: 128 LVRFTTESVLRERIAVRTIDDVLTVERDKIALETAEKVQEILDSYDSGILINKVYLQEVA 187

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  AFD+V  A+QD++RF+ E+ KY+N V+  A+G+A  I   + AY  + I EAQ
Sbjct: 188 PPDQVVAAFDDVNNAKQDKERFINEATKYANDVIPKAQGQAEKILREAEAYAQKKILEAQ 247

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           GE  RFLS+  +Y  AP + +KR+ LE ++ +    K + +      +  L +N+
Sbjct: 248 GETQRFLSVLKEYEIAPEITKKRLILEKLQSVFSSTKNIFVLDDSGTIKLLNVND 302


>gi|150020525|ref|YP_001305879.1| HflK protein [Thermosipho melanesiensis BI429]
 gi|149793046|gb|ABR30494.1| HflK protein [Thermosipho melanesiensis BI429]
          Length = 309

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 101/281 (35%), Positives = 158/281 (56%), Gaps = 11/281 (3%)

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKV-IERQQKIGGRS-ASVG 125
           +Y V P E A+   FGK  +    PG+H    +PI    IV V   R+++IG R+  S G
Sbjct: 23  VYQVGPSEVALIKTFGKYTHSTG-PGIHFHLPYPIQSHVIVDVETIRKEEIGFRTIESYG 81

Query: 126 SNS-------GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVV 178
             S        L+LTGD NI+ +  +V Y + DP  + FN+ N  + ++  +ES +RE V
Sbjct: 82  KISYRTINEEALMLTGDGNIISVEVAVQYKIKDPVKFAFNVINGRDIVRFTTESVLRERV 141

Query: 179 GRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQR 238
             R   D+    R +IA+E    +QK +D Y +GILIN + +++ +PP +V +AFD+V  
Sbjct: 142 AVRNIDDVLTVARDEIAIETAEQVQKILDEYDAGILINKVYLQEVAPPDQVVEAFDDVNN 201

Query: 239 AEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYV 298
           A+QD++RF+ E+N+Y+N ++  A GEA  I   + AY    I EA+GE  RFLS+  +Y 
Sbjct: 202 AKQDKERFINEANRYANDIVPKAEGEAQKILREAEAYAKEKILEAKGETQRFLSVLKEYE 261

Query: 299 NAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
            AP + +KR+ +E +E +    K V +      +  L +NE
Sbjct: 262 IAPDITKKRLLIERLEEVFSNTKNVFVLDDSGTLKLLDVNE 302


>gi|156972472|ref|YP_001443379.1| serine protease [Vibrio harveyi ATCC BAA-1116]
 gi|47933920|gb|AAT39526.1| HflK [Vibrio harveyi]
 gi|156524066|gb|ABU69152.1| hypothetical protein VIBHAR_00092 [Vibrio harveyi ATCC BAA-1116]
          Length = 401

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 100/288 (34%), Positives = 157/288 (54%), Gaps = 14/288 (4%)

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE 112
           + +I + +  F  F   Y +   ER V LR GK  + +  PGL+     ID+ E V V  
Sbjct: 78  IAVIAIAVWFFAGF---YTIGEAERGVVLRLGK-YDRIVDPGLNWRPRFIDEYEAVNV-- 131

Query: 113 RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
             Q I    AS     GL+LT D+N+V +   V Y V DP  YL+ + N  ++L+Q ++S
Sbjct: 132 --QAIRSLRAS-----GLMLTKDENVVTVAMDVQYRVADPYKYLYRVTNADDSLRQATDS 184

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           A+R V+G      I  S RQQI    +  + + +D Y  GI+I  ++ + A PP +V DA
Sbjct: 185 ALRAVIGDSLMDSILTSGRQQIRQTTQETLNQIIDSYDMGIVIVDVNFQSARPPEQVKDA 244

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           FD+   A +DE+RF+ E+  Y N +L  A G A  +++ +  Y +R+  EA G+  +F  
Sbjct: 245 FDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNERVTNEALGQVAQFEK 304

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
           +  +Y  AP + R R+YL+TME +     KV+ID + S  + YLP+++
Sbjct: 305 LLPEYQAAPGVTRDRLYLDTMEEVYSSTSKVLIDSESSGNLLYLPIDK 352


>gi|310779295|ref|YP_003967628.1| HflK protein [Ilyobacter polytropus DSM 2926]
 gi|309748618|gb|ADO83280.1| HflK protein [Ilyobacter polytropus DSM 2926]
          Length = 329

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 104/298 (34%), Positives = 161/298 (54%), Gaps = 27/298 (9%)

Query: 40  KFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
           KF  +P       +  I LL G       +++V PDE A  L FGK +     PG++  F
Sbjct: 26  KFIFVP-------ILFIYLLTG-------VFVVGPDEEAAILLFGKYQKTAG-PGINWYF 70

Query: 100 WPIDQVEIVKVIERQQ---KIGGRSASVGS--------NSGLILTGDQNIVGLHFSVLYV 148
            P+     +KV   +    ++G R+ S G            LILTGD+NI+ + FSV Y 
Sbjct: 71  -PVPIASRIKVKTTKVYRVEVGFRTVSPGPPAKYKDMREESLILTGDENILDVDFSVQYK 129

Query: 149 VTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDY 208
           +TD + YLFNL +P +T+K  SES+MR++VG+    +     +  I ++ R  +Q+ +  
Sbjct: 130 ITDLKKYLFNLGDPYKTIKDASESSMRQIVGKYNIDETLTEGKSNIQMQTREKLQEILKK 189

Query: 209 YKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHI 268
           Y SGI +  + ++D  PP EV  AF +V  A +D  R++ E+N Y N ++  ARGEA  +
Sbjct: 190 YDSGITVLNVQLQDVQPPEEVVQAFKDVASAREDRIRYINEANGYRNDIIPKARGEAFKV 249

Query: 269 RESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID 326
              +  YK++ ++E+QG+  RFL +Y  Y     + + R+YLE +E  LK   KVIID
Sbjct: 250 LNDAEGYKEKRVKESQGDVVRFLKLYENYKLGKEVTKTRLYLENLERNLKDVDKVIID 307


>gi|153835427|ref|ZP_01988094.1| HflK [Vibrio harveyi HY01]
 gi|148868032|gb|EDL67217.1| HflK [Vibrio harveyi HY01]
          Length = 400

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 100/288 (34%), Positives = 157/288 (54%), Gaps = 14/288 (4%)

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE 112
           + +I + +  F  F   Y +   ER V LR GK  + +  PGL+     ID+ E V V  
Sbjct: 77  IAVIAIAVWFFAGF---YTIGEAERGVVLRLGK-YDRIVDPGLNWRPRFIDEYEAVNV-- 130

Query: 113 RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
             Q I    AS     GL+LT D+N+V +   V Y V DP  YL+ + N  ++L+Q ++S
Sbjct: 131 --QAIRSLRAS-----GLMLTKDENVVTVAMDVQYRVADPYKYLYRVTNADDSLRQATDS 183

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           A+R V+G      I  S RQQI    +  + + +D Y  GI+I  ++ + A PP +V DA
Sbjct: 184 ALRAVIGDSLMDSILTSGRQQIRQTTQETLNQIIDSYDMGIVIVDVNFQSARPPEQVKDA 243

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           FD+   A +DE+RF+ E+  Y N +L  A G A  +++ +  Y +R+  EA G+  +F  
Sbjct: 244 FDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNERVTNEALGQVAQFEK 303

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
           +  +Y  AP + R R+YL+TME +     KV+ID + S  + YLP+++
Sbjct: 304 LLPEYQAAPGVTRDRLYLDTMEEVYSSTSKVLIDSESSGNLLYLPIDK 351


>gi|153827317|ref|ZP_01979984.1| hflK protein [Vibrio cholerae MZO-2]
 gi|149738783|gb|EDM53125.1| hflK protein [Vibrio cholerae MZO-2]
          Length = 395

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 157/291 (53%), Gaps = 14/291 (4%)

Query: 50  YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVK 109
           +G +  I + +  F  F   Y +   ER V LR GK  + +  PGL+     ID+V  V 
Sbjct: 71  FGVIAAIAVAVWFFTGF---YTIGEAERGVVLRLGK-YDRIVDPGLNWRPRFIDEVTPVN 126

Query: 110 VIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
           V    Q I    AS     GL+LT D+N+V +   V Y + DP  YL+ + N  ++L+Q 
Sbjct: 127 V----QAIRSLRAS-----GLMLTKDENVVTVSMDVQYRIADPYKYLYRVTNADDSLRQA 177

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           ++SA+R VVG      I  S RQQI    +  + + +D Y  G++I  ++ + A PP +V
Sbjct: 178 TDSALRAVVGDSLMDSILTSGRQQIRQSTQQTLNQVIDSYDMGLMIVDVNFQSARPPEQV 237

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
            DAFD+   A +DE+RF+ E+  Y N +L  A G A  +++ +  Y +R I EA G+  +
Sbjct: 238 KDAFDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNERTINEALGQVAQ 297

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
           F  +  +Y  AP + R R+YL+ ME +     KV+ID + S  + YLP+++
Sbjct: 298 FEKLLPEYQAAPKVTRDRLYLDAMEQVYSNTSKVLIDSESSGNLLYLPIDK 348


>gi|51473322|ref|YP_067079.1| protease activity modulator protein HflK [Rickettsia typhi str.
           Wilmington]
 gi|51459634|gb|AAU03597.1| protease activity modulator protein HflK [Rickettsia typhi str.
           Wilmington]
          Length = 344

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 98/310 (31%), Positives = 180/310 (58%), Gaps = 15/310 (4%)

Query: 41  FDLIPFFKSYGSVYIILLLIGSFCAF--QSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
           FD + F  ++ +  IIL +      +    IY +   E A  +RFG+     + PGL+  
Sbjct: 37  FDKLQFPFNFNTKTIILAVTAIVILWLASGIYEIKEGEEAAVIRFGRFVRKGY-PGLNYH 95

Query: 99  F-WPIDQVEIVKVIE-RQQKIGGRSASVGSNSG--------LILTGDQNIVGLHFSVLYV 148
           F  P + + + KV + R+ +IG R+ S   + G        ++LTGD+NIV L+  V++ 
Sbjct: 96  FPSPFENIIVEKVKQSRRIEIGYRTNSSLRSGGDKNIIGESIMLTGDENIVSLNCDVMWH 155

Query: 149 VTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDY 208
           +++   ++FN++ P ET+K   ES++REV+G      +   Q+Q+I  ++  L QK +D 
Sbjct: 156 ISNLEDFIFNVQRPEETVKATVESSVREVIGNTPISWVLSDQKQEITYKIEKLAQKILDS 215

Query: 209 YKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHI 268
           Y +G++I  + +  A PP EV DA+ +VQ ++ D+++ + ++  Y+N++L  ARG A+ I
Sbjct: 216 YNAGVMIEKVQLLKAEPPSEVIDAYRDVQTSKADKEKEINQAQAYNNKILPEARGTAAKI 275

Query: 269 RESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK 328
            + +  Y++ +I +A+G++ RF +IY QY     + R R+YLE +E IL  + K II+  
Sbjct: 276 IQEAEGYREEVISKAEGDSQRFNAIYKQYATGRQVTRDRLYLEVVEEILGGSNKTIIN-- 333

Query: 329 QSVMPYLPLN 338
            +++P++ +N
Sbjct: 334 NALLPHMLIN 343


>gi|91775940|ref|YP_545696.1| HflK protein [Methylobacillus flagellatus KT]
 gi|91709927|gb|ABE49855.1| protease FtsH subunit HflK [Methylobacillus flagellatus KT]
          Length = 391

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 113/336 (33%), Positives = 173/336 (51%), Gaps = 36/336 (10%)

Query: 19  NGNGDGLPPFDVEAIIRYIKDKFD------------------LIPFFKSYGSVYIILLLI 60
           N N DG P  D++ + R    K                     IP   + G V +I    
Sbjct: 9   NRNNDGPP--DLDEVFRQFSRKLSGLFGKGGGTGGEPNPEARTIPVLPALGLVAVIWFAT 66

Query: 61  GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE-RQQKIG 118
           G        YIV    R V LRFGK   +  +PG      +PI+ V +V + + R  ++G
Sbjct: 67  G-------FYIVDQGSRGVVLRFGK-HVETTMPGPRWHLPYPIESVTVVNMEQVRTIEVG 118

Query: 119 GRSASVGSNSG------LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
            RSA  GS  G      L+LT D+NI+ L F+V Y + +    LFN     E+++ ++E+
Sbjct: 119 YRSAEGGSTRGRELRESLMLTDDENIIDLQFAVQYNLKNVEETLFNNRFAEESVRGIAET 178

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           A+RE+VG+          R++IA+  + L+Q+ +D Y +GI I  +++++A PP +V  A
Sbjct: 179 AIREIVGKSKMDFALYEGREEIAVLAKQLMQEILDRYSTGINIVNVTMQNAQPPEQVQAA 238

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           FD+  +A QD +R   E   Y+N V+  ARG AS + E +  YK R+  EA+G A RF  
Sbjct: 239 FDDAVKAGQDLERQKNEGYAYANDVIPRARGTASRLLEEAEGYKLRVENEARGNASRFEQ 298

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK 328
           I  QY  AP + R+R+YL+  E I+    KV++D+K
Sbjct: 299 ILTQYQRAPEVTRQRLYLDAQEQIMSSVSKVVVDQK 334


>gi|254467782|ref|ZP_05081188.1| HflK protein [beta proteobacterium KB13]
 gi|207086592|gb|EDZ63875.1| HflK protein [beta proteobacterium KB13]
          Length = 415

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 110/306 (35%), Positives = 172/306 (56%), Gaps = 18/306 (5%)

Query: 44  IPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPI 102
           IP       V++I LL G        YIV    R V LRFG+   DV  PG      +PI
Sbjct: 68  IPLLPILLIVFLIWLLTG-------FYIVDQGSRGVVLRFGE-HIDVTQPGPRWHLPYPI 119

Query: 103 DQVEIVKVIE-RQQKIGGRSAS-VGSNS-----GLILTGDQNIVGLHFSVLYVVTDPRLY 155
           + VEIV   + R  ++G RS++ + +NS      L+LTGD+NIV L F+V Y +     +
Sbjct: 120 ETVEIVNQEQVRTIEVGYRSSNDLAANSQELRESLMLTGDENIVDLQFAVQYNLKSVEDF 179

Query: 156 LFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILI 215
           +FN      +++  SE+A+REVVG+     +    R+++A+  + L+Q+ +D Y +GI I
Sbjct: 180 IFNNRAAETSVRAASETAIREVVGKSEMDFVLYEGREEVAIRTKELMQQILDRYSTGINI 239

Query: 216 NTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAY 275
            ++++++A PP +V  AFD+  +A+QD +R   E   Y+N V+  A+G A+ +   + AY
Sbjct: 240 TSVTMQNAQPPEQVQAAFDDAVKAKQDLERQKNEGQAYANDVVPKAKGTAARLLAEANAY 299

Query: 276 KDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMP 333
           K  I  EA G + RF  I  +Y  AP + + R++LE  E IL    KVIID+K   + + 
Sbjct: 300 KVSIENEALGNSSRFEQIMKEYERAPEVTKNRLFLEAQEEILSNVTKVIIDQKSGSNSLI 359

Query: 334 YLPLNE 339
           YLPL++
Sbjct: 360 YLPLDQ 365


>gi|297582277|ref|ZP_06944191.1| hflK protein [Vibrio cholerae RC385]
 gi|297533496|gb|EFH72343.1| hflK protein [Vibrio cholerae RC385]
          Length = 395

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 157/291 (53%), Gaps = 14/291 (4%)

Query: 50  YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVK 109
           +G +  I + +  F  F   Y +   ER V LR GK  + +  PGL+     ID+V  V 
Sbjct: 71  FGVIAAIAVAVWFFTGF---YTIGEAERGVVLRLGK-YDRIVDPGLNWRPRFIDEVTPVN 126

Query: 110 VIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
           V    Q I    AS     GL+LT D+N+V +   V Y + DP  YL+ + N  ++L+Q 
Sbjct: 127 V----QAIRSLRAS-----GLMLTKDENVVTVSMDVQYRIADPYKYLYRVTNADDSLRQA 177

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           ++SA+R VVG      I  S RQQI    +  + + +D Y  G++I  ++ + A PP +V
Sbjct: 178 TDSALRAVVGDSLMDSILTSGRQQIRQSTQQTLNQVIDSYDMGLMIVDVNFQSARPPEQV 237

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
            DAFD+   A +DE+RF+ E+  Y N +L  A G A  +++ +  Y +R I EA G+  +
Sbjct: 238 KDAFDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNERTINEALGQVAQ 297

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
           F  +  +Y  AP + R R+YL+ ME +     KV+ID + S  + YLP+++
Sbjct: 298 FEKLLPEYQAAPKVTRDRLYLDAMEQVYSNTSKVLIDSESSGNLLYLPIDK 348


>gi|15640376|ref|NP_230003.1| hflK protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121591396|ref|ZP_01678678.1| hflK protein [Vibrio cholerae 2740-80]
 gi|121729706|ref|ZP_01682148.1| hflK protein [Vibrio cholerae V52]
 gi|147675327|ref|YP_001218618.1| hflK protein [Vibrio cholerae O395]
 gi|153217193|ref|ZP_01950957.1| hflK protein [Vibrio cholerae 1587]
 gi|153803485|ref|ZP_01958071.1| hflK protein [Vibrio cholerae MZO-3]
 gi|153820452|ref|ZP_01973119.1| hflK protein [Vibrio cholerae NCTC 8457]
 gi|153823718|ref|ZP_01976385.1| hflK protein [Vibrio cholerae B33]
 gi|153830887|ref|ZP_01983554.1| hflK protein [Vibrio cholerae 623-39]
 gi|227080561|ref|YP_002809112.1| hflK protein [Vibrio cholerae M66-2]
 gi|229506855|ref|ZP_04396363.1| HflK protein [Vibrio cholerae BX 330286]
 gi|229508659|ref|ZP_04398153.1| HflK protein [Vibrio cholerae B33]
 gi|229512373|ref|ZP_04401848.1| HflK protein [Vibrio cholerae TMA 21]
 gi|229516041|ref|ZP_04405492.1| HflK protein [Vibrio cholerae RC9]
 gi|229519942|ref|ZP_04409373.1| HflK protein [Vibrio cholerae TM 11079-80]
 gi|229526913|ref|ZP_04416316.1| HflK protein [Vibrio cholerae bv. albensis VL426]
 gi|229526987|ref|ZP_04416383.1| HflK protein [Vibrio cholerae 12129(1)]
 gi|229606369|ref|YP_002877017.1| HflK protein [Vibrio cholerae MJ-1236]
 gi|254227110|ref|ZP_04920662.1| hflK protein [Vibrio cholerae V51]
 gi|254292141|ref|ZP_04962913.1| hflK protein [Vibrio cholerae AM-19226]
 gi|254851660|ref|ZP_05241010.1| hflK protein [Vibrio cholerae MO10]
 gi|262147187|ref|ZP_06027992.1| HflK protein [Vibrio cholerae INDRE 91/1]
 gi|262166925|ref|ZP_06034645.1| HflK protein [Vibrio cholerae RC27]
 gi|298501249|ref|ZP_07011047.1| hflK protein [Vibrio cholerae MAK 757]
 gi|20138381|sp|Q9KV09|HFLK_VIBCH RecName: Full=Protein HflK
 gi|9654765|gb|AAF93522.1| hflK protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121546755|gb|EAX56928.1| hflK protein [Vibrio cholerae 2740-80]
 gi|121628557|gb|EAX61039.1| hflK protein [Vibrio cholerae V52]
 gi|124113776|gb|EAY32596.1| hflK protein [Vibrio cholerae 1587]
 gi|124120986|gb|EAY39729.1| hflK protein [Vibrio cholerae MZO-3]
 gi|125620365|gb|EAZ48747.1| hflK protein [Vibrio cholerae V51]
 gi|126509004|gb|EAZ71598.1| hflK protein [Vibrio cholerae NCTC 8457]
 gi|126518765|gb|EAZ75988.1| hflK protein [Vibrio cholerae B33]
 gi|146317210|gb|ABQ21749.1| hflK protein [Vibrio cholerae O395]
 gi|148873621|gb|EDL71756.1| hflK protein [Vibrio cholerae 623-39]
 gi|150421940|gb|EDN13915.1| hflK protein [Vibrio cholerae AM-19226]
 gi|227008449|gb|ACP04661.1| hflK protein [Vibrio cholerae M66-2]
 gi|227012205|gb|ACP08415.1| hflK protein [Vibrio cholerae O395]
 gi|229335510|gb|EEO00991.1| HflK protein [Vibrio cholerae 12129(1)]
 gi|229336082|gb|EEO01101.1| HflK protein [Vibrio cholerae bv. albensis VL426]
 gi|229343070|gb|EEO08057.1| HflK protein [Vibrio cholerae TM 11079-80]
 gi|229346944|gb|EEO11911.1| HflK protein [Vibrio cholerae RC9]
 gi|229350588|gb|EEO15533.1| HflK protein [Vibrio cholerae TMA 21]
 gi|229354294|gb|EEO19223.1| HflK protein [Vibrio cholerae B33]
 gi|229355960|gb|EEO20879.1| HflK protein [Vibrio cholerae BX 330286]
 gi|229369024|gb|ACQ59447.1| HflK protein [Vibrio cholerae MJ-1236]
 gi|254847365|gb|EET25779.1| hflK protein [Vibrio cholerae MO10]
 gi|262024630|gb|EEY43311.1| HflK protein [Vibrio cholerae RC27]
 gi|262031368|gb|EEY49977.1| HflK protein [Vibrio cholerae INDRE 91/1]
 gi|297540003|gb|EFH76066.1| hflK protein [Vibrio cholerae MAK 757]
          Length = 395

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 157/291 (53%), Gaps = 14/291 (4%)

Query: 50  YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVK 109
           +G +  I + +  F  F   Y +   ER V LR GK  + +  PGL+     ID+V  V 
Sbjct: 71  FGVIAAIAVAVWFFTGF---YTIGEAERGVVLRLGK-YDRIVDPGLNWRPRFIDEVTPVN 126

Query: 110 VIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
           V    Q I    AS     GL+LT D+N+V +   V Y + DP  YL+ + N  ++L+Q 
Sbjct: 127 V----QAIRSLRAS-----GLMLTKDENVVTVSMDVQYRIADPYKYLYRVTNADDSLRQA 177

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           ++SA+R VVG      I  S RQQI    +  + + +D Y  G++I  ++ + A PP +V
Sbjct: 178 TDSALRAVVGDSLMDSILTSGRQQIRQSTQQTLNQVIDSYDMGLMIVDVNFQSARPPEQV 237

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
            DAFD+   A +DE+RF+ E+  Y N +L  A G A  +++ +  Y +R I EA G+  +
Sbjct: 238 KDAFDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNERTINEALGQVAQ 297

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
           F  +  +Y  AP + R R+YL+ ME +     KV+ID + S  + YLP+++
Sbjct: 298 FEKLLPEYQAAPKVTRDRLYLDAMEQVYSNTSKVLIDSESSGNLLYLPIDK 348


>gi|290473403|ref|YP_003466269.1| FtsH phage lambda cII repressor protease [Xenorhabdus bovienii
           SS-2004]
 gi|289172702|emb|CBJ79473.1| with HflC, part of modulator for protease specific for FtsH phage
           lambda cII repressor [Xenorhabdus bovienii SS-2004]
          Length = 414

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 98/274 (35%), Positives = 154/274 (56%), Gaps = 10/274 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V +R GK  + V  PGL+     ID+V  V V          S    + SG
Sbjct: 92  YTIKETERGVVIRLGK-FSHVVQPGLNWKMTFIDRVRAVNV---------ESVRELATSG 141

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V    +V Y VTDP  YLFN+ +P  +L Q ++SA+R VVG+     I  +
Sbjct: 142 VMLTSDENVVRAEMNVQYRVTDPAAYLFNVTSPDNSLSQATDSAVRGVVGKYTMEKILTA 201

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  Y  GI +  ++ + A PP EV  AFD+V  A ++E + + E
Sbjct: 202 DRTIVRNDTQKVLEETIRPYNMGITLLDVNFQTARPPEEVQVAFDDVIAAREEEQKTIRE 261

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y N VL  A+G+A  + E + AYK  ++  AQGE   F  I  +Y  AP + R+R+Y
Sbjct: 262 AESYKNAVLPMAKGDAQRMIEDARAYKVSVVLNAQGEVASFAKILPEYKAAPEITRERLY 321

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSR 343
           +ETME +L   +KVI ++K + M  LPL++ F +
Sbjct: 322 IETMEYVLSNTRKVIANEKSNNMLVLPLDQVFRK 355


>gi|171463410|ref|YP_001797523.1| HflK protein [Polynucleobacter necessarius subsp. necessarius
           STIR1]
 gi|171192948|gb|ACB43909.1| HflK protein [Polynucleobacter necessarius subsp. necessarius
           STIR1]
          Length = 498

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 96/315 (30%), Positives = 168/315 (53%), Gaps = 18/315 (5%)

Query: 41  FDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM-MF 99
           F+    F S  S+ I   ++         +I+   +  V L FGK  +    PG++  M 
Sbjct: 123 FNFSNPFDSKASILIAGAIVFFMWVCSGFFIIQEGQAGVILTFGK-YDYTAKPGINWRMP 181

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVG---------SNSGLILTGDQNIVGLHFSVLYVVT 150
           WPI   E V +       G RS  VG              +LT D+NI+ + F+V Y + 
Sbjct: 182 WPIQSEETVNLS------GVRSVEVGRPVLIKATNQKDSSMLTEDENIIDVRFAVQYRLK 235

Query: 151 DPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYK 210
           DP  YLFN  +P   + Q +E+A+RE+V R     +    R++I +++ N IQK +D YK
Sbjct: 236 DPTDYLFNNRDPEAAVVQAAETAVREIVARSKMDTVLYEGREKIGVDLANSIQKILDSYK 295

Query: 211 SGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRE 270
           +GI + ++++++  PP +V  AFD+  +A QD++R   E   Y+N ++  A+G A+ + +
Sbjct: 296 TGIYVTSVTVQNVQPPEQVQAAFDDAVKAGQDQERLKSEGQAYANDIIPRAKGTAARLIQ 355

Query: 271 SSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQ 329
            +  YK R++  A+G+A RF  +  +Y  AP + R R+Y+++M  I     K+++D  K 
Sbjct: 356 EAEGYKARVVATAEGDATRFKQVLVEYSKAPQVTRDRMYIDSMREIYNNVTKILVDTTKS 415

Query: 330 SVMPYLPLNEAFSRI 344
           + + YLPL++  +++
Sbjct: 416 NSLLYLPLDKIVAQV 430


>gi|114048918|ref|YP_739468.1| HflK protein [Shewanella sp. MR-7]
 gi|113890360|gb|ABI44411.1| HflK protein [Shewanella sp. MR-7]
          Length = 381

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 113/343 (32%), Positives = 176/343 (51%), Gaps = 25/343 (7%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKF------DLIPFFKSYGSVYIIL 57
           +K N  W      G+ G  D  PP D++ + R +  +F           F S+ SV IIL
Sbjct: 8   NKGNDPW------GNKGGNDKGPP-DLDEVFRNLSKRFGGKGNGSSGQNFSSF-SVIIIL 59

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
            +          Y +   ER V LRFG+   +V  PGLH     IDQ+  V V       
Sbjct: 60  AIAFVVWGLSGFYTIKEAERGVALRFGQHIGEVG-PGLHWKATFIDQIYPVDV------- 111

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
             +S      SG +LT D+N+V +   V Y + D   YLF+  +   +L++ ++SA+R V
Sbjct: 112 --QSVRSIPASGSMLTSDENVVKVELDVQYRILDAYSYLFSAVDANASLREATDSALRYV 169

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           +G     DI  + R  I  +    +++ ++ YK G+ I  ++   A PP EV DAFD+  
Sbjct: 170 IGHNKMDDILTTGRDTIRRDTWKELERIIEPYKLGLAIVDVNFLPARPPEEVKDAFDDAI 229

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
            A++DE RF+ E+  Y+  V   ARGE   + + + AYK+R + EA+G+  RF  +  +Y
Sbjct: 230 AAQEDEQRFIREAEAYAREVEPKARGEVERMAQQANAYKEREVLEARGKVARFELLLPEY 289

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
             AP + RKR+YL+ M+ ++    KV+ID K S  + YLPL++
Sbjct: 290 QAAPEVTRKRLYLDAMQQVMTDTNKVLIDTKNSGNLMYLPLDK 332


>gi|113968944|ref|YP_732737.1| HflK protein [Shewanella sp. MR-4]
 gi|113883628|gb|ABI37680.1| HflK protein [Shewanella sp. MR-4]
          Length = 381

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 113/343 (32%), Positives = 176/343 (51%), Gaps = 25/343 (7%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKF------DLIPFFKSYGSVYIIL 57
           +K N  W      G+ G  D  PP D++ + R +  +F           F S+ SV IIL
Sbjct: 8   NKGNDPW------GNKGGNDKGPP-DLDEVFRNLSKRFGGKGNGSSGQNFSSF-SVIIIL 59

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
            +          Y +   ER V LRFG+   +V  PGLH     IDQ+  V V       
Sbjct: 60  AIAFVVWGLSGFYTIKEAERGVALRFGQHIGEVG-PGLHWKATFIDQIYPVDV------- 111

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
             +S      SG +LT D+N+V +   V Y + D   YLF+  +   +L++ ++SA+R V
Sbjct: 112 --QSVRSIPASGSMLTSDENVVKVELDVQYRILDAYSYLFSAVDANASLREATDSALRYV 169

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           +G     DI  + R  I  +    +++ ++ YK G+ I  ++   A PP EV DAFD+  
Sbjct: 170 IGHNKMDDILTTGRDAIRRDTWKELERIIEPYKLGLAIVDVNFLPARPPEEVKDAFDDAI 229

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
            A++DE RF+ E+  Y+  V   ARGE   + + + AYK+R + EA+G+  RF  +  +Y
Sbjct: 230 AAQEDEQRFIREAEAYAREVEPKARGEVERMAQQANAYKEREVLEARGKVARFELLLPEY 289

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
             AP + RKR+YL+ M+ ++    KV+ID K S  + YLPL++
Sbjct: 290 QAAPEVTRKRLYLDAMQQVMTDTNKVLIDTKNSGNLMYLPLDK 332


>gi|262401559|ref|ZP_06078126.1| HflK protein [Vibrio sp. RC586]
 gi|262352274|gb|EEZ01403.1| HflK protein [Vibrio sp. RC586]
          Length = 396

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 100/287 (34%), Positives = 155/287 (54%), Gaps = 11/287 (3%)

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVG 125
           F   Y +   ER V LR GK  + +  PGL+     ID+V  V V    Q I    AS  
Sbjct: 84  FTGFYTIGEAERGVVLRLGK-YDRIVDPGLNWRPRFIDEVTPVNV----QAIRSLRAS-- 136

Query: 126 SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVD 185
              GL+LT D+N+V +   V Y ++DP  YL+ + N  ++L+Q ++SA+R VVG      
Sbjct: 137 ---GLMLTKDENVVTVSMDVQYRISDPYKYLYQVTNADDSLRQATDSALRAVVGDSLMDS 193

Query: 186 IFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDR 245
           I  S RQQI    +  + + +D Y  G++I  ++ + A PP +V DAFD+   A +DE+R
Sbjct: 194 ILTSGRQQIRQSTQQTLNQIIDSYDMGLMIVDVNFQSARPPEQVKDAFDDAIAAREDEER 253

Query: 246 FVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLR 305
           F+ E+  Y N +L  A G A  +++ +  Y +R I EA G+  +F  +  +Y  AP + R
Sbjct: 254 FIREAEAYKNEILPKATGRAERLKKEAQGYNERTINEALGQVAQFEKLLPEYQAAPKVTR 313

Query: 306 KRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQTKREIR 351
            R+YL+ ME +     KV+ID + S  + YLP+++   +   K E R
Sbjct: 314 DRLYLDAMEEVYSNTSKVLIDSESSGNLLYLPIDKLAGQDSKKAEPR 360


>gi|145300252|ref|YP_001143093.1| hflK protein [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142853024|gb|ABO91345.1| hflK protein [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 384

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 113/347 (32%), Positives = 181/347 (52%), Gaps = 20/347 (5%)

Query: 1   MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG------SVY 54
           M++++  ++ +     G+NG   G P  D++ ++R +  +F  +      G       + 
Sbjct: 3   MAWNEPGNNGKDRDPWGNNGKNQGPP--DLDEMLRKVSRRFGGLLGGGKSGGEMGRFGLS 60

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           I L++          Y +   ER V LRFG+  ++V  PGL      ID+V  V V    
Sbjct: 61  IALVVAVVVWVVSGFYTIREAERGVVLRFGEYSHNVD-PGLRWKPTFIDRVIPVDV---- 115

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
                 S      SG +LT D+N+V +   V Y V DP  YLF++ N  E+L Q ++SA+
Sbjct: 116 -----ESVRSLPASGFMLTQDENVVRVEMDVQYRVVDPEQYLFSVTNADESLGQATDSAL 170

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           R VVG     D+  + R+++  E   +I   ++ Y+ G+ I  ++   A PP EV DAFD
Sbjct: 171 RYVVGHTRMDDVLTTGREKVRQETWQVIDGIIEPYQMGLQIVDVNFLPARPPEEVKDAFD 230

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +   A++DE RF+ E+  Y+  V   ARG    + + +  YK +I+ +A+GE  RF  + 
Sbjct: 231 DAISAQEDEQRFIREAEAYAREVEPKARGSVKRLEQEAEGYKSQIVLKAKGEVARFNELL 290

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIID--KKQSVMPYLPLNE 339
            QY  AP L R+RIYLETME + ++A KV++D     + M YLPL++
Sbjct: 291 PQYQAAPELTRERIYLETMEELYQQANKVLVDMPAGNNSMIYLPLDK 337


>gi|261209770|ref|ZP_05924076.1| HflK protein [Vibrio sp. RC341]
 gi|260841186|gb|EEX67696.1| HflK protein [Vibrio sp. RC341]
          Length = 396

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 100/287 (34%), Positives = 154/287 (53%), Gaps = 11/287 (3%)

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVG 125
           F   Y +   ER V LR GK  + +  PGL+     ID+V  V V    Q I    AS  
Sbjct: 84  FTGFYTIGEAERGVVLRLGK-YDRIVDPGLNWRPRFIDEVTPVNV----QAIRSLRAS-- 136

Query: 126 SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVD 185
              GL+LT D+N+V +   V Y + DP  YL+ + N  ++L+Q ++SA+R VVG      
Sbjct: 137 ---GLMLTKDENVVTVSMDVQYRIADPYKYLYQVTNADDSLRQATDSALRAVVGDSLMDS 193

Query: 186 IFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDR 245
           I  S RQQI    +  + + +D Y  G++I  ++ + A PP +V DAFD+   A +DE+R
Sbjct: 194 ILTSGRQQIRQSTQQTLNQIIDSYDMGLMIVDVNFQSARPPEQVKDAFDDAIAAREDEER 253

Query: 246 FVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLR 305
           F+ E+  Y N +L  A G A  +++ +  Y +R I EA G+  +F  +  +Y  AP + R
Sbjct: 254 FIREAEAYKNEILPKATGRAERLKKEAQGYNERTINEALGQVAQFEKLLPEYQAAPKVTR 313

Query: 306 KRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQTKREIR 351
            R+YL+ ME +     KV+ID + S  + YLP+++   +   K E R
Sbjct: 314 DRLYLDAMEEVYSNTSKVLIDSESSGNLLYLPIDKLAGQDSNKAEPR 360


>gi|33152817|ref|NP_874170.1| HflK protein [Haemophilus ducreyi 35000HP]
 gi|33149042|gb|AAP96559.1| HflK protein [Haemophilus ducreyi 35000HP]
          Length = 401

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 103/299 (34%), Positives = 163/299 (54%), Gaps = 14/299 (4%)

Query: 52  SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI 111
           ++ I   L+     F   Y V   ER V  RFGK  + + +PGL+     IDQV I   I
Sbjct: 79  AIVIFSALVWGASGF---YTVQEAERGVVTRFGK-LHQIVMPGLNWKPTFIDQV-IPINI 133

Query: 112 ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSE 171
           ER  ++           G +LT D+N+V +  +V Y V DP  Y F++ N  ++LKQ ++
Sbjct: 134 ERVSEL--------KTQGSMLTQDENMVQVEMTVQYRVEDPAKYKFSVRNADDSLKQATD 185

Query: 172 SAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231
           SA+R V+G     DI    R  +  +    +++ +  Y  G+L+  ++ + A PP EV D
Sbjct: 186 SALRYVIGHMSMDDILTKGRATVREKTWETLREIIKTYDMGLLVTDVNFQSARPPEEVKD 245

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           AFD+  +A++DE R + E+  Y+      ARG+A  I E + AYK++I+ EAQG+  RF 
Sbjct: 246 AFDDAIKAQEDEQRLIREAEAYARGREPLARGQAQRIIEQATAYKEQIVLEAQGDIQRFS 305

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTKREI 350
            +  +Y  AP ++R+R+Y+ETME ++K   K+I+D   + +  LPL E F    T  E+
Sbjct: 306 KLLPEYQAAPAVMRERLYIETMEKVMKNTPKIIMDSNSNNVNVLPL-EKFLGKTTASEV 363


>gi|89901078|ref|YP_523549.1| HflK protein [Rhodoferax ferrireducens T118]
 gi|89345815|gb|ABD70018.1| HflK protein [Rhodoferax ferrireducens T118]
          Length = 464

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 101/276 (36%), Positives = 163/276 (59%), Gaps = 6/276 (2%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSA---SVGS 126
           +IV   ++AV  +FGK ++ V       + +PI + E+V V + +    GR     + G 
Sbjct: 143 FIVQEGQQAVITQFGKYRSTVGAGFNWRLPYPIQRHELVFVTQIRSVDVGRDTIIKATGL 202

Query: 127 NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDI 186
               +LT D+NIV + F+V Y + D R +LF  ++P   + Q +E+++REVVG+      
Sbjct: 203 RESAMLTQDENIVEIKFAVQYRLNDARAFLFESKDPTAAVVQAAETSVREVVGKMRMDSA 262

Query: 187 FRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS--PPREVADAFDEVQRAEQDED 244
              +R QIA  VR L+QK +D YK GI +  ++++ +   PP +V  AFD+V +A Q+ +
Sbjct: 263 LAEERDQIAPRVRALMQKILDRYKVGIEVVGVNLQQSGVRPPEQVQAAFDDVLKAGQERE 322

Query: 245 RFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLL 304
           R   E+  Y+N V+  A G AS ++E + AYK RI+ +AQG+A RF S+  +Y  AP + 
Sbjct: 323 RAKNEAQAYANDVVPRAIGSASRLKEEADAYKARIVAQAQGDAQRFRSVLTEYQKAPQVT 382

Query: 305 RKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNE 339
           R R+Y++TM+ I     KV+ID +Q S + YLPL++
Sbjct: 383 RDRMYVDTMQQIYSSVTKVMIDSRQGSNLLYLPLDK 418


>gi|33519559|ref|NP_878391.1| HflK protein [Candidatus Blochmannia floridanus]
 gi|33517222|emb|CAD83604.1| HflK protein [Candidatus Blochmannia floridanus]
          Length = 440

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 101/291 (34%), Positives = 163/291 (56%), Gaps = 13/291 (4%)

Query: 42  DLIPFFKSYGS--VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF 99
           +L PFFK      V+ IL++I  + A   +Y +   ER V LRFG+    V  PGL+   
Sbjct: 62  NLKPFFKKTQLFIVFSILIVIIVW-ACSGLYTIKEAERGVILRFGQYHCLVH-PGLN--- 116

Query: 100 WPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNL 159
           W    V++V        +  +S    + SG++LT D+N++ +  +V Y VTDP+ YLFN+
Sbjct: 117 WKPTFVDVV------IPVNVKSVRELAASGMMLTSDENVIRVEMNVQYRVTDPKNYLFNV 170

Query: 160 ENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS 219
            N  ++L+Q ++SA+R V+G+     I    R  +  + R +++KT+  Y  GI +  ++
Sbjct: 171 TNADDSLRQATDSALRGVIGKYNMDRILTEGRTVVRSDTRRILEKTIQPYNMGISLLDVN 230

Query: 220 IEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRI 279
            + A PP EV  AFD+   A ++E +++ E+  Y+N +   A G+A  I E   AYK R 
Sbjct: 231 FQTARPPEEVKAAFDDAIAARENEQQYIREAEAYANEIQPKANGKAQRILEEGRAYKART 290

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS 330
           I EA+GE  RFL +  +Y  AP + R+R+Y+ +ME I    +K+ ID K +
Sbjct: 291 ILEARGEVQRFLKVLPEYRVAPEITRERLYINSMERIFSNTRKIFIDSKNT 341


>gi|269961404|ref|ZP_06175768.1| hflK protein [Vibrio harveyi 1DA3]
 gi|269833781|gb|EEZ87876.1| hflK protein [Vibrio harveyi 1DA3]
          Length = 401

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 99/288 (34%), Positives = 157/288 (54%), Gaps = 14/288 (4%)

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE 112
           + +I + +  F  F   Y +   ER V LR GK  + +  PGL+     ID+ E V V  
Sbjct: 78  IAVIAIAVWFFAGF---YTIGEAERGVVLRLGK-YDRIVDPGLNWRPRFIDEYEAVNV-- 131

Query: 113 RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
             Q I    AS     GL+LT D+N+V +   V Y V DP  YL+ + N  ++L+Q ++S
Sbjct: 132 --QAIRSLRAS-----GLMLTKDENVVTVAMDVQYRVADPYKYLYRVTNADDSLRQATDS 184

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           A+R V+G      I  S RQQI    +  + + +D Y  GI+I  ++ + A PP +V DA
Sbjct: 185 ALRAVIGDSLMDSILTSGRQQIRQTTQETLNQIIDSYDMGIVIVDVNFQSARPPEQVKDA 244

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           FD+   A +DE+RF+ E+  Y N +L  A G A  +++ +  Y +R+  EA G+  +F  
Sbjct: 245 FDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNERVTNEALGQVAQFEK 304

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
           +  +Y+ AP + R R+YL+ ME +     KV+ID + S  + YLP+++
Sbjct: 305 LLPEYLAAPGVTRDRLYLDAMEEVYSSTSKVLIDSESSGNLLYLPIDK 352


>gi|285017450|ref|YP_003375161.1| integral membrane protease subunit hflk protein [Xanthomonas
           albilineans GPE PC73]
 gi|283472668|emb|CBA15173.1| probable integral membrane protease subunit hflk protein
           [Xanthomonas albilineans]
          Length = 379

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 165/294 (56%), Gaps = 14/294 (4%)

Query: 46  FFKSYGSVYIILLLIGSFCA-FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPID 103
            F   G +   +L + +    F S  ++   +R V LRFG+  + + LPG +    WPI+
Sbjct: 43  LFGDGGGIGRWVLGVAAVALLFSSFQLIGEQQRGVVLRFGQ-FSRILLPGPNFKLPWPIE 101

Query: 104 QVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
            V         +K+         +   +LTGD+NIV +  +V Y V DPR Y+F   +  
Sbjct: 102 TV---------RKVDATRIKTFDSQLPVLTGDENIVNVSLNVQYRVEDPRTYVFGTRDAD 152

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           + L+Q ++SA+RE VG    ++   + R  +A+  R+ +Q  +  Y +G+++  +++ DA
Sbjct: 153 QVLQQAAQSAVREQVGHS-DLNTVLNNRGPMAVAARDRLQVALKAYHTGLIVTGLTLPDA 211

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP  V  AFDEV  A+Q ++R + E+  Y+ +V+  ARG+A+  R  +   KD  I  A
Sbjct: 212 RPPEAVKSAFDEVNGAQQVKERLINEAQAYAAKVVPEARGQAARTRTVAEGDKDAAIARA 271

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPL 337
           QG+ADRF  +  QY NAP + RKR++LET++ +L +++KVI  + + ++ YLP+
Sbjct: 272 QGDADRFTLLQQQYQNAPEVTRKRLWLETLQQVLAESRKVIGGEARPMI-YLPM 324


>gi|197287179|ref|YP_002153051.1| HflK protein [Proteus mirabilis HI4320]
 gi|194684666|emb|CAR46604.1| HflK protein (putative regulator of FtsH protease) [Proteus
           mirabilis HI4320]
          Length = 424

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 101/291 (34%), Positives = 160/291 (54%), Gaps = 12/291 (4%)

Query: 51  GSVYIILLL--IGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIV 108
           G+V + L L  +    A    Y +   E+ V  RFGK    +  PGL+     ID+V+ V
Sbjct: 79  GNVLVSLALGAVVVVWAASGFYTIKEAEQGVVTRFGK-FYQIVEPGLNWKPTFIDEVQPV 137

Query: 109 KVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
            V         ++    +  G++LT D+N+V +  +V YVV+DP  +LFN+  P  +L Q
Sbjct: 138 NV---------KTIRDLTTGGMMLTSDENMVQVEINVQYVVSDPEAFLFNVTTPMNSLGQ 188

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
            ++SA+R V+GR     I  S R +I  + R  +++T+  YK GI I  ++ + A PP  
Sbjct: 189 ATDSAVRGVIGRSEMEKILTSNRSEIRDQTRQELEETIRPYKMGISIVDVNFQVARPPEA 248

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V  AFD+V  A ++E + + ++  Y N VL  A+G A  + E + AYK  ++ +A+GE  
Sbjct: 249 VKAAFDDVIAAREEEQKTIRQAEAYKNEVLPLAKGNAQRMIEEATAYKTSVVMKAEGEVA 308

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
            F  I  +Y  AP + R+R+Y+ETME +L K +KVI + K + M  LPL +
Sbjct: 309 SFAKILPEYRAAPEITRERLYIETMEKVLSKTRKVIANDKGNSMLVLPLEQ 359


>gi|227357126|ref|ZP_03841495.1| HflK protein (regulator of FtsH protease) [Proteus mirabilis ATCC
           29906]
 gi|227162658|gb|EEI47625.1| HflK protein (regulator of FtsH protease) [Proteus mirabilis ATCC
           29906]
          Length = 424

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 101/291 (34%), Positives = 160/291 (54%), Gaps = 12/291 (4%)

Query: 51  GSVYIILLL--IGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIV 108
           G+V + L L  +    A    Y +   E+ V  RFGK    +  PGL+     ID+V+ V
Sbjct: 79  GNVLVSLALGAVVVVWAASGFYTIKEAEQGVVTRFGK-FYQIVEPGLNWKPTFIDEVQPV 137

Query: 109 KVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
            V         ++    +  G++LT D+N+V +  +V YVV+DP  +LFN+  P  +L Q
Sbjct: 138 NV---------KTIRDLTTGGMMLTSDENMVQVEINVQYVVSDPEAFLFNVTTPMNSLGQ 188

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
            ++SA+R V+GR     I  S R +I  + R  +++T+  YK GI I  ++ + A PP  
Sbjct: 189 ATDSAVRGVIGRSEMEKILTSNRSEIRDQTRQELEETIRPYKMGISIVDVNFQVARPPEA 248

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V  AFD+V  A ++E + + ++  Y N VL  A+G A  + E + AYK  ++ +A+GE  
Sbjct: 249 VKAAFDDVIAAREEEQKTIRQAEAYKNEVLPLAKGNAQRMIEEATAYKTSVVMKAEGEVA 308

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
            F  I  +Y  AP + R+R+Y+ETME +L K +KVI + K + M  LPL +
Sbjct: 309 SFAKILPEYRAAPEITRERLYIETMEKVLSKTRKVIANDKGNSMLVLPLEQ 359


>gi|258623501|ref|ZP_05718503.1| hflK protein [Vibrio mimicus VM573]
 gi|262172553|ref|ZP_06040231.1| HflK protein [Vibrio mimicus MB-451]
 gi|258584213|gb|EEW08960.1| hflK protein [Vibrio mimicus VM573]
 gi|261893629|gb|EEY39615.1| HflK protein [Vibrio mimicus MB-451]
          Length = 395

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 155/287 (54%), Gaps = 11/287 (3%)

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVG 125
           F   Y +   ER V LR GK  + +  PGL+     ID+V  V V    Q I    AS  
Sbjct: 84  FTGFYTIGEAERGVVLRLGK-YDRIVDPGLNWRPRFIDEVTPVNV----QAIRSLRAS-- 136

Query: 126 SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVD 185
              GL+LT D+N+V +   V Y ++DP  YL+ + N  ++L+Q ++SA+R V+G      
Sbjct: 137 ---GLMLTKDENVVTVSMDVQYRISDPYKYLYQVTNADDSLRQATDSALRAVIGDSLMDS 193

Query: 186 IFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDR 245
           I  S RQQI    +  + + +D Y  G++I  ++ + A PP +V DAFD+   A +DE+R
Sbjct: 194 ILTSGRQQIRQSTQQTLNQIIDSYDMGLMIVDVNFQSARPPEQVKDAFDDAIAAREDEER 253

Query: 246 FVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLR 305
           F+ E+  Y N +L  A G A  +++ +  Y +R I EA G+  +F  +  +Y  AP + R
Sbjct: 254 FIREAEAYKNEILPKATGRAERLKKEAQGYNERTINEALGQVAQFEKLLPEYQAAPKVTR 313

Query: 306 KRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQTKREIR 351
            R+YL+ ME +     KV+ID + S  + YLP+++   +   K E R
Sbjct: 314 DRLYLDAMEEVYSNTSKVLIDSESSGNLLYLPIDKLAGQDSKKAEPR 360


>gi|54401358|gb|AAV34452.1| predicted membrane protease subunit [uncultured proteobacterium
           RedeBAC7D11]
          Length = 380

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 112/334 (33%), Positives = 181/334 (54%), Gaps = 28/334 (8%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLI----------PFFKSYGSVYIILLLIGSFCAF 66
           G N N    PP D++ +I+  + + + I             K   S+ I ++L+ S    
Sbjct: 17  GRNNN----PPPDIDELIKKFRAQINSIFGGGSGSGGGGIKKILPSILIAIVLLYSVFG- 71

Query: 67  QSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGS 126
             IY V   E AV LRFGK  +    PG+H     ID   IV      +K+   +    +
Sbjct: 72  --IYTVDAQEEAVILRFGK-YSTTKGPGIHWNPPFIDNRFIVNT----EKLFTHT----T 120

Query: 127 NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDI 186
           NS + LT D+NIV +  +V Y  ++P  +L     P ++L Q SE+ +R VVG       
Sbjct: 121 NSSM-LTKDENIVNVEVAVQYKRSNPVFFLLEASAPEDSLAQASEAELRHVVGSATMDST 179

Query: 187 FRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRF 246
               R+QIA++V++ +Q  +D YK+GI +  +SI ++ PP  V +AFD+V +A +DE R 
Sbjct: 180 LTVGREQIAMDVKSRLQTRLDTYKTGIEVVAVSIRESRPPDAVKEAFDDVVKAREDEVRL 239

Query: 247 VEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRK 306
             E+  Y+N V+  ARGEA    E +  YK ++I EA+GEA RF  +  +Y  +P + R+
Sbjct: 240 RNEAETYANEVVPIARGEAKRAVEDAEGYKQKVISEAEGEASRFDQLLVEYSKSPEVTRQ 299

Query: 307 RIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNE 339
           R+YL+ ++ ++  + KV+ID K+ + + YLPL++
Sbjct: 300 RLYLDAVQSVMNSSTKVMIDVKEGNNILYLPLDQ 333


>gi|300721492|ref|YP_003710767.1| hypothetical protein XNC1_0459 [Xenorhabdus nematophila ATCC 19061]
 gi|297627984|emb|CBJ88533.1| with HflC, part of modulator for protease specific for FtsH phage
           lambda cII repressor [Xenorhabdus nematophila ATCC
           19061]
          Length = 411

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 97/272 (35%), Positives = 152/272 (55%), Gaps = 10/272 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  R GK  + V  PGL+     ID+V  V V          S    + SG
Sbjct: 92  YTIKETERGVVTRLGKFSH-VVQPGLNWKMTFIDRVRAVNV---------ESVRELATSG 141

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V    +V Y VTDP  YLFN+ NP  +L+Q ++SA+R VVG+     I  +
Sbjct: 142 VMLTSDENVVRAEMNVQYRVTDPAAYLFNVTNPDNSLRQATDSAVRGVVGKYTMEKILTA 201

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  Y  GI +  ++ + A PP EV  AFD+V  A ++E + + E
Sbjct: 202 DRTIVRNDTQKVLEETIRPYHMGITLLDVNFQTARPPEEVKAAFDDVIAAREEEQKTIRE 261

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y N VL  A+G+A  + E + AYK  ++  A+GE   F  I  +Y  AP + R+R+Y
Sbjct: 262 AEAYKNSVLPIAKGDAQRMIEEAKAYKASVVFNARGEVASFAKILPEYKAAPEITRERLY 321

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNEAF 341
           +ETME +L   +KVI ++K + M  LPL++  
Sbjct: 322 IETMERVLSHTRKVIANEKSNNMLVLPLDQVL 353


>gi|237809126|ref|YP_002893566.1| HflK protein [Tolumonas auensis DSM 9187]
 gi|237501387|gb|ACQ93980.1| HflK protein [Tolumonas auensis DSM 9187]
          Length = 390

 Score =  166 bits (421), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 106/339 (31%), Positives = 180/339 (53%), Gaps = 16/339 (4%)

Query: 6   NNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGS---VYIILLLIGS 62
           NN+D    R    N     +PP D++ +++ ++++       +S G    + I  LL   
Sbjct: 8   NNNDKDKDRDPWKNTGKSQIPP-DLDKLLKSVRERLTGTFGGQSSGGSTGLIIFALLAVV 66

Query: 63  FCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSA 122
                  Y +   ER V LRFGK  ++   PGL   +  +D+V  V V          S 
Sbjct: 67  IWIGSGFYTIEEAERGVVLRFGK-YHETVDPGLRWKWTFVDKVIPVDV---------ESV 116

Query: 123 SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRF 182
               +SG +LT D+N+V +   V Y V +PR YLF++ +   +L++ ++SA+R VVG   
Sbjct: 117 KSMPSSGFMLTQDENVVRVEMDVQYRVVNPREYLFSVTDADNSLREATDSALRYVVGHTS 176

Query: 183 AVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQD 242
             D+    R+++      ++++ ++ Y+ G+ I  ++   A PP EV DAFD+   A++D
Sbjct: 177 MDDLLTRGREKVRQNTWQVLEEIVEPYRMGLAIVDVNFLPARPPEEVKDAFDDAISAQED 236

Query: 243 EDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPT 302
           E RF+ E+  Y+      ARG+   + E S+ YK++++  A GE  RF  +  +Y+ AP 
Sbjct: 237 EQRFLREAEAYARETEPKARGQVKRLEEESLGYKEQVVLRATGEVARFNQLLPEYIAAPQ 296

Query: 303 LLRKRIYLETMEGILKKAKKVIID--KKQSVMPYLPLNE 339
           L R+R+YL+TME + +K  KV+ID  K  + + YLPL++
Sbjct: 297 LTRERLYLDTMEELYQKTNKVLIDVPKGNNNVIYLPLDK 335


>gi|153002271|ref|YP_001367952.1| HflK protein [Shewanella baltica OS185]
 gi|160876995|ref|YP_001556311.1| HflK protein [Shewanella baltica OS195]
 gi|217974858|ref|YP_002359609.1| HflK protein [Shewanella baltica OS223]
 gi|304410917|ref|ZP_07392534.1| HflK protein [Shewanella baltica OS183]
 gi|307304912|ref|ZP_07584662.1| HflK protein [Shewanella baltica BA175]
 gi|151366889|gb|ABS09889.1| HflK protein [Shewanella baltica OS185]
 gi|160862517|gb|ABX51051.1| HflK protein [Shewanella baltica OS195]
 gi|217499993|gb|ACK48186.1| HflK protein [Shewanella baltica OS223]
 gi|304350814|gb|EFM15215.1| HflK protein [Shewanella baltica OS183]
 gi|306912314|gb|EFN42738.1| HflK protein [Shewanella baltica BA175]
 gi|315269198|gb|ADT96051.1| HflK protein [Shewanella baltica OS678]
          Length = 379

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 108/341 (31%), Positives = 176/341 (51%), Gaps = 22/341 (6%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKF----DLIPFFKSYGSVYIILLL 59
           +K N  W      G+ G  D  PP D++ + R +  +F    +      S  S+ IIL +
Sbjct: 8   NKGNDPW------GNKGGNDKGPP-DLDEVFRNLSKRFGGKGNGSGQSFSSFSLIIILAV 60

Query: 60  IGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGG 119
                     Y +   ER V LRFGK   ++  PGLH     IDQ+  V +         
Sbjct: 61  AVVVWGLSGFYTIKEAERGVALRFGKHAGEIG-PGLHWKATFIDQIYPVDI--------- 110

Query: 120 RSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVG 179
           +S      SG +LT D+N+V +   V Y + D   YLF+  +   +L++ ++SA+R V+G
Sbjct: 111 QSVRSIPASGSMLTSDENVVKVELDVQYRILDAYSYLFSAVDANASLREATDSALRYVIG 170

Query: 180 RRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRA 239
                DI  + R  I  +    +++ ++ YK G+ +  ++   A PP EV DAFD+   A
Sbjct: 171 HNKMDDILTTGRDAIRRDTWKELERILEPYKLGLAVVDVNFLPARPPEEVKDAFDDAISA 230

Query: 240 EQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVN 299
           ++DE RF+ E+  Y+  +   ARGE   + + + AYK+R + EA+G+  RF  +  +Y  
Sbjct: 231 QEDEQRFIREAEAYAREIEPKARGEVERMAQQANAYKEREVLEARGKVARFELLLPEYQA 290

Query: 300 APTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
           AP + RKR+YL+TM+ ++    KV+ID K +  + YLPL++
Sbjct: 291 APDVTRKRLYLDTMQQVMTDTNKVLIDAKNNGNLMYLPLDK 331


>gi|239947125|ref|ZP_04698878.1| HflK protein [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239921401|gb|EER21425.1| HflK protein [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 345

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 98/315 (31%), Positives = 181/315 (57%), Gaps = 18/315 (5%)

Query: 38  KDKFDLIPFFKSYGSVYIILLLIGSFCAF---QSIYIVHPDERAVELRFGKPKNDVFLPG 94
           K++F+   FF+   +   I+L + +  A      IY +   E A  +RFG+     + PG
Sbjct: 32  KNQFNFDKFFQFNFNAKTIILAVVAMVALWFVSGIYEIKEGEEAAVIRFGRFVRKGY-PG 90

Query: 95  LHMMF-WPIDQVEIVKVIE-RQQKIGGRSASV----GSNS------GLILTGDQNIVGLH 142
           L+     P +++ + KV + R+ +IG R+ S     G N+       ++LTGD+NIV L+
Sbjct: 91  LNYHLPAPFEKIIVEKVKQSRRIEIGYRTNSSLHSGGDNTKNIAGESIMLTGDENIVALN 150

Query: 143 FSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLI 202
             V++ + +   ++FN++ P ET+K   ESA+REV+G      +   ++Q+I  ++  L 
Sbjct: 151 CDVMWHINNLEDFIFNVQRPKETVKATVESAVREVIGNTPISWVLSDRKQEITYKIEKLA 210

Query: 203 QKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSAR 262
           QK +D Y +G++I  + +  A PP EV DA+ +VQ ++ D+++ + ++  Y+N++L  AR
Sbjct: 211 QKILDSYNAGVMIEKVQLLKAEPPAEVIDAYRDVQTSKADKEKEINQAQAYNNKILPEAR 270

Query: 263 GEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKK 322
           G A+ I + +  Y++ +I +A+G + RF +IY QY     + R R+YLE +E IL  + K
Sbjct: 271 GAAAKIIQEAEGYREEVISKAEGYSQRFNAIYKQYATGRQVTRDRLYLEVVEEILGGSNK 330

Query: 323 VIIDKKQSVMPYLPL 337
            II+   +++P++ +
Sbjct: 331 TIIN--NALLPHMAI 343


>gi|88704494|ref|ZP_01102208.1| protease subunit HflK [Congregibacter litoralis KT71]
 gi|88701545|gb|EAQ98650.1| protease subunit HflK [Congregibacter litoralis KT71]
          Length = 385

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 100/290 (34%), Positives = 173/290 (59%), Gaps = 14/290 (4%)

Query: 53  VYIILLLIGSFC-AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI 111
           ++I+LL   +   A   +Y +   ERAV LRFGK  + V  PGLH     ID  E+++V 
Sbjct: 61  LFIVLLCGAALVWALMGLYQIDEQERAVVLRFGKYHSTVR-PGLHWNPPGID--EVIRV- 116

Query: 112 ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSE 171
               K+  R+AS      ++LT D+NIV +  SV Y++ + + ++  +  P   L+Q ++
Sbjct: 117 -NTTKV--RAASFRE---IMLTQDENIVEVRMSVQYIIDNVQDFVLQVRQPENALQQAAK 170

Query: 172 SAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231
           SA+R VVG      +    R +IA EV   +Q  ++ Y +GI ++ ++++D+ PP +V  
Sbjct: 171 SALRHVVGGMTMDLVLTEGRTRIATEVDERLQNYLNNYTTGIRLSAVNVDDSKPPSQVQA 230

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           AFD+V +A +DE+R   E+  Y+N ++  ARG+A    E + AY++++I  A+GEADRF 
Sbjct: 231 AFDDVIKAREDEERVKNEAQSYANGIVPEARGQAQRQIEEASAYREQVIANAEGEADRFS 290

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
           ++  +Y  AP + R+R+YL+ ++ +L    K+++D +   +VM YLPL++
Sbjct: 291 NLLAEYRKAPEVTRERLYLDAVQNVLSNTSKIMVDVEGGNNVM-YLPLDK 339


>gi|254796556|ref|YP_003081392.1| HflK protein [Neorickettsia risticii str. Illinois]
 gi|254589793|gb|ACT69155.1| HflK protein [Neorickettsia risticii str. Illinois]
          Length = 347

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 107/306 (34%), Positives = 171/306 (55%), Gaps = 9/306 (2%)

Query: 28  FDVEAIIRYIKDKF--DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGK 85
           +D+E ++  ++ KF     P F S+  V+ +L L G F      YIV+P+E+AVEL FGK
Sbjct: 28  YDIEGLLLSVRGKFFRRSGPRF-SWWFVFSLLGLFGVFWLLSGFYIVNPEEQAVELTFGK 86

Query: 86  PKNDVFLPGLHMMF-WPIDQVEIVKVIE-RQQKIGGRSASVGSNSGLILTGDQNIVGLHF 143
               +  PGL   F +PI +V+ VKV    + +IG  S   G   G++LTGD+NIV  +F
Sbjct: 87  -YTGMADPGLRYHFPFPIGRVDKVKVAAINRNEIGYSSGKKGEGEGIMLTGDENIVNANF 145

Query: 144 SVLYVVTDPRLYLFNLENPGETL--KQVSESAMREVVGRRFAVDIFRSQ-RQQIALEVRN 200
            V + + D   +L+ + + G  L  K  +ESAMR+ +G+     I R + R +IA + + 
Sbjct: 146 EVQWRIKDAYKFLYKVRDYGFGLSVKGAAESAMRDAIGQNKISFILRGEGRAKIASDTKK 205

Query: 201 LIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGS 260
            +Q+ +D Y  G+ + +I ++   PP +V DAF +VQ A  D++R + ++  Y N  L  
Sbjct: 206 QLQEILDGYDMGVEVLSIQMKKVDPPEKVIDAFRDVQSARADKEREINQAYSYRNDALPR 265

Query: 261 ARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKA 320
           ARGEA    + + AYK  +I  A G+  RF  +Y +Y   P + + R+ +E +E + K  
Sbjct: 266 ARGEAEVALQGAQAYKIEVINRAVGDTTRFTEVYNEYRINPDITKVRMRIEMLEEVYKNT 325

Query: 321 KKVIID 326
           +KVI D
Sbjct: 326 EKVIAD 331


>gi|229586362|ref|YP_002844863.1| Protease activity modulator HflK [Rickettsia africae ESF-5]
 gi|228021412|gb|ACP53120.1| Protease activity modulator HflK [Rickettsia africae ESF-5]
          Length = 346

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 97/311 (31%), Positives = 178/311 (57%), Gaps = 17/311 (5%)

Query: 41  FDLIPFFKSYGSVYIILLLIGSFCAF--QSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
           FD   F  ++ +  IIL ++     +    IY +   E A  +RFG+     + PGL+  
Sbjct: 37  FDQFQFPFNFNAKTIILAVVAVVALWLASGIYEIKEGEEAAVIRFGRFVRKGY-PGLNYH 95

Query: 99  F-WPIDQVEIVKVIE-RQQKIGGRSASV----GSNS------GLILTGDQNIVGLHFSVL 146
              P +++ + KV + R+ +IG R+ S     G N+       ++LTGD+NI+ L+  V+
Sbjct: 96  LPAPFEKIIVEKVKQSRRIEIGYRTNSSLRSGGDNTKNIAGESIMLTGDENIIALNCDVM 155

Query: 147 YVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTM 206
           + + +   ++FN++ P ET+K   ESA+REV+G      +   Q+Q+I  ++  L QK +
Sbjct: 156 WHINNLEDFIFNVQRPAETVKATVESAVREVIGNTPISWVLSDQKQEITYKIEKLAQKIL 215

Query: 207 DYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEAS 266
           D Y +G++I  + +  A PP EV DA+ +VQ ++ D+++ + ++  Y+N++L  ARG A+
Sbjct: 216 DSYNAGVMIEKVQLLKAEPPAEVIDAYRDVQTSKADKEKEINQAQAYNNKILPEARGAAA 275

Query: 267 HIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID 326
            I + +  Y+  +I +A+G++ RF +IY QY     + R R+YLE +E IL  + K II+
Sbjct: 276 KIIQEAEGYRAEVISKAEGDSQRFNAIYKQYATGRQITRDRLYLEVVEEILGGSNKTIIN 335

Query: 327 KKQSVMPYLPL 337
              +++P++ +
Sbjct: 336 --NALLPHMAI 344


>gi|239993401|ref|ZP_04713925.1| HflK complex with HflC [Alteromonas macleodii ATCC 27126]
          Length = 383

 Score =  166 bits (420), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 105/297 (35%), Positives = 160/297 (53%), Gaps = 13/297 (4%)

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
             + + LL++  F +    Y +   ER V LRFG+    V  PGL      ID V  V V
Sbjct: 57  AGILVGLLVVIWFIS--GFYTIREAERGVVLRFGEYHEQV-EPGLRWAPTFIDSVIPVDV 113

Query: 111 IERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
                    +S    S+SG +LT D+N+V +   + + V DP  + F +E+P ++L Q  
Sbjct: 114 ---------QSIRDQSSSGSMLTEDENVVSVQMEMQFRVVDPYRWTFAVESPEQSLSQSL 164

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
           +SA+R VVG     D+    R+     V   +Q  ++ Y  G+ I  ++  DA PP +V 
Sbjct: 165 DSAIRYVVGHSKMDDVLTDGREVTRQRVWEELQAIIEPYNMGVSIIDMNFRDARPPEQVK 224

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
           DAFD+   A++DE RF+ E+  Y+  +   ARG+ + + E + AYK+R+  EAQGE  RF
Sbjct: 225 DAFDDAIAAQEDEQRFIREAEAYAREIEPRARGQVNRMNEEAQAYKERVTLEAQGEVARF 284

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNEAFSRIQT 346
             +  QY  AP + R+RIYLETME +L    K+++D K  + M YLPL++   R Q+
Sbjct: 285 EELLPQYERAPQVTRERIYLETMEEVLGNTSKIMVDSKGGNNMMYLPLDKIMERQQS 341


>gi|56459446|ref|YP_154727.1| membrane protease family stomatin/prohibitin-like protein
           [Idiomarina loihiensis L2TR]
 gi|56178456|gb|AAV81178.1| Membrane protease, stomatin/prohibitin family [Idiomarina
           loihiensis L2TR]
          Length = 384

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 99/275 (36%), Positives = 154/275 (56%), Gaps = 11/275 (4%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y V   +R V LRFG+  + +   GLH     ID VE V V          +       G
Sbjct: 79  YTVKEADRGVVLRFGQ-FHTLVESGLHWRPVFIDSVEHVDV---------NNIRSDKTDG 128

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
            +LT D+N+V +   V Y V DPR YLFN+EN    L + ++SA+R VVG     ++   
Sbjct: 129 YMLTQDENVVRVELDVQYRVVDPRAYLFNVENADGVLSRATDSALRFVVGHTTMDEVLTR 188

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R+++     ++++KTM+ Y  G+ +  I++  A PP  V DAFD+   A++DE+RF+ E
Sbjct: 189 GREEVRANTLDMLEKTMNPYTVGLQVVDINLLPARPPEAVKDAFDDAISAQEDEERFIRE 248

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+  V   ARG+   + + + AY+++II EAQGE  RF  +  QY NAP + R+RIY
Sbjct: 249 AEAYAREVEPLARGQVRRMLQEAQAYREQIILEAQGEVARFEELLPQYQNAPEVTRQRIY 308

Query: 310 LETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSR 343
           L+T++ +  K  KV++D +  + M YLPL +   +
Sbjct: 309 LDTLQELYAKTPKVLVDVEGGNNMMYLPLEKLLEK 343


>gi|21672809|ref|NP_660876.1| HflK protein [Buchnera aphidicola str. Sg (Schizaphis graminum)]
 gi|25008546|sp|Q8K914|HFLK_BUCAP RecName: Full=Protein HflK
 gi|21623459|gb|AAM68087.1| HflK [Buchnera aphidicola str. Sg (Schizaphis graminum)]
          Length = 411

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 101/289 (34%), Positives = 157/289 (54%), Gaps = 11/289 (3%)

Query: 54  YIILLLIGSFC-AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE 112
           ++I+  +  F   F   Y +   ER V   FGK  + V  PGL+     I++V+ V V  
Sbjct: 72  FLIIAFVSFFVWCFSGFYTIKEAERGVVTTFGKFSHLV-APGLNWRPVFINEVKAVNV-- 128

Query: 113 RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
                   +    + SG++LT D+N+V +  +V Y +TDP  YLF++  P ++L+Q ++S
Sbjct: 129 -------ETVRELATSGVMLTSDENVVRVEMNVQYKITDPADYLFSVAYPDDSLRQATDS 181

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           A+R V+G      +    R  I  + +  I++T+  YK GI I  ++ + A PP EV +A
Sbjct: 182 ALRGVIGHSNMDRVLTEGRTLIRSDTQKEIEETIKPYKLGITILDVNFQTARPPEEVKEA 241

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           FD+   A ++ ++++ E+  YSN V   A G+A  I E + AY  R I EAQGE  RFL 
Sbjct: 242 FDDAIAARENREQYIREAEAYSNEVQPKAHGKAQRILEEAKAYSSRRILEAQGEVVRFLK 301

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAF 341
           I  +Y     +  KR+Y+E+ME +L K KK+ IDKK     +L LN  F
Sbjct: 302 ILPEYRKNKEMTLKRLYIESMEKLLSKTKKIFIDKKNHSKLFLSLNNFF 350


>gi|254230081|ref|ZP_04923479.1| HflK protein, putative [Vibrio sp. Ex25]
 gi|262393035|ref|YP_003284889.1| HflK protein [Vibrio sp. Ex25]
 gi|151937415|gb|EDN56275.1| HflK protein, putative [Vibrio sp. Ex25]
 gi|262336629|gb|ACY50424.1| HflK protein [Vibrio sp. Ex25]
          Length = 401

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 97/286 (33%), Positives = 156/286 (54%), Gaps = 11/286 (3%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           +I L+  +   F   Y +   ER V LR GK  + +  PGL+     ID+ E V V    
Sbjct: 77  VIALIAVAVWFFAGFYTIGEAERGVVLRLGK-YDRIVDPGLNWRPRFIDEYEAVNV---- 131

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
           Q I    AS     GL+LT D+N+V +   V Y VTDP  YL+ + N  ++L+Q ++SA+
Sbjct: 132 QAIRSLRAS-----GLMLTKDENVVTVAMDVQYRVTDPYKYLYRVTNADDSLRQATDSAL 186

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           R V+G      I  S RQQI    +  + + +D Y  G+++  ++ + A PP +V DAFD
Sbjct: 187 RAVIGDSLMDSILTSGRQQIRQTTQETLNQIIDSYDMGLVLVDVNFQSARPPEQVKDAFD 246

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +   A +DE+RF+ E+  Y N +L  A G A  +++ +  Y +R+  EA G+  +F  + 
Sbjct: 247 DAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNERVTNEALGQVAQFEKLL 306

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
            +Y  AP + R R+Y++ ME +     KV+ID + S  + YLP+++
Sbjct: 307 PEYQAAPGVTRDRLYIDAMEEVYSSTSKVLIDSESSGNLLYLPIDK 352


>gi|157803308|ref|YP_001491857.1| protease activity modulator HflK [Rickettsia canadensis str.
           McKiel]
 gi|157784571|gb|ABV73072.1| protease activity modulator HflK [Rickettsia canadensis str.
           McKiel]
          Length = 346

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 98/311 (31%), Positives = 178/311 (57%), Gaps = 17/311 (5%)

Query: 41  FDLIPFFKSYGSVYIIL--LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
           FD   F  ++ +  IIL  +++ +      IY +   E A  +RFG+     + PGL+  
Sbjct: 37  FDKFQFQFNFNAKTIILAIVVVAALWLASGIYEIKEGEEAAVIRFGRFVRKGY-PGLNYH 95

Query: 99  F-WPIDQVEIVKVIE-RQQKIGGRSASV----GSNS------GLILTGDQNIVGLHFSVL 146
              P +++ + KV + R+ +IG R+ S     G N+       ++LTGD+NIV L+  V+
Sbjct: 96  LPAPFEKIIVEKVKQSRRIEIGYRTNSSIRSGGDNTKNIAGESIMLTGDENIVALNCDVM 155

Query: 147 YVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTM 206
           + + +   ++FN++ P ET+K   ESA+REV+G      +   Q+Q+I  ++  L QK +
Sbjct: 156 WHINNLEDFIFNVQRPEETVKATVESAVREVIGNTPISWVLSDQKQEITYKIEKLAQKIL 215

Query: 207 DYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEAS 266
           D Y +G++I  + +  A PP EV DA+ +VQ ++ D+++ + ++  Y+N++L  ARG A+
Sbjct: 216 DSYNAGVMIEKVQLLKAEPPAEVIDAYRDVQTSKADKEKEINQAQAYNNKILPEARGAAA 275

Query: 267 HIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID 326
            I + +  Y++ +I +A+G++ RF +IY QY     + R R+YLE  E IL  + K II+
Sbjct: 276 KIIQEAEGYREEVISKAEGDSQRFNAIYKQYTTGRQVTRDRLYLEVAEEILSGSNKTIIN 335

Query: 327 KKQSVMPYLPL 337
               ++P++ +
Sbjct: 336 --NVLLPHMAI 344


>gi|207743436|ref|YP_002259828.1| membrane protease subunits, stomatin/prohibitin homologs protein
           [Ralstonia solanacearum IPO1609]
 gi|206594833|emb|CAQ61760.1| membrane protease subunits, stomatin/prohibitin homologs protein
           [Ralstonia solanacearum IPO1609]
          Length = 434

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 110/348 (31%), Positives = 179/348 (51%), Gaps = 28/348 (8%)

Query: 20  GNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGS---VYIILLLIGSFCAFQSIYIVHPDE 76
           GNG+G  P               L P     GS   V ++L ++         +IV   +
Sbjct: 61  GNGNGPTP---------------LRPGNGRAGSGLGVGVLLAVLAGLWLASGFFIVQEGQ 105

Query: 77  RAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQKIGGRSASVGSNS---GLIL 132
             V L+FG+ K  +  PG++    +PI+  EIV +   +    GR+  +   +     +L
Sbjct: 106 TGVILQFGRFKY-LATPGINWRLPYPIESHEIVNLSGVRTLEIGRTTQIKDTNLKDSSML 164

Query: 133 TGDQNIVGLHFSVLYVVTDPRLYLF----NLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           T D+NIV + FSV Y + DP  YLF    +     E + Q +E+++RE+VGR     +  
Sbjct: 165 TQDENIVDVRFSVQYNIADPVEYLFYNRTDQRGDEELVTQAAETSVREIVGRNKMDAVLY 224

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  +   + + IQ+ +  YK+GI I +++++   PP +V  AFD+V +A QD +R + 
Sbjct: 225 EGRDAVGRNLADSIQRILSAYKTGIRILSVNVQSVQPPEQVQAAFDDVTKAGQDRERAIS 284

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           E   Y+N V+  ARG A+ + E +  YK R++  A+G+A RF S+  +Y  AP + R RI
Sbjct: 285 EGQAYANDVVPRARGTAARLGEEAQGYKARVVARAEGDAARFASVQREYAKAPQVTRDRI 344

Query: 309 YLETMEGILKKAKKVIIDKK-QSVMPYLPLNEAFSRIQTKREIRWYQS 355
           YLETM+ I   A KV++D+     + YLPL++  ++ Q     R  Q+
Sbjct: 345 YLETMQDIYGSATKVLVDQSGNGNLLYLPLDKLIAQSQAGDTARAQQT 392


>gi|167647306|ref|YP_001684969.1| HflK protein [Caulobacter sp. K31]
 gi|167349736|gb|ABZ72471.1| HflK protein [Caulobacter sp. K31]
          Length = 370

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 99/282 (35%), Positives = 164/282 (58%), Gaps = 16/282 (5%)

Query: 63  FCAFQSIYIVHPDERAVELRFGKPKNDVFLPGL--HMMFWPIDQVEIVKVIERQQ-KIGG 119
                  Y+V P ++AV   FG   +    PGL  H+ F PI++ E+V     Q   IGG
Sbjct: 85  LWGLSGCYVVQPKDQAVVTTFGA-YSRTAGPGLRYHLPF-PIERAEMVPFTSTQSLDIGG 142

Query: 120 RSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVG 179
            +A    +  L+LTGD+NIV L F+V + VTD   Y FN+  P   +K V+ESAMREVVG
Sbjct: 143 SAAQPVPDERLMLTGDENIVDLSFTVQWRVTDAAKYSFNVLEPDAVIKDVAESAMREVVG 202

Query: 180 RRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRA 239
           +     I  + R Q+  + + L+Q+ +D Y  G+ I +++I+ A+ P  V +A+      
Sbjct: 203 KTALTPILTNGRGQVQDQTKRLMQQIVDRYAMGVTIQSVNIQTATTPGPVLEAY------ 256

Query: 240 EQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVN 299
                R V+ + + +     +ARGEA+ I+++++ Y++++++EA G+A RF  +Y QY  
Sbjct: 257 -----RDVQRAAQNAQSAANNARGEAAQIKQAALGYREQVVREAAGDAARFNQVYEQYKL 311

Query: 300 APTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAF 341
           AP + R+R+Y+ETM+ +L+++ KVI+D K +  P +  +E F
Sbjct: 312 APAVTRERLYIETMQRVLERSNKVIVDSKGANAPIILPSETF 353


>gi|91227451|ref|ZP_01261815.1| HflK protein [Vibrio alginolyticus 12G01]
 gi|269967704|ref|ZP_06181753.1| hflK protein [Vibrio alginolyticus 40B]
 gi|91188601|gb|EAS74892.1| HflK protein [Vibrio alginolyticus 12G01]
 gi|269827682|gb|EEZ81967.1| hflK protein [Vibrio alginolyticus 40B]
          Length = 401

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 97/286 (33%), Positives = 156/286 (54%), Gaps = 11/286 (3%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           +I L+  +   F   Y +   ER V LR GK  + +  PGL+     ID+ E V V    
Sbjct: 77  VIALIAVAVWFFAGFYTIGEAERGVVLRLGK-YDRIVDPGLNWRPRFIDEYEAVNV---- 131

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
           Q I    AS     GL+LT D+N+V +   V Y VTDP  YL+ + N  ++L+Q ++SA+
Sbjct: 132 QAIRSLRAS-----GLMLTKDENVVTVAMDVQYRVTDPYKYLYRVTNADDSLRQATDSAL 186

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           R V+G      I  S RQQI    +  + + +D Y  G+++  ++ + A PP +V DAFD
Sbjct: 187 RAVIGDSLMDSILTSGRQQIRQTTQETLNQIIDSYDMGLVLVDVNFQSARPPEQVKDAFD 246

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +   A +DE+RF+ E+  Y N +L  A G A  +++ +  Y +R+  EA G+  +F  + 
Sbjct: 247 DAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNERVTNEALGQVAQFEKLL 306

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
            +Y  AP + R R+Y++ ME +     KV+ID + S  + YLP+++
Sbjct: 307 PEYQAAPGVTRDRLYIDAMEEVYSSTSKVLIDSESSGNLLYLPIDK 352


>gi|294634455|ref|ZP_06712991.1| HflK protein [Edwardsiella tarda ATCC 23685]
 gi|291092165|gb|EFE24726.1| HflK protein [Edwardsiella tarda ATCC 23685]
          Length = 422

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 97/270 (35%), Positives = 154/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V  V V          S    + SG
Sbjct: 99  YTIKEAERGVVTRFGKFSH-LVQPGLNWKPTFIDDVIPVNV---------ESVRELAASG 148

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VT+P  YLFN+ N  ++L+Q ++SA+R V+G+     I   
Sbjct: 149 VMLTSDENVVRVEMNVQYRVTNPEEYLFNVTNADDSLRQATDSALRAVIGKYTMDTILTE 208

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + + ++++ +  Y  GI I  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 209 GRTVIRNDTQKVLEEIIRPYHMGITILDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 268

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYKDR + EAQGE  RF  +  +Y  +P + R+R+Y
Sbjct: 269 AEAYTNEVQPRANGQAQRILEDAKAYKDRTVLEAQGEVGRFSRLLPEYKASPEITRERLY 328

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           LETME +L + +KV++D K + +  LPL++
Sbjct: 329 LETMERVLGQTRKVLVDDKSNNLMVLPLDQ 358


>gi|114564470|ref|YP_751984.1| HflK protein [Shewanella frigidimarina NCIMB 400]
 gi|114335763|gb|ABI73145.1| HflK protein [Shewanella frigidimarina NCIMB 400]
          Length = 386

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 109/339 (32%), Positives = 177/339 (52%), Gaps = 18/339 (5%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYG-----SVYIILLLIG-SFCAFQSIY 70
           G+ G  D  PP D++ + R +  +F       + G     S+ I++ LI     A   +Y
Sbjct: 16  GNKGGNDKGPP-DLDEVFRNLSKRFGGKGGGSATGQPFNSSLLIVIALIALVIWALSGLY 74

Query: 71  IVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGL 130
            V   ER V LRFG+   +V   GLH     ID+V +V V E  + I          SG 
Sbjct: 75  TVKEAERGVLLRFGQHIGEVS-SGLHWKATFIDEVTMVDV-ETFRSIPA--------SGR 124

Query: 131 ILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQ 190
           +LT D+NIV +   V Y V+D   YL++  +   +L++ ++SA+R V+G     DI  + 
Sbjct: 125 MLTSDENIVNVELVVQYSVSDAYSYLYSAVDANSSLREATDSALRYVIGHNRMDDILTTG 184

Query: 191 RQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEES 250
           R  I  +    +++ ++ YK G+ I  ++   A PP EV DAFD+   A++DE RF+ E+
Sbjct: 185 RDAIRRDTWTELERIIEPYKLGLQIRDVNFLPARPPEEVKDAFDDAISAQEDEQRFIREA 244

Query: 251 NKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYL 310
             Y+  +   ARG    + + + AYK+R + EA+G+  RF  +  +Y  AP + R R+Y+
Sbjct: 245 EAYAREIEPKARGTVERMAQQASAYKEREVLEARGKVARFEKLLPEYKAAPGVTRNRLYI 304

Query: 311 ETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQTKR 348
           + M+ +L    KV+ID K S  + YLPL++     ++ R
Sbjct: 305 DAMQSVLADTNKVLIDTKNSGNLMYLPLDKLMDSSKSLR 343


>gi|15892087|ref|NP_359801.1| protease activity modulator HflK [Rickettsia conorii str. Malish 7]
 gi|34580882|ref|ZP_00142362.1| protease activity modulator HflK [Rickettsia sibirica 246]
 gi|15619210|gb|AAL02702.1| protease activity modulator HflK [Rickettsia conorii str. Malish 7]
 gi|28262267|gb|EAA25771.1| protease activity modulator HflK [Rickettsia sibirica 246]
          Length = 346

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 97/311 (31%), Positives = 178/311 (57%), Gaps = 17/311 (5%)

Query: 41  FDLIPFFKSYGSVYIILLLIGSFCAF--QSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
           FD   F  ++ +  IIL ++     +    IY +   E A  +RFG+     + PGL+  
Sbjct: 37  FDQFQFPFNFNAKTIILAVVAVVALWLASGIYEIKEGEEAAVIRFGRFVRKGY-PGLNYH 95

Query: 99  F-WPIDQVEIVKVIE-RQQKIGGRSASV----GSNS------GLILTGDQNIVGLHFSVL 146
              P +++ + KV + R+ +IG R+ S     G N+       ++LTGD+NI+ L+  V+
Sbjct: 96  LPAPFEKIIVEKVKQSRRIEIGYRTNSSLRSGGDNTKNIAGESIMLTGDENIIALNCDVM 155

Query: 147 YVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTM 206
           + + +   ++FN++ P ET+K   ESA+REV+G      +   Q+Q+I  ++  L QK +
Sbjct: 156 WHINNLEDFIFNVQRPAETVKATVESAVREVIGNTPISWVLSDQKQEITYKIEKLAQKIL 215

Query: 207 DYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEAS 266
           D Y +G++I  + +  A PP EV DA+ +VQ ++ D+++ + ++  Y+N++L  ARG A+
Sbjct: 216 DSYNAGVMIEKVQLLKAEPPAEVIDAYRDVQTSKADKEKEINQAQAYNNKILPEARGAAA 275

Query: 267 HIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID 326
            I + +  Y+  +I +A+G++ RF +IY QY     + R R+YLE +E IL  + K II+
Sbjct: 276 KIIQEAEGYRAEVISKAEGDSQRFNAIYKQYATGRQVTRDRLYLEVVEEILGGSNKTIIN 335

Query: 327 KKQSVMPYLPL 337
              +++P++ +
Sbjct: 336 --NALLPHMAI 344


>gi|207723171|ref|YP_002253570.1| membrane protease subunits, stomatin/prohibitin homologs protein
           [Ralstonia solanacearum MolK2]
 gi|206588365|emb|CAQ35328.1| membrane protease subunits, stomatin/prohibitin homologs protein
           [Ralstonia solanacearum MolK2]
          Length = 436

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 110/348 (31%), Positives = 179/348 (51%), Gaps = 28/348 (8%)

Query: 20  GNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGS---VYIILLLIGSFCAFQSIYIVHPDE 76
           GNG+G  P               L P     GS   V ++L ++         +IV   +
Sbjct: 61  GNGNGPTP---------------LRPGNGRAGSGLGVGVLLAVLAGLWLASGFFIVQEGQ 105

Query: 77  RAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQKIGGRSASVGSNS---GLIL 132
             V L+FG+ K  +  PG++    +PI+  EIV +   +    GR+  +   +     +L
Sbjct: 106 TGVILQFGRFKY-LATPGINWRLPYPIESHEIVNLSGVRTLEIGRTTQIKDTNLKDSSML 164

Query: 133 TGDQNIVGLHFSVLYVVTDPRLYLF----NLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           T D+NIV + FSV Y + DP  YLF    +     E + Q +E+++RE+VGR     +  
Sbjct: 165 TQDENIVDVRFSVQYNIADPVEYLFYNRTDQRGDEELVTQAAETSVREIVGRNKMDAVLY 224

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  +   + + IQ+ +  YK+GI I +++++   PP +V  AFD+V +A QD +R + 
Sbjct: 225 EGRDAVGRNLADSIQRILSAYKTGIRILSVNVQSVQPPEQVQAAFDDVTKAGQDRERAIS 284

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           E   Y+N V+  ARG A+ + E +  YK R++  A+G+A RF S+  +Y  AP + R RI
Sbjct: 285 EGQAYANDVVPRARGTAARLGEEAQGYKARVVARAEGDAARFASVQREYAKAPQVTRDRI 344

Query: 309 YLETMEGILKKAKKVIIDKK-QSVMPYLPLNEAFSRIQTKREIRWYQS 355
           YLETM+ I   A KV++D+     + YLPL++  ++ Q     R  Q+
Sbjct: 345 YLETMQDIYGSATKVLVDQSGNGNLLYLPLDKLIAQSQAGDTARAQQT 392


>gi|54310428|ref|YP_131448.1| putative membrane protease subunits [Photobacterium profundum SS9]
 gi|46914869|emb|CAG21646.1| putative Membrane protease subunits [Photobacterium profundum SS9]
          Length = 387

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 102/289 (35%), Positives = 162/289 (56%), Gaps = 11/289 (3%)

Query: 52  SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI 111
           S+ ++ +L  +   F   Y +   ER V LRFGK   ++  PGL+     +D+V  V V 
Sbjct: 63  SLGVVAVLATAVWGFSGFYTIGEAERGVVLRFGK-FYEMVDPGLNWKPTFVDEVTPVNV- 120

Query: 112 ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSE 171
              Q I  RS     +SGL+LT D+N++ +   V Y V+D + YLF++ N  ++L+Q ++
Sbjct: 121 ---QAI--RSLR---SSGLMLTKDENVLKVEMDVQYRVSDAQSYLFSVTNADDSLRQATD 172

Query: 172 SAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231
           SA+R V+G     +   + RQ I    +  I+K ++ Y  G+L+  ++ + A PP EV D
Sbjct: 173 SALRAVIGDSSMDEALTTGRQVIRASTQEAIEKIIENYYMGVLVVDVNFQSARPPTEVQD 232

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           AFD+   A +DE+RFV ES  YSN +L  A G A  +++ +  Y ++ I  A GE  +F 
Sbjct: 233 AFDDAIAAREDEERFVRESEAYSNDILPKATGHAERLKKEAQGYSEKTINGALGEVAQFE 292

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNE 339
            +  +Y  A  + R R+YLETME +     KV+ID K +  + YLPL++
Sbjct: 293 KLLPEYEVAKEVTRSRLYLETMERVYSNTSKVMIDSKSNGNLLYLPLDK 341


>gi|258625633|ref|ZP_05720514.1| hflK protein [Vibrio mimicus VM603]
 gi|262163592|ref|ZP_06031335.1| HflK protein [Vibrio mimicus VM223]
 gi|258582088|gb|EEW06956.1| hflK protein [Vibrio mimicus VM603]
 gi|262027959|gb|EEY46621.1| HflK protein [Vibrio mimicus VM223]
          Length = 395

 Score =  166 bits (419), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 98/285 (34%), Positives = 154/285 (54%), Gaps = 11/285 (3%)

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVG 125
           F   Y +   ER V LR GK  + +  PGL+     ID+V  V V    Q I    AS  
Sbjct: 84  FTGFYTIGEAERGVVLRLGK-YDRIVDPGLNWRPRFIDEVTPVNV----QAIRSLRAS-- 136

Query: 126 SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVD 185
              GL+LT D+N+V +   V Y ++DP  YL+ + N  ++L+Q ++SA+R V+G      
Sbjct: 137 ---GLMLTKDENVVTVSMDVQYRISDPYKYLYQVTNADDSLRQATDSALRAVIGDSLMDS 193

Query: 186 IFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDR 245
           I  S RQQI    +  + + +D Y  G++I  ++ + A PP +V DAFD+   A +DE+R
Sbjct: 194 ILTSGRQQIRQSTQQTLNQIIDSYDMGLMIVDVNFQSARPPEQVKDAFDDAIAAREDEER 253

Query: 246 FVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLR 305
           F+ E+  Y N +L  A G A  +++ +  Y +R I EA G+  +F  +  +Y  AP + R
Sbjct: 254 FIREAEAYKNEILPKATGRAERLKKEAQGYNERTINEALGQVAQFEKLLPEYQAAPKVTR 313

Query: 306 KRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQTKRE 349
            R+YL+ ME +     KV+ID + S  + YLP+++   +   K E
Sbjct: 314 DRLYLDAMEEVYSNTSKVLIDSESSGNLLYLPIDKLAGQDSKKAE 358


>gi|152981571|ref|YP_001353810.1| membrane protease subunit HflK [Janthinobacterium sp. Marseille]
 gi|151281648|gb|ABR90058.1| membrane protease subunit HflK [Janthinobacterium sp. Marseille]
          Length = 424

 Score =  166 bits (419), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 102/293 (34%), Positives = 159/293 (54%), Gaps = 14/293 (4%)

Query: 57  LLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP--IDQVEIVKVIE-R 113
           L L+  F      +IV   +  V + FGK  +    P      WP  I   EIV V + R
Sbjct: 91  LWLVSGF------FIVQEGQTGVVMTFGKYSH--MTPAGFNWRWPTPIQSHEIVNVSQVR 142

Query: 114 QQKIG--GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSE 171
             ++G  G   +      L+LT D+NI+ + F+V Y + +   ++FN     E +KQV+E
Sbjct: 143 TVEVGYRGNVKNKQQQESLMLTEDENIIDIQFAVQYTLKNASDWVFNNREQEEMVKQVAE 202

Query: 172 SAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231
           +A+REVVGR     +    R++IA +   L+Q+ +D YKSG+ I  ++++   PP +V  
Sbjct: 203 TAIREVVGRSKMDFVLYEGREKIAFDSSQLMQQIVDRYKSGVQITNVTMQGVQPPEQVQA 262

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           +FD+  +A QD +R   E   Y+N V+  ARG AS + + S AY+  +   AQGEA RF 
Sbjct: 263 SFDDAVKAGQDRERQKNEGQAYANDVIPRARGAASRLLQESEAYRSSVTANAQGEASRFK 322

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNEAFSR 343
            +  +Y  AP + R R+YLETM+ I     KV++D K  + + YLPL++  S+
Sbjct: 323 QVLVEYQKAPAVTRDRMYLETMQKIFSSTTKVMVDSKGNNSLIYLPLDKLISQ 375


>gi|119468152|ref|ZP_01611278.1| HflK complex with HflC [Alteromonadales bacterium TW-7]
 gi|119448145|gb|EAW29409.1| HflK complex with HflC [Alteromonadales bacterium TW-7]
          Length = 386

 Score =  166 bits (419), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 167/299 (55%), Gaps = 11/299 (3%)

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE 112
           +  IL++     A   IY V   ER V L+FGK  + +  PGL    W +  +E V  ++
Sbjct: 62  ISFILIIAAIVWALSGIYTVKEAERGVVLQFGK-YDRIAEPGLR---WKMTFIETVIPVD 117

Query: 113 RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
            +     RS S    SG +LT D+N+V + F V Y V DP LY F++ N   +L++  +S
Sbjct: 118 IE---AVRSLSA---SGFMLTEDENVVSVEFQVQYRVIDPYLYKFSVTNADSSLEEALDS 171

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           A+R VVG      +  + R+++     + + K ++ Y  G+++  ++ +D+ PP EV DA
Sbjct: 172 ALRYVVGHAKMDQVLTNGREEVRQNTWDELNKVIEPYNLGLIVTDVNFKDSRPPTEVKDA 231

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           FD+   A++DE+RF+ E+  Y+  +   ARG+ + + + +  Y++RI  EAQGE  RF  
Sbjct: 232 FDDAIAAQEDEERFIREAEAYAREIEPRARGQVTRMTQEAEGYQERITLEAQGEVARFEK 291

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKREI 350
           +  +Y+ A  + R+R+Y++ ME +L  + KV++D K  + M YLPL++   +  T   +
Sbjct: 292 LLPEYLAAKEVTRERLYIDAMEEVLGSSSKVLVDVKGGNNMMYLPLDKIMEKQGTATRV 350


>gi|71278127|ref|YP_267093.1| HflK protein [Colwellia psychrerythraea 34H]
 gi|71143867|gb|AAZ24340.1| HflK protein [Colwellia psychrerythraea 34H]
          Length = 382

 Score =  166 bits (419), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 162/293 (55%), Gaps = 12/293 (4%)

Query: 56  ILLLIGSFC-AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           ILL++ S   AF   Y +   E+ + LRFG+    V  PG++  +  +D++  V +    
Sbjct: 64  ILLIVASVVYAFSGFYTIKEAEQGIVLRFGEYSGTV-EPGINWKWTFVDRIIPVDM---- 118

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
                +S     +SG +LT D+N+V +   + Y V D R Y+F++ N  ++L Q  +SA+
Sbjct: 119 -----QSTRDMPSSGFMLTKDENVVRVEMQIQYRVVDARKYIFSVTNADDSLNQSLDSAL 173

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           R VVG     DI  S R+ I   V   + K ++ Y  G++I  ++ +DA PP EV DAFD
Sbjct: 174 RYVVGHAKMDDILTSGRESIRQSVWEELDKIIEPYNLGLIIVDVNFKDARPPNEVKDAFD 233

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +   A++DE RF+ E+  Y+  +   ARG    + + +IAYK RI+ +AQGE  RF  I 
Sbjct: 234 DAISAQEDEVRFLREAEAYARGIEPRARGRVKRMEQEAIAYKSRIVLDAQGEVARFEKIL 293

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQT 346
            +Y  AP + R+R+Y+ TME +     KV++D +  + M YLPL++   +  T
Sbjct: 294 PEYQAAPKVTRERLYIATMEKVYGNVSKVMVDVEGGNNMMYLPLDKIIQQQNT 346


>gi|332995406|gb|AEF05461.1| HflK complex with HflC [Alteromonas sp. SN2]
          Length = 383

 Score =  166 bits (419), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 102/284 (35%), Positives = 153/284 (53%), Gaps = 11/284 (3%)

Query: 63  FCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSA 122
             A    Y +   ER V LRFG+    V  PGL      ID+V  V V         +S 
Sbjct: 67  IWAVSGFYTIREAERGVVLRFGEYAKQV-EPGLRWAPTFIDRVIPVDV---------QSI 116

Query: 123 SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRF 182
              S+SG +LT D+N+V +   + + V DP  + F +E+P  +L Q  +SA+R VVG   
Sbjct: 117 RDQSSSGSMLTEDENVVSVQMEMQFRVVDPYRWTFAVESPETSLSQSLDSAIRYVVGHST 176

Query: 183 AVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQD 242
             D+    R+     V   +Q  ++ Y  G+ I  ++  DA PP +V DAFD+   A++D
Sbjct: 177 MDDVLTDGREVARQRVWEELQAIIEPYNMGVSIIDMNFRDARPPEQVKDAFDDAISAQED 236

Query: 243 EDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPT 302
           E RF+ E+  Y+  +   ARG+ + + E + AYK+R+  EAQGE  RF ++  QY  AP 
Sbjct: 237 EQRFIREAEAYAREIEPRARGQVNRMNEEAQAYKERVTLEAQGEVARFEALLPQYEKAPV 296

Query: 303 LLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNEAFSRIQ 345
           + R+RIY+ETME +L    K+++D K  + M YLPL++   R Q
Sbjct: 297 VTRERIYIETMEEVLGSTSKILVDSKGGNNMMYLPLDKIMERQQ 340


>gi|260770601|ref|ZP_05879533.1| HflK protein [Vibrio furnissii CIP 102972]
 gi|260614431|gb|EEX39618.1| HflK protein [Vibrio furnissii CIP 102972]
 gi|315178342|gb|ADT85256.1| hflK protein [Vibrio furnissii NCTC 11218]
          Length = 397

 Score =  165 bits (418), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 96/275 (34%), Positives = 150/275 (54%), Gaps = 11/275 (4%)

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVG 125
           F   Y +   ER V LR GK  + +  PGL+     ID+V  V V    Q I    AS  
Sbjct: 86  FAGFYTIGEAERGVVLRLGK-YDRIVDPGLNWRPRFIDEVTPVNV----QAIRSLRAS-- 138

Query: 126 SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVD 185
              GL+LT D+N+V +   V Y V DP  YLF + N  ++L+Q ++SA+R V+G      
Sbjct: 139 ---GLMLTKDENVVTVSMDVQYRVADPYKYLFKVTNADDSLRQATDSALRAVIGDSLMDS 195

Query: 186 IFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDR 245
           I  S RQQI    +  + + +D Y  G++I  ++ + A PP +V DAFD+   A +DE+R
Sbjct: 196 ILTSGRQQIRQSTQETLNQIIDGYDMGLIIVDVNFQSARPPEQVKDAFDDAIAAREDEER 255

Query: 246 FVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLR 305
           F+ E+  Y N +L  A G A  +++ +  Y +R + EA G+  +F  +  +Y  +P + R
Sbjct: 256 FIREAEAYKNEILPKATGRAERLKKEAQGYTERTVNEALGQVAQFEKLLPEYTASPKVTR 315

Query: 306 KRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
            R+YL+ M+ +     KV+ID K S  + YLP+++
Sbjct: 316 DRLYLDAMQEVYSNTSKVLIDSKSSGNLLYLPIDK 350


>gi|319760226|ref|YP_004124164.1| HflK protein [Candidatus Blochmannia vafer str. BVAF]
 gi|318038940|gb|ADV33490.1| HflK protein [Candidatus Blochmannia vafer str. BVAF]
          Length = 440

 Score =  165 bits (418), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 96/266 (36%), Positives = 148/266 (55%), Gaps = 10/266 (3%)

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASV 124
           A    Y +   ER V LRFGK  + +  PGL+     ID V  V V          S   
Sbjct: 89  AMSGFYTIKEAERGVILRFGK-YHHLVQPGLNWRPSLIDYVIPVNV---------ESVRE 138

Query: 125 GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAV 184
            + SG++LT D+N+V +  +V Y VTDP+ YLF++ N  ++L+Q ++SA+R V+G+    
Sbjct: 139 LAASGMMLTSDENVVRVEMNVQYKVTDPKNYLFSVTNADDSLRQATDSALRGVIGKYNMD 198

Query: 185 DIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDED 244
            I    R  +  + R +++KT+  Y  GI +  ++ + A PP EV  AFD+   A ++E 
Sbjct: 199 RILTEGRTVVRSDTRRILEKTIHPYNMGISLLDVNFQTARPPEEVKAAFDDAIAARENEQ 258

Query: 245 RFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLL 304
           +++ E+  Y+N +   A G+A  I E   AYK + I EAQGE  RFL I  +Y  AP + 
Sbjct: 259 QYIREAEAYANEIQPKANGQAQRILEEGRAYKAKTILEAQGEVQRFLKILPEYKAAPEIT 318

Query: 305 RKRIYLETMEGILKKAKKVIIDKKQS 330
           R+R+Y+ +ME IL   +K+ ID K +
Sbjct: 319 RERLYINSMERILSNTRKIFIDTKNT 344


>gi|83747954|ref|ZP_00944985.1| Protease activity modulator HflK [Ralstonia solanacearum UW551]
 gi|83725372|gb|EAP72519.1| Protease activity modulator HflK [Ralstonia solanacearum UW551]
          Length = 459

 Score =  165 bits (418), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 110/348 (31%), Positives = 179/348 (51%), Gaps = 28/348 (8%)

Query: 20  GNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGS---VYIILLLIGSFCAFQSIYIVHPDE 76
           GNG+G  P               L P     GS   V ++L ++         +IV   +
Sbjct: 86  GNGNGPTP---------------LRPGNGRAGSGLGVGVLLAVLAGLWLASGFFIVQEGQ 130

Query: 77  RAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQKIGGRSASVGSNS---GLIL 132
             V L+FG+ K  +  PG++    +PI+  EIV +   +    GR+  +   +     +L
Sbjct: 131 TGVILQFGRFKY-LATPGINWRLPYPIESHEIVNLSGVRTLEIGRTTQIKDTNLKDSSML 189

Query: 133 TGDQNIVGLHFSVLYVVTDPRLYLF----NLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           T D+NIV + FSV Y + DP  YLF    +     E + Q +E+++RE+VGR     +  
Sbjct: 190 TQDENIVDVRFSVQYNIADPVEYLFYNRTDQRGDEELVTQAAETSVREIVGRNKMDAVLY 249

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
             R  +   + + IQ+ +  YK+GI I +++++   PP +V  AFD+V +A QD +R + 
Sbjct: 250 EGRDAVGRNLADSIQRILSAYKTGIRILSVNVQSVQPPEQVQAAFDDVTKAGQDRERAIS 309

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           E   Y+N V+  ARG A+ + E +  YK R++  A+G+A RF S+  +Y  AP + R RI
Sbjct: 310 EGQAYANDVVPRARGTAARLGEEAQGYKARVVARAEGDAARFASVQREYAKAPQVTRDRI 369

Query: 309 YLETMEGILKKAKKVIIDKK-QSVMPYLPLNEAFSRIQTKREIRWYQS 355
           YLETM+ I   A KV++D+     + YLPL++  ++ Q     R  Q+
Sbjct: 370 YLETMQDIYGSATKVLVDQSGNGNLLYLPLDKLIAQSQAGDTARAQQT 417


>gi|291279916|ref|YP_003496751.1| membrane protease subunit HflK [Deferribacter desulfuricans SSM1]
 gi|290754618|dbj|BAI80995.1| membrane protease subunit HflK [Deferribacter desulfuricans SSM1]
          Length = 326

 Score =  165 bits (418), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 99/298 (33%), Positives = 172/298 (57%), Gaps = 23/298 (7%)

Query: 44  IPFFKSYG------SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM 97
           +P FK  G      ++ +ILL + S      ++IV P+E+A+  RFGK    +  PG H 
Sbjct: 16  MPNFKYKGLLLSLIAIVLILLWLAS-----GVFIVKPNEQAIVKRFGKIIK-IVGPGPHY 69

Query: 98  MF-WPI---DQVEIVKVIERQQKIGGRSASVGS-----NSGLILTGDQNIVGLHFSVLYV 148
              +PI   D+ E+ KV   + +IG RS   G         L+LTGD+NIV + F V Y 
Sbjct: 70  HLPYPIETIDKAEVTKV--HRIEIGFRSLKNGGYKTIKEESLMLTGDENIVNIDFIVQYK 127

Query: 149 VTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDY 208
           + D   YL+N+ +  +T+K  +E+ +REV G+    +I  + + +I +E + ++Q+ +D 
Sbjct: 128 IYDISKYLYNVVDVPKTIKDAAEATIREVAGKENIDEILTTGKNRIQIETQKILQRILDD 187

Query: 209 YKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHI 268
           Y++G+ I  + ++D  PP  V   F +V  A +D++R++ E+  Y+N ++  AR +A+ +
Sbjct: 188 YQTGVKIVAVQLQDVEPPAPVIKYFKDVASAREDKNRYINEAEAYANEIIPQARAKAASM 247

Query: 269 RESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID 326
              + AY+   I++A+G+A RF+     Y +AP + +KR+Y +TME ILK+++K I D
Sbjct: 248 ILEAEAYQKEKIEKAKGDAYRFIETLKSYKSAPEITKKRLYFDTMEKILKRSEKYIFD 305


>gi|242237989|ref|YP_002986170.1| HflK protein [Dickeya dadantii Ech703]
 gi|242130046|gb|ACS84348.1| HflK protein [Dickeya dadantii Ech703]
          Length = 418

 Score =  165 bits (418), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 100/289 (34%), Positives = 161/289 (55%), Gaps = 13/289 (4%)

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
           G V   L++I     F   Y +   ER V  RFGK  + +  PGL+     ID V  V V
Sbjct: 77  GLVIAALVVIWGVTGF---YTIKEAERGVVTRFGK-FSRIVEPGLNWKPTFIDSVRAVNV 132

Query: 111 IERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
            E  +++        + SG++LT D+N+V +  +V Y VT P  YLF++ N  ++L+Q +
Sbjct: 133 -EAVREL--------ATSGVMLTSDENVVRVEMNVQYRVTQPDRYLFSVTNADDSLRQAT 183

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
           +SA+R V+G+     I    R  +  + + ++++T+  Y  GI +  ++ + A PP EV 
Sbjct: 184 DSALRGVIGKYTMDKILTEGRTIVRTDTQRVLEETIRPYDMGITLLDVNFQTARPPEEVK 243

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
            AFD+   A ++E +++ E+  Y+N V   A G+A  I E S AYK+R I EAQGE  RF
Sbjct: 244 AAFDDAIAARENEQQYIREAEAYANEVQPRANGQAQRILEESRAYKERTILEAQGEVSRF 303

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
             +  +Y  AP + R+R+Y+ETME +L    KV++  K + +  LPL++
Sbjct: 304 ARLLPEYKAAPEITRQRLYIETMERVLSHTSKVLVSDKGNNLMVLPLDQ 352


>gi|238918370|ref|YP_002931884.1| FtsH protease regulator HflK [Edwardsiella ictaluri 93-146]
 gi|238867938|gb|ACR67649.1| HflK protein, putative [Edwardsiella ictaluri 93-146]
          Length = 419

 Score =  165 bits (418), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 97/270 (35%), Positives = 153/270 (56%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V  V V          S    + SG
Sbjct: 97  YTIKEAERGVVTRFGKFSH-LVQPGLNWKPTFIDDVIPVNV---------ESVRELAASG 146

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VT+P  YLFN+ N  ++L+Q ++SA+R V+G+     I   
Sbjct: 147 VMLTSDENVVRVEMNVQYRVTNPEEYLFNVTNADDSLRQATDSALRAVIGKYTMDTILTE 206

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + + ++++ +  Y  GI I  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 207 GRTVIRNDTQKVLEEIIRPYHMGITILDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 266

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYKDR + EAQGE  RF  +  +Y  +P + R+R+Y
Sbjct: 267 AEAYANEVQPRANGQAQRILEDAKAYKDRTVLEAQGEVGRFSRLLPEYKASPEITRERLY 326

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           LETME +L   +KV++D K + +  LPL++
Sbjct: 327 LETMERVLGHTRKVLVDDKSNNLMVLPLDQ 356


>gi|254283117|ref|ZP_04958085.1| heat shock protein HslU [gamma proteobacterium NOR51-B]
 gi|219679320|gb|EED35669.1| heat shock protein HslU [gamma proteobacterium NOR51-B]
          Length = 386

 Score =  165 bits (418), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 102/296 (34%), Positives = 166/296 (56%), Gaps = 16/296 (5%)

Query: 50  YGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVK 109
           +G +   LL++ +   F   Y +   ERAV LRFGK  +    PGL      IDQV  V 
Sbjct: 61  FGVIGGALLVVWAVMGF---YQLDEQERAVVLRFGK-YHATLQPGLQWNPPIIDQVITVN 116

Query: 110 VIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
             +       RSA       ++LT D+NIV +  SV Y++ DP  ++  + +P  +L+  
Sbjct: 117 TTKV------RSAGFRE---VMLTKDENIVEVSMSVQYIIDDPEKFILEVRDPEISLQHA 167

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           ++SA+R VVG      +    R  IA EV   +Q  ++ Y +GIL++ ++I++  PP +V
Sbjct: 168 AQSALRHVVGDTTMDLVLTEGRAAIAGEVTQRLQNYLNSYGTGILVSKVNIDEGKPPSQV 227

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
             AFD+V +A +DE+R   E+  YSN ++  ARG A  + E + AY+D++I  A+GEA+R
Sbjct: 228 QGAFDDVIKAREDEERVKNEAQSYSNGIVPEARGRAQRVLEEASAYRDQVIALAEGEAER 287

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNEAFSR 343
           F  +  +Y  AP + R+R+YL+ ++ +     KV++D +   +VM YLPL++   R
Sbjct: 288 FTQLLTEYRKAPEVTRERLYLDAVQTVFANTNKVLVDVEGGNNVM-YLPLDKLAPR 342


>gi|269137712|ref|YP_003294412.1| FtsH protease regulator HflK [Edwardsiella tarda EIB202]
 gi|267983372|gb|ACY83201.1| FtsH protease regulator HflK [Edwardsiella tarda EIB202]
 gi|304557766|gb|ADM40430.1| HflK [Edwardsiella tarda FL6-60]
          Length = 414

 Score =  165 bits (418), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 97/270 (35%), Positives = 153/270 (56%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V  V V          S    + SG
Sbjct: 97  YTIKEAERGVVTRFGKFSH-LVQPGLNWKPTFIDDVIPVNV---------ESVRELAASG 146

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VT+P  YLFN+ N  ++L+Q ++SA+R V+G+     I   
Sbjct: 147 VMLTSDENVVRVEMNVQYRVTNPEEYLFNVTNADDSLRQATDSALRAVIGKYTMDTILTE 206

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + + ++++ +  Y  GI I  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 207 GRTVIRNDTQKVLEEIIRPYHMGITILDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 266

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYKDR + EAQGE  RF  +  +Y  +P + R+R+Y
Sbjct: 267 AEAYANEVQPRANGQAQRILEDAKAYKDRTVLEAQGEVGRFSRLLPEYKASPEITRERLY 326

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           LETME +L   +KV++D K + +  LPL++
Sbjct: 327 LETMERVLGHTRKVLVDDKSNNLMVLPLDQ 356


>gi|157964189|ref|YP_001499013.1| protease activity modulator HflK [Rickettsia massiliae MTU5]
 gi|157843965|gb|ABV84466.1| Protease activity modulator HflK [Rickettsia massiliae MTU5]
          Length = 346

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 96/316 (30%), Positives = 179/316 (56%), Gaps = 26/316 (8%)

Query: 39  DKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGK------PKNDVFL 92
           D+F   PF  +  ++ + ++ + +      IY +   E A  +RFG+      P  +  L
Sbjct: 38  DQFQC-PFNFNAKTIILAVVAVVALWLASGIYEIKEGEEAAVIRFGRLVRKGSPGLNYHL 96

Query: 93  PGLHMMFWPIDQVEIVKVIE-RQQKIGGRSASV----GSNS------GLILTGDQNIVGL 141
           P       P +++ + KV + R+ +IG R+ S     G N+       ++LTGD+NIV L
Sbjct: 97  PA------PFEKIIVEKVKQSRRIEIGYRTNSFLRSGGDNTKNIAGESIMLTGDENIVAL 150

Query: 142 HFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNL 201
           +  V++ + +   ++FN++ P ET+K   ESA+REV+G      +   Q+Q+I  ++  L
Sbjct: 151 NCDVMWHINNLEDFIFNVQRPEETVKATVESAVREVIGNTPISWVLSDQKQEITYKIEKL 210

Query: 202 IQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSA 261
            QK +D Y +G++I  + +  A PP EV DA+ +VQ ++ D+++ + ++  Y+N++L  A
Sbjct: 211 AQKILDSYNAGVMIEKVQLLKAEPPAEVIDAYRDVQTSKADKEKEINQAQAYNNKILPEA 270

Query: 262 RGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAK 321
           RG A+ I + +  Y++ +I +A+G++ RF +IY QY     + R R+YLE +E IL  + 
Sbjct: 271 RGAAAKIIQEAEGYREEVISKAEGDSQRFNAIYKQYATGRQVTRDRLYLEVVEEILGGSN 330

Query: 322 KVIIDKKQSVMPYLPL 337
           K II+   +++P++ +
Sbjct: 331 KTIIN--NALLPHMAI 344


>gi|239616669|ref|YP_002939991.1| HflK protein [Kosmotoga olearia TBF 19.5.1]
 gi|239505500|gb|ACR78987.1| HflK protein [Kosmotoga olearia TBF 19.5.1]
          Length = 321

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 99/277 (35%), Positives = 155/277 (55%), Gaps = 8/277 (2%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE-RQQKIGGRSASVG-- 125
           + V P E  +  RFG     V  PGLH    +PI+ V  V V   R+Q+IG R+ S G  
Sbjct: 39  FFVGPAEVGLVKRFGAHIKTVG-PGLHYHLPYPIESVVKVNVSALRKQEIGFRTVSPGRY 97

Query: 126 ---SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRF 182
               N  L+LTGD NIV +   V Y V DP  + FNL N  + ++ VSE+ +RE V    
Sbjct: 98  TSVKNESLMLTGDGNIVSVEAVVQYYVKDPEQFAFNLINDEQVVRFVSEAILREEVAAAS 157

Query: 183 AVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQD 242
             ++   +R  IA +    +Q  +D    GI +  + +++ SPP +V  AFD+V  A+QD
Sbjct: 158 IDEVLTFERDVIAAKTAERVQDVLDQLNVGIEVKNVYLQEVSPPEQVVAAFDDVNNAKQD 217

Query: 243 EDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPT 302
           +++   E+ +Y N ++  A GEA  I   + AY + +I +A+GEA+RF  ++G+Y  AP 
Sbjct: 218 KEKLRNEAERYKNDLIPRAEGEAVQIVREAEAYAEELILKAKGEAERFTKVFGEYKKAPK 277

Query: 303 LLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           + R R+YLE +  ILK ++K ++  K  V+ +L L++
Sbjct: 278 ITRTRLYLEMLNRILKDSEKFVLLSKDGVLKFLDLSK 314


>gi|218530836|ref|YP_002421652.1| HflK protein [Methylobacterium chloromethanicum CM4]
 gi|240139406|ref|YP_002963881.1| protease subunit hflK [Methylobacterium extorquens AM1]
 gi|254561822|ref|YP_003068917.1| protease subunit hflK [Methylobacterium extorquens DM4]
 gi|218523139|gb|ACK83724.1| HflK protein [Methylobacterium chloromethanicum CM4]
 gi|240009378|gb|ACS40604.1| protease subunit hflK [Methylobacterium extorquens AM1]
 gi|254269100|emb|CAX25063.1| protease subunit hflK [Methylobacterium extorquens DM4]
          Length = 382

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 110/295 (37%), Positives = 160/295 (54%), Gaps = 20/295 (6%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKV-IERQQKIGGRSASVGS- 126
           YIV P+E  +   FG+        GL   F +PI  V+   V I     IG  +A   + 
Sbjct: 84  YIVKPNEVGINTIFGRYTGQSG-EGLRYNFPYPIGSVQKPNVGIVNSIPIGYMAAGNTTR 142

Query: 127 -----NSGLILTGDQNIVGLHFSVLYVVTDPRL--YLFNLENPGETLKQVSESAMREVVG 179
                   L+LTGD+NIV + F V + V   +   Y+FNL NP  T+K ++ESAMREV+G
Sbjct: 143 QRDVPEESLMLTGDENIVDIDFEVQWRVNPLKAEDYVFNLANPDGTIKAIAESAMREVIG 202

Query: 180 RRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRA 239
           RR    I  +++  I+ EV+ ++Q  +D Y +G+ I  + +   +PP EV  AF +V  A
Sbjct: 203 RRNIQAILTNEQSSISQEVKEIVQSALDEYGAGVRIEVVQLTSVTPPPEVRPAFIDVNAA 262

Query: 240 EQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVN 299
           +Q   +   E+  Y++RV   ARG AS + +++ AYK +   EA G+A RF  +Y  Y  
Sbjct: 263 QQYAQQVRNEAETYASRVTPEARGNASKVMQAAEAYKSQATSEATGQASRFRQVYDSYKV 322

Query: 300 APTLLRKRIYLETMEGILKKAKKVIIDK--------KQSVMPYLPLNEAFSRIQT 346
           AP ++R+RI+LETME +L    KVIID+           V+P LPL E   R QT
Sbjct: 323 APEVIRERIFLETMERVLGSVNKVIIDQNGGVAGANAAGVLPVLPLMEN-GRTQT 376


>gi|91788463|ref|YP_549415.1| HflK protein [Polaromonas sp. JS666]
 gi|91697688|gb|ABE44517.1| protease FtsH subunit HflK [Polaromonas sp. JS666]
          Length = 474

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 105/307 (34%), Positives = 171/307 (55%), Gaps = 17/307 (5%)

Query: 45  PFFKSYG------SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
           P  KS G      +   +L+ +G+       +IV   ++AV  +FGK  + V       +
Sbjct: 117 PDMKSAGIGAGLIAAVAVLIWLGT-----GFFIVQEGQQAVITQFGKYHSTVGAGFNWRL 171

Query: 99  FWPIDQVEIVKVIERQQKIGGRSA---SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLY 155
            +P+ + E+V V + +    GR     + G     +LT D+NIV + F+V Y ++D R Y
Sbjct: 172 PYPVQRHEMVVVTQIRSVDVGRDTIIKATGLRDSAMLTEDENIVEIKFAVQYRLSDARAY 231

Query: 156 LFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILI 215
           LF  ++P   + Q +E+A+REVVG+         +R QI   VR L+Q  +D YK G+ +
Sbjct: 232 LFESKDPASAVVQAAETAVREVVGKMKMDLALADERDQIGPRVRALMQIILDRYKVGVEV 291

Query: 216 NTISIEDAS--PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
             I+++ +   PP +V  AFD+V RA Q+ +R   E+  Y+N V+  A G AS ++E S 
Sbjct: 292 VGINLQQSGVRPPEQVQAAFDDVLRAGQERERSKNEAQAYANDVIPRAVGSASRLKEESE 351

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVM 332
           AYK RI+ +AQG+A RF S+  +Y  AP + R R+YL+ M+ +     KV+++ +Q S +
Sbjct: 352 AYKARIVAQAQGDAQRFRSVLTEYQKAPQVTRDRMYLDAMQQVYTNVTKVLVESRQGSNL 411

Query: 333 PYLPLNE 339
            YLPL++
Sbjct: 412 LYLPLDK 418


>gi|50122852|ref|YP_052019.1| FtsH protease regulator HflK [Pectobacterium atrosepticum SCRI1043]
 gi|49613378|emb|CAG76829.1| putative phage-related protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 417

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 95/270 (35%), Positives = 152/270 (56%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V  V V          S    + SG
Sbjct: 97  YTIKEAERGVVTRFGKFSH-LVGPGLNWKPTFIDSVRAVNV---------ESVRELATSG 146

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VT P  YLF++ N  ++L+Q ++SA+R V+G+     I   
Sbjct: 147 VMLTSDENVVRVEMNVQYRVTQPEQYLFSVTNADDSLRQATDSALRGVIGKYTMDKILTE 206

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 207 GRTIVRTDTQRVLEETVRPYNMGITLLDVNFQTARPPEEVKAAFDDAIAARENEQQYIRE 266

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E S AYK R + EAQGE  RF  +  +Y  AP + R+R+Y
Sbjct: 267 AEAYANEVQPRANGQAQRILEESRAYKTRTVLEAQGEVARFARVLPEYKAAPEITRERLY 326

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K S +  LPL++
Sbjct: 327 IETMERVLSHTRKVLVNDKGSNLMVLPLDQ 356


>gi|317051947|ref|YP_004113063.1| HflK protein [Desulfurispirillum indicum S5]
 gi|316947031|gb|ADU66507.1| HflK protein [Desulfurispirillum indicum S5]
          Length = 368

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 103/298 (34%), Positives = 174/298 (58%), Gaps = 17/298 (5%)

Query: 56  ILLLIGSFCAFQS--IYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE 112
           ++LL+    A+ S  I I+ P+E+A  LRFGK  +    PG H+   +PI++  +  V  
Sbjct: 64  VILLVVILLAWLSTGILILKPEEQAAILRFGK-YDRTLGPGPHITLPYPIERRYVASVTT 122

Query: 113 RQQ-KIGGRSA---------SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENP 162
            Q+ +IG RSA         SVG  S L+LTGD+NI+ +   V + + D   Y+F + + 
Sbjct: 123 VQRLEIGFRSAASQRDDRIISVGQES-LMLTGDENILDVKVIVQFRIRDIIDYMFEVRDS 181

Query: 163 GETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIED 222
            +TL+  + S++REV+G     +     + +I + +R  +QK ++ Y++G+ I ++ + D
Sbjct: 182 LQTLQNTAASSVREVMGGESIDNALTVGKFEIQMNIREQLQKALNEYRAGLEILSVELYD 241

Query: 223 ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQE 282
             PP++VA AF EV  A +D +RF+ ++  Y N++L  ARGEA+ I E++ AY++  I  
Sbjct: 242 VQPPQQVAGAFREVVSAREDRERFINQAQGYRNQILPQARGEAAQIMEAASAYREERILR 301

Query: 283 AQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLN 338
           A+G+  RFL++  +Y  AP + R R+  +T++  L K K  +ID      V+PYLPL+
Sbjct: 302 ARGDVARFLAMESEYRLAPAVTRDRLMFDTLQETLPKTKLFLIDSDAGSGVLPYLPLD 359


>gi|77359240|ref|YP_338815.1| hypothetical protein PSHAa0273 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76874151|emb|CAI85372.1| HflK complex with HflC [Pseudoalteromonas haloplanktis TAC125]
          Length = 389

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 108/354 (30%), Positives = 184/354 (51%), Gaps = 30/354 (8%)

Query: 17  GSNGN---------GDGLPPFDVEAIIRYIKDKFDLIPFFKS----------YGSVYIIL 57
           G+NGN         G    P D++ ++R   +KF  +   K              +  IL
Sbjct: 7   GNNGNDKDPWNNKGGRDQGPPDLDEVLRKFSNKFSGLFGGKKPGNGSGGGLGGAGISFIL 66

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           ++     A   IY V   ER V L+FGK  + +  PGL    W +  +E +  ++ +   
Sbjct: 67  IIAVIVWALSGIYTVKEAERGVVLQFGK-YDRIADPGLR---WKMTFIETIIPVDIE--- 119

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
             RS S    SG +LT D+N+V + F V Y V DP LY F++ N   +L++  ESA+R V
Sbjct: 120 AVRSLST---SGFMLTEDENVVSVEFQVQYRVIDPYLYKFSVTNADSSLEEALESALRYV 176

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG      +  + R+ +     + + K ++ Y  G+++  ++ +D+ PP EV DAFD+  
Sbjct: 177 VGHAKMDQVLTNGREVVRQNTWDELNKVIEPYNLGLIVTDVNFKDSRPPAEVKDAFDDAI 236

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
            A++DE+RF+ E+  Y+  +   ARG+ + + + +  Y++RI  EAQGE  RF  +  +Y
Sbjct: 237 AAQEDEERFIREAEAYAREIEPRARGQVTRMTQEAEGYQERITLEAQGEVARFEKLLPEY 296

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKREI 350
             A T+ R+R+Y++ M+ +L  + KV++D K  + M YLPL++   +  T   +
Sbjct: 297 QAAKTVTRERLYIDAMQEVLGNSSKVLVDVKGGNNMMYLPLDKIMEKQGTATRV 350


>gi|94676792|ref|YP_589007.1| HflK protein [Baumannia cicadellinicola str. Hc (Homalodisca
           coagulata)]
 gi|94219942|gb|ABF14101.1| HflK protein [Baumannia cicadellinicola str. Hc (Homalodisca
           coagulata)]
          Length = 386

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 98/288 (34%), Positives = 161/288 (55%), Gaps = 11/288 (3%)

Query: 52  SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI 111
           S+YI L++I        +Y +   ER V LRFGK    V  PGL+     ID V +V V 
Sbjct: 56  SLYICLIVITLIWLGSGLYTIKEAERGVVLRFGKFYRLVN-PGLNWKPTFIDTVTMVNV- 113

Query: 112 ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSE 171
                    S    + SG++LT D+N+V +  +V Y +TDP  YLF++ +  ++L+Q ++
Sbjct: 114 --------ESVRELAASGVMLTSDENVVRVEMNVQYRITDPERYLFSVTDADDSLRQATD 165

Query: 172 SAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231
           SA+R V+G+     I    R  +  + + ++++T+  Y  G+ +  ++ + A PP EV  
Sbjct: 166 SALRGVIGKYTMDRILTEGRTVVRSDTQRVLEETIQPYNMGLTLLDVNFQAARPPEEVKA 225

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           AFD+   A ++E +++ E+  Y+N V   A G+A  I E   AYK R I EA+GE  RF 
Sbjct: 226 AFDDAIAARENEQQYIREAEAYANEVQPRANGQAQRILEEGRAYKARTILEAKGEVQRFA 285

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLN 338
            +  +Y  AP + R+R+Y++ ME +L K  K+I+++K S  +  LPL+
Sbjct: 286 KVLPEYKAAPEVTRERLYIDAMERLLSKTNKIIVNEKNSNNLILLPLD 333


>gi|329911738|ref|ZP_08275597.1| HflK protein [Oxalobacteraceae bacterium IMCC9480]
 gi|327545809|gb|EGF30932.1| HflK protein [Oxalobacteraceae bacterium IMCC9480]
          Length = 353

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 105/334 (31%), Positives = 171/334 (51%), Gaps = 31/334 (9%)

Query: 25  LPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIG-SFCAF--QSIYIVHPDERAVEL 81
           +PP D++ + +  + +         +G   I L++ G  F AF   S + V P+E  V  
Sbjct: 1   MPPPDIDDMAKDFRQRA------ARFGVRRIALVIAGLVFLAFMMSSWFTVQPEETGVVQ 54

Query: 82  RFGKPKNDVFLPGLHMMFWPID-----QVEIVKVIERQQKIGGRSASVGSNS-------- 128
           RFG   N    PGLH  F PI       V   +V++ +      S   G  S        
Sbjct: 55  RFGA-VNRTVGPGLHYKF-PIGIERARMVPTARVLKEEFGFLTTSTGAGERSQYAAEKTK 112

Query: 129 ----GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAV 184
                L+LTGD N++ + + V Y + DP  +LF + +  +T++  +E+ MR+VVG R   
Sbjct: 113 FKEVSLMLTGDLNVIDVQWIVQYRIEDPVQFLFQVRDSRQTIRDTAEAVMRQVVGNRLGS 172

Query: 185 DIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDED 244
           D+    R  ++ EV+  +Q+ +  Y++G+ + T+ ++D +PP  V  AF+EV +A QD +
Sbjct: 173 DVLTVGRVAVSTEVKEEMQRLLTGYRTGVRLVTVELQDVTPPDPVKPAFNEVNKARQDRE 232

Query: 245 RFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLL 304
           R + ++ + +NR +  ARGEA+     +  Y    +  AQGEA RF +I   Y  AP + 
Sbjct: 233 RIINQAQERANREIPQARGEANRTISEAEGYAVERVNRAQGEATRFTTILADYRKAPEVT 292

Query: 305 RKRIYLETMEGILKKAKKV-IIDKKQSVMPYLPL 337
           R+R+YLE M  +L  AK + ++D  Q  M  LPL
Sbjct: 293 RQRLYLEAMSTLLPGAKSLYVVDSDQKAM--LPL 324


>gi|251788134|ref|YP_003002855.1| HflK protein [Dickeya zeae Ech1591]
 gi|247536755|gb|ACT05376.1| HflK protein [Dickeya zeae Ech1591]
          Length = 420

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 99/289 (34%), Positives = 157/289 (54%), Gaps = 13/289 (4%)

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
           G V    L++     F   Y +   ER V  RFGK  + V  PGL+     +D V  V V
Sbjct: 77  GLVVAAALVVWGVSGF---YTIKEAERGVVTRFGKFSHLVG-PGLNWKPTFVDSVRAVNV 132

Query: 111 IERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
                     S    + SG++LT D+N+V +  +V Y VT P  YLF++ N  ++L+Q +
Sbjct: 133 ---------ESVRELATSGVMLTSDENVVRVEMNVQYRVTQPDKYLFSVTNADDSLRQAT 183

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
           +SA+R V+G+     I    R  +  + + ++++T+  Y  GI +  ++ + A PP EV 
Sbjct: 184 DSALRGVIGKYTMDKILTEGRTIVRTDTQRVLEETVRPYDMGITLLDVNFQTARPPEEVK 243

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
            AFD+   A ++E +++ E+  Y+N V   A G+A  I E S AYKDR + EAQGE  RF
Sbjct: 244 AAFDDAIAARENEQQYIREAEAYANEVQPRANGQAQRILEESRAYKDRTVLEAQGEVSRF 303

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
             +  +Y  AP + R+R+Y+ETME +L    KV++  K + +  LPL++
Sbjct: 304 SRLLPEYKAAPEITRERLYIETMERVLSHTNKVLVSDKSNNLMVLPLDQ 352


>gi|163852078|ref|YP_001640121.1| HflK protein [Methylobacterium extorquens PA1]
 gi|163663683|gb|ABY31050.1| HflK protein [Methylobacterium extorquens PA1]
          Length = 382

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 107/288 (37%), Positives = 157/288 (54%), Gaps = 19/288 (6%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKV-IERQQKIGGRSASVGS- 126
           YIV P+E  +   FG+        GL   F +PI  V+   V I     IG  +A   + 
Sbjct: 84  YIVKPNEVGINTIFGRYTGQSG-EGLRYNFPYPIGSVQKPNVGIVNSIPIGYMAAGNTTR 142

Query: 127 -----NSGLILTGDQNIVGLHFSVLYVVTDPRL--YLFNLENPGETLKQVSESAMREVVG 179
                   L+LTGD+NIV + F V + V   +   Y+FNL NP  T+K ++ESAMREV+G
Sbjct: 143 QRDVPEESLMLTGDENIVDIDFEVQWRVNPLKAEDYVFNLANPDGTIKAIAESAMREVIG 202

Query: 180 RRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRA 239
           RR    I  +++  I+ EV+ ++Q  +D Y +G+ I  + +   +PP EV  AF +V  A
Sbjct: 203 RRNIQAILTNEQSSISQEVKEIVQSALDEYGAGVRIEVVQLTSVTPPPEVRPAFIDVNAA 262

Query: 240 EQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVN 299
           +Q   +   E+  Y++RV   ARG AS + +++ AYK +   EA G+A RF  +Y  Y  
Sbjct: 263 QQYAQQVRNEAETYASRVTPEARGNASKVMQAAEAYKSQATSEATGQASRFRQVYDSYKV 322

Query: 300 APTLLRKRIYLETMEGILKKAKKVIIDK--------KQSVMPYLPLNE 339
           AP ++R+RI+LETME +L    KVIID+           V+P LPL E
Sbjct: 323 APEVIRERIFLETMERVLGSVNKVIIDQNGGVAGANAAGVLPVLPLME 370


>gi|90414473|ref|ZP_01222449.1| putative Membrane protease subunit [Photobacterium profundum 3TCK]
 gi|90324478|gb|EAS41037.1| putative Membrane protease subunit [Photobacterium profundum 3TCK]
          Length = 387

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 101/286 (35%), Positives = 160/286 (55%), Gaps = 11/286 (3%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           ++ +L  +   F   Y +   ER V LRFGK   ++  PGL+     +D+V  V V    
Sbjct: 66  VVAVLATAVWGFSGFYTIGEAERGVVLRFGK-FYEMVDPGLNWKPTFVDEVTPVNV---- 120

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
           Q I  RS     +SGL+LT D+N++ +   V Y V++ + YLF++ N  ++L+Q ++SA+
Sbjct: 121 QAI--RSLR---SSGLMLTKDENVLKVEMDVQYRVSEAQNYLFSVTNADDSLRQATDSAL 175

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           R V+G     +   + RQ I    +  I+K ++ Y  GIL+  ++ + A PP EV DAFD
Sbjct: 176 RAVIGDSTMDEALTTGRQVIRASTQEAIEKIIENYDMGILVVDVNFQSARPPSEVQDAFD 235

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +   A +DE+RFV ES  YSN +L  A G A  +++ +  Y ++ I  A GE  +F  + 
Sbjct: 236 DAIAAREDEERFVRESEAYSNDILPKATGHAERLKKEAQGYSEKTINGALGEVAQFEKLL 295

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNE 339
            +Y  A  + R R+YLETME +     KV+ID K +  + YLPL++
Sbjct: 296 PEYEVAKDVTRSRLYLETMERVYSNTSKVMIDSKSNGNLLYLPLDK 341


>gi|311745514|ref|ZP_07719299.1| HflK protein [Algoriphagus sp. PR1]
 gi|126578072|gb|EAZ82292.1| HflK protein [Algoriphagus sp. PR1]
          Length = 325

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 97/289 (33%), Positives = 165/289 (57%), Gaps = 15/289 (5%)

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM--FWPIDQVEIVKVIERQQKIGGRSAS 123
           F SI  V P+E  V ++ G+  N    PGL+ +  FW     +I    + +Q+ G R+  
Sbjct: 33  FTSIRTVGPEEEGVVIQLGQ-YNRTVNPGLNFIVPFWIERMYKIPVQRQLKQEFGFRTTK 91

Query: 124 VGSNS----------GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESA 173
            G  S           ++LTGD N+  + + V Y +T+   +LF + N  +TL+ +SES 
Sbjct: 92  AGQRSDYTKEGFGDESMMLTGDLNLTDVEWVVQYRITNSYNFLFKVRNAEKTLRDMSESV 151

Query: 174 MREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAF 233
           MR+VVG R   ++    RQ+IA  V  L+Q+  D Y++GI I+ + ++D +PP  V  +F
Sbjct: 152 MRKVVGDRTVNEVLTVGRQEIATTVEGLLQELCDEYENGIRIDQVVLQDVNPPESVKPSF 211

Query: 234 DEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSI 293
           + V +A+Q+ +  + ++    NRV+  ARGEA    + + A+    +  A+GEA+RF ++
Sbjct: 212 NAVNQAQQERETLINQAEAEYNRVIPRARGEAEETIQLAEAFALNRVNRAKGEAERFNAL 271

Query: 294 YGQYVNAPTLLRKRIYLETMEGILKK-AKKVIIDKK-QSVMPYLPLNEA 340
           +  Y+ +P + ++RIYLETME IL K   K+I+D+K  +V+P L +++ 
Sbjct: 272 FNAYIKSPEVTKQRIYLETMEKILPKIGNKIIVDEKGNNVLPLLNIDQV 320


>gi|227326197|ref|ZP_03830221.1| FtsH protease regulator HflK [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 419

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 96/270 (35%), Positives = 151/270 (55%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V  V V          S    + SG
Sbjct: 97  YTIKEAERGVVTRFGKFSH-LVGPGLNWKPTFIDSVRAVNV---------ESVRELATSG 146

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VT P  YLF++ N  ++L+Q ++SA+R V+G+     I   
Sbjct: 147 VMLTSDENVVRVEMNVQYRVTQPEQYLFSVTNADDSLRQATDSALRGVIGKYTMDKILTE 206

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 207 GRTIVRTDTQRVLEETVRPYNMGITLLDVNFQTARPPEEVKAAFDDAIAARENEQQYIRE 266

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E S AYK R I EAQGE  RF  I  +Y  AP + R+R+Y
Sbjct: 267 AEAYANEVQPRANGQAQRILEESRAYKTRTILEAQGEVARFARILPEYKAAPEITRERLY 326

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K   +  LPL++
Sbjct: 327 IETMERVLSHTRKVLVNDKGGNLMVLPLDQ 356


>gi|157363838|ref|YP_001470605.1| HflK protein [Thermotoga lettingae TMO]
 gi|157314442|gb|ABV33541.1| HflK protein [Thermotoga lettingae TMO]
          Length = 306

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 95/264 (35%), Positives = 152/264 (57%), Gaps = 8/264 (3%)

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKV-IERQQKIGGRSASVGS 126
           +Y V+P + A+   FGK  +    PG+H    +P     IV V   R+Q+IG R+   G 
Sbjct: 23  VYQVNPSQVALVKTFGK-YSHTSGPGIHFHAPFPFQTHVIVDVQTVRKQEIGFRTVRPGQ 81

Query: 127 -----NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRR 181
                +  LILT D NIV +   V Y V DP  ++FN+ENP E +K  +ESA+R+ + +R
Sbjct: 82  YVQKQDEALILTKDGNIVSVEAVVQYRVNDPIKFVFNVENPEELVKFTTESALRDRISKR 141

Query: 182 FAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQ 241
              DI  S+R  +A E   + Q+ +D Y  G+ +  + +++  PP+ V  AFD+V  A+Q
Sbjct: 142 TVDDILTSERDTVAYETHQIAQQLLDQYDVGVTVLNVLLQEVVPPQPVIAAFDDVNNAKQ 201

Query: 242 DEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAP 301
           D++R++ E+ KY+N ++ S  GE   I   + AY  + + +A GE  RFLSI  +Y  +P
Sbjct: 202 DKERYINEATKYANNLIPSVEGETRKIVLDAEAYAQQKVLQAVGETQRFLSILKEYETSP 261

Query: 302 TLLRKRIYLETMEGILKKAKKVII 325
            +   R+ +ET+E +L KAK++I+
Sbjct: 262 EITEIRLKIETLEEVLPKAKRIIL 285


>gi|119946424|ref|YP_944104.1| HflK protein [Psychromonas ingrahamii 37]
 gi|119865028|gb|ABM04505.1| HflK protein [Psychromonas ingrahamii 37]
          Length = 357

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 106/303 (34%), Positives = 174/303 (57%), Gaps = 18/303 (5%)

Query: 54  YIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM-MFWPIDQVEIVKVIE 112
           YI+ LL+     + +IY +  D  AV  RFGK   +V   GLH+ M   ID+  IV V  
Sbjct: 52  YILFLLLAGISLWSAIYTIPSDSVAVVQRFGKYLKEV-PAGLHIKMPLGIDRATIVPVKR 110

Query: 113 R-QQKIGGRSASVG---SNSGL--------ILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
           + +Q+ G  +        +SG+        ++TGD N   + + V Y + DP  +LF + 
Sbjct: 111 QLKQEFGFTTPDATDPYQSSGVRASEQETQMVTGDLNAALVEWVVQYRIADPVKFLFKVR 170

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
            P ETL+ VSES MREVVG R   ++    RQ+I  E    +Q     Y+ GI I+ + +
Sbjct: 171 QPSETLRSVSESVMREVVGDRTVDEVITIGRQEIEYEALTKMQALSSKYEMGISIDQVQL 230

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASH-IRESSIAYKDRI 279
           ++ +PP+ V  +F+EV +A+Q++++ + E+ +  N+V+  A GE    IRE+   Y+ + 
Sbjct: 231 KNINPPKPVQASFNEVNQAQQEKEKLINEARRDYNKVIPLALGEKDQRIREAD-GYRLKR 289

Query: 280 IQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAK-KVIIDKKQ-SVMPYLPL 337
           I EA+G+  RF +++ +Y+ AP + ++RIYLETM+ +L + + K+IID    S++P+L L
Sbjct: 290 INEAEGDVARFNALFAEYLKAPEVTKRRIYLETMQAVLPQIRSKIIIDSNSPSILPWLDL 349

Query: 338 NEA 340
           N A
Sbjct: 350 NAA 352


>gi|300691799|ref|YP_003752794.1| protein hflK, cofactor of ATP-dependent protease FtsH [Ralstonia
           solanacearum PSI07]
 gi|299078859|emb|CBJ51520.1| Protein hflK, cofactor of ATP-dependent protease FtsH [Ralstonia
           solanacearum PSI07]
          Length = 459

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 104/314 (33%), Positives = 171/314 (54%), Gaps = 11/314 (3%)

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVK 109
           G   ++ +L+G + A    +IV   +  V L+FG+ K     PG++    +PI+  EIV 
Sbjct: 106 GVGVLLAVLVGLWLA-SGFFIVQEGQTGVILQFGRFKYQA-TPGINWRLPYPIETHEIVN 163

Query: 110 VIERQQKIGGRSASVGSNS---GLILTGDQNIVGLHFSVLYVVTDPRLYLF----NLENP 162
           +   +    GR+  +   +     +LT D+NIV + FSV Y + DP  YLF    +    
Sbjct: 164 LSGVRTLEIGRTTQIKDTNLKDSSMLTQDENIVDVRFSVQYNIADPVEYLFYNRTDQRGD 223

Query: 163 GETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIED 222
            E + Q +E+++RE+VGR     +    R  +   +   IQ+ +  YK+GI I +++++ 
Sbjct: 224 EELVTQAAETSVREIVGRNKMDAVLYEGRDAVGRNLGESIQRILSAYKTGIRILSVNVQS 283

Query: 223 ASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQE 282
             PP +V  AFD+V +A QD +R + E   Y+N V+  A+G A+ + E +  YK R++  
Sbjct: 284 VQPPEQVQAAFDDVTKAGQDRERAISEGQAYANDVVPRAKGTAARLGEEAQGYKARVVAR 343

Query: 283 AQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAF 341
           A+G+A RF S+  +Y  AP + R RIYLETM+ I   A KV++D+  S  + YLPL++  
Sbjct: 344 AEGDAARFASVQREYAKAPQVTRDRIYLETMQDIYANATKVLVDQNGSGNLLYLPLDKLI 403

Query: 342 SRIQTKREIRWYQS 355
           ++ Q     R  QS
Sbjct: 404 TQSQAADAARPQQS 417


>gi|197335058|ref|YP_002157117.1| protease activity modulator HflK [Vibrio fischeri MJ11]
 gi|197316548|gb|ACH65995.1| protease activity modulator HflK [Vibrio fischeri MJ11]
          Length = 402

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 95/299 (31%), Positives = 164/299 (54%), Gaps = 13/299 (4%)

Query: 44  IPFFKSYGSVYIILLLIGSFC--AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP 101
           +P F + G+V + L+ + +     F   Y +   +R V LRFG+  + +  PGL+     
Sbjct: 65  LPSFGNGGAVGLGLIAVVAIAIWVFSGFYTIGESDRGVVLRFGQ-YDRMVDPGLNWKPTF 123

Query: 102 IDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
           IDQV  V +         +S    ++ GL+LT D+N+V +   V Y V D   YL+ + N
Sbjct: 124 IDQVTPVNI---------QSIRSLNSKGLMLTKDENVVTVEMGVQYRVADAHKYLYTVTN 174

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
             ++L+Q ++SA+R V+G     DI  S RQ+I    +  + + +D Y  G+++  ++ +
Sbjct: 175 ADDSLRQATDSALRAVIGDAKMDDILTSGRQEIRQRTQETLNRIIDKYDMGLIVVDVNFQ 234

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
            A PP +V  +FD+   A +DE+RF+ E+  YSN +L  A G A  +++ +  Y +R + 
Sbjct: 235 SARPPEQVKASFDDAIAAREDEERFIREAEAYSNDILPKATGRAERLKKEAQGYTERKVN 294

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
           EA G+  +F  +  +Y  AP + R R+YL+TME +     KV+ID + +  + YLPL++
Sbjct: 295 EAIGQIAQFEKLLPEYNKAPEVTRTRLYLDTMERVYSNTSKVLIDSESNGNLLYLPLDK 353


>gi|59712928|ref|YP_205704.1| modulator for HflB protease specific for phage lambda cII repressor
           [Vibrio fischeri ES114]
 gi|59481029|gb|AAW86816.1| modulator for HflB protease specific for phage lambda cII repressor
           [Vibrio fischeri ES114]
          Length = 401

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 95/299 (31%), Positives = 164/299 (54%), Gaps = 13/299 (4%)

Query: 44  IPFFKSYGSVYIILLLIGSFC--AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP 101
           +P F + G+V + L+ + +     F   Y +   +R V LRFG+  + +  PGL+     
Sbjct: 64  LPSFGNGGAVGLGLIAVVAIAIWVFSGFYTIGESDRGVVLRFGQ-YDRMVDPGLNWKPTF 122

Query: 102 IDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
           IDQV  V +         +S    ++ GL+LT D+N+V +   V Y V D   YL+ + N
Sbjct: 123 IDQVTPVNI---------QSIRSLNSKGLMLTKDENVVTVEMGVQYRVADAHKYLYTVTN 173

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
             ++L+Q ++SA+R V+G     DI  S RQ+I    +  + + +D Y  G+++  ++ +
Sbjct: 174 ADDSLRQATDSALRAVIGDAKMDDILTSGRQEIRQRTQETLNRIIDKYDMGLIVVDVNFQ 233

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
            A PP +V  +FD+   A +DE+RF+ E+  YSN +L  A G A  +++ +  Y +R + 
Sbjct: 234 SARPPEQVKASFDDAIAAREDEERFIREAEAYSNDILPKATGRAERLKKEAQGYTERKVN 293

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
           EA G+  +F  +  +Y  AP + R R+YL+TME +     KV+ID + +  + YLPL++
Sbjct: 294 EAIGQIAQFEKLLPEYNKAPEVTRTRLYLDTMERVYSNTSKVLIDSESNGNLLYLPLDK 352


>gi|329895356|ref|ZP_08270981.1| HflK protein [gamma proteobacterium IMCC3088]
 gi|328922369|gb|EGG29713.1| HflK protein [gamma proteobacterium IMCC3088]
          Length = 389

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 108/349 (30%), Positives = 187/349 (53%), Gaps = 32/349 (9%)

Query: 11  RPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLI---------------PFFKSYGSVYI 55
           RP    GS GN     P D++  ++ ++DK + I                    +G V  
Sbjct: 12  RPNDPWGSGGNQG---PPDLDEALKKVQDKINAIFGGGSGGRSGGPSKGASSAFFGVVAA 68

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQ 115
             L+I     F   Y +   ERAV LRFG+  + V  PGL      ID+V  + V + + 
Sbjct: 69  AALVIWGVMGF---YQIDEQERAVVLRFGEYHSTV-TPGLQWNPPLIDEVIKLNVTKVRA 124

Query: 116 KIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMR 175
           +         S   ++LT D+NIV ++ SV YV+ +P  ++  + +P  +L+  ++SA+R
Sbjct: 125 Q---------SFREVMLTKDENIVDVNMSVQYVINNPEHFVLKVRDPEVSLQHATQSALR 175

Query: 176 EVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDE 235
            VVG      +    R  IALEV+  +Q  +D Y++GI ++ +++++A PP +V  AFD+
Sbjct: 176 HVVGDNKMDLVLTEGRAAIALEVQQRVQNLLDNYQTGIQVSKVTVDNAQPPSQVQAAFDD 235

Query: 236 VQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYG 295
           V +A +DE+R   E+  Y+N ++  ARG+A    E + AY ++++  A+GEA+RF  +  
Sbjct: 236 VIKAREDEERVKNEAQAYANGIIPEARGQAQRQIEEANAYLEQVVANAEGEANRFTKLLA 295

Query: 296 QYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSR 343
           +Y  AP + R+R+YL+ +  +  ++ KV++D +  + M YLPL++   R
Sbjct: 296 EYRKAPEVTRERLYLDAITSVYGQSSKVMVDVEGGNNMMYLPLDKLMER 344


>gi|309782314|ref|ZP_07677041.1| HflK protein [Ralstonia sp. 5_7_47FAA]
 gi|308918932|gb|EFP64602.1| HflK protein [Ralstonia sp. 5_7_47FAA]
          Length = 434

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 99/296 (33%), Positives = 167/296 (56%), Gaps = 10/296 (3%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQK 116
           +L+G + A    +IV   +  V L+FG+ K  +  PG++    +P++  EIV +   +  
Sbjct: 90  VLVGLWLA-SGFFIVQEGQTGVILQFGRFKY-LATPGINWRLPYPVESHEIVNLSGVRTL 147

Query: 117 IGGRSASVGSNS---GLILTGDQNIVGLHFSVLYVVTDPRLYLF-NLENPG---ETLKQV 169
             GR+  +   +     +LT D+NIV + FSV Y + +P  YLF N  + G   E + Q 
Sbjct: 148 EIGRTTQIKDTNLKDSSMLTQDENIVDVRFSVQYNIANPVDYLFYNRTDRGGDEELVTQA 207

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           +E+++RE+VGR     +    R  +   +   IQ+ +  YK+GI I +++++   PP +V
Sbjct: 208 AETSVREIVGRNKMDAVLYEGRDAVGRNLAESIQRILSAYKTGIRILSVNVQSVQPPEQV 267

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
             AFD+V +A QD +R + E   Y+N V+  A+G A+ + E +  YK R+I  A+G+A R
Sbjct: 268 QAAFDDVTKAGQDRERAISEGQAYANDVVPRAKGTAARLGEEAQGYKARVIARAEGDAAR 327

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQ 345
           F S+  +Y  AP + R RIYLETM+ I   + KV++D+    + YLPL++  ++ Q
Sbjct: 328 FASVQREYAKAPQVTRDRIYLETMQDIYANSTKVLVDQSNGSLLYLPLDKLIAQTQ 383


>gi|271502151|ref|YP_003335177.1| HflK protein [Dickeya dadantii Ech586]
 gi|270345706|gb|ACZ78471.1| HflK protein [Dickeya dadantii Ech586]
          Length = 419

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 94/270 (34%), Positives = 151/270 (55%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     +D V  V V          S    + SG
Sbjct: 94  YTIKEAERGVVTRFGKFSH-LVGPGLNWKPTFVDAVRAVNV---------ESVRELATSG 143

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VT P  YLF++ N  ++L+Q ++SA+R V+G+     I   
Sbjct: 144 VMLTSDENVVRVEMNVQYRVTQPEKYLFSVTNADDSLRQATDSALRGVIGKYTMDKILTE 203

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 204 GRTIVRTDTQRVLEETVRPYDMGITLLDVNFQTARPPEEVKAAFDDAIAARENEQQYIRE 263

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E S AYKDR + EAQGE  RF  +  +Y  AP + R+R+Y
Sbjct: 264 AEAYANEVQPRANGQAQRILEESRAYKDRTVLEAQGEVSRFSRLLPEYKAAPEITRERLY 323

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L    KV++  K + +  LPL++
Sbjct: 324 IETMERVLSHTNKVLVSDKSNNLMVLPLDQ 353


>gi|161505134|ref|YP_001572246.1| FtsH protease regulator HflK [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|160866481|gb|ABX23104.1| hypothetical protein SARI_03268 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 419

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 96/270 (35%), Positives = 155/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V  V V E  +++          SG
Sbjct: 98  YTIKEAERGVVTRFGK-FSHLVEPGLNWKPTFIDNVTPVNV-EAVRELAA--------SG 147

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP+ YLF++ +P ++L+Q ++SA+R V+G+     I   
Sbjct: 148 VMLTSDENVVRVEMNVQYRVTDPQKYLFSVTSPDDSLRQATDSALRGVIGKYTMDRILTE 207

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 208 GRTVIRSDTQRELEETIKPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 267

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK + I EAQGE  RF  I  +Y  AP + R+R+Y
Sbjct: 268 AEAYTNEVQPRANGQAQRILEEARAYKTQTILEAQGEVARFAKILPEYKAAPQITRERLY 327

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K   +  LPL++
Sbjct: 328 IETMEKVLSHTRKVLVNDKSGNLMVLPLDQ 357


>gi|332527860|ref|ZP_08403897.1| hypothetical protein RBXJA2T_17951 [Rubrivivax benzoatilyticus JA2]
 gi|332112437|gb|EGJ12230.1| hypothetical protein RBXJA2T_17951 [Rubrivivax benzoatilyticus JA2]
          Length = 422

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 102/306 (33%), Positives = 164/306 (53%), Gaps = 17/306 (5%)

Query: 45  PFFKSYG------SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
           P  KS G         ++L+ +GS       +IV   ++AV   FGK  +     G    
Sbjct: 74  PDMKSAGIGVGLIGAVVVLVWLGS-----GFFIVQEGQQAVVTTFGKYSHTADA-GFQWR 127

Query: 99  F-WPIDQVEIVKVIERQQKIGGRSASV---GSNSGLILTGDQNIVGLHFSVLYVVTDPRL 154
           F +P+   E V V + +    GRS  V   G     +LT D+NI+ + F+V Y ++D R 
Sbjct: 128 FPYPVQAHETVSVTQLRSVEVGRSTVVQATGLRDSSMLTQDENIIDIRFTVQYRLSDARQ 187

Query: 155 YLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGIL 214
           YLF   +P E + Q SESA+RE+VGR     +   QR  +A ++   IQ  ++  ++GIL
Sbjct: 188 YLFENRSPDEAVVQASESAVREIVGRSRVDSVLYEQRDALAADLVKSIQSQLERLRAGIL 247

Query: 215 INTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIA 274
           I  +++++   P  V  AF++  +A  D DRF  E   Y++ V+  ARG AS + E +  
Sbjct: 248 IANVNVQNVLVPDAVQAAFNDAVKAGADRDRFKNEGQAYASDVIPKARGNASRLLEEAEG 307

Query: 275 YKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMP 333
           Y+ R+I +A+G+A RF S+  +Y  AP + R R+Y++ M+ I     KV++D +  S + 
Sbjct: 308 YRARVIAQAEGDAQRFRSVLAEYQKAPAVTRDRMYVDAMQQIYSNVSKVMVDSRSGSNLL 367

Query: 334 YLPLNE 339
           YLPL++
Sbjct: 368 YLPLDK 373


>gi|117919052|ref|YP_868244.1| HflK protein [Shewanella sp. ANA-3]
 gi|117611384|gb|ABK46838.1| HflK protein [Shewanella sp. ANA-3]
          Length = 381

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 111/342 (32%), Positives = 174/342 (50%), Gaps = 23/342 (6%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFD-----LIPFFKSYGSVYIILL 58
           +K N  W      G+ G  D  PP D++ + R +  +F            S  S+ IIL 
Sbjct: 8   NKGNDPW------GNKGGNDKGPP-DLDEVFRNLSKRFGGKGNGSSGQSFSSFSLIIILA 60

Query: 59  LIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIG 118
           +          Y +   ER V LRFG+   +V  PGLH     IDQ+  V V        
Sbjct: 61  IAFVVWGLSGFYTIKEAERGVALRFGQHIGEVG-PGLHWKATFIDQIYPVDV-------- 111

Query: 119 GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVV 178
            +S      SG +LT D+N+V +   V Y + D   YLF+  +   +L++ ++SA+R V+
Sbjct: 112 -QSVRSIPASGSMLTSDENVVKVELDVQYRILDAYSYLFSAVDANASLREATDSALRYVI 170

Query: 179 GRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQR 238
           G     DI  + R  I  +    +++ ++ YK G+ I  ++   A PP EV DAFD+   
Sbjct: 171 GHNKMDDILTTGRDAIRRDTWKELERIIEPYKLGLAIVDVNFLPARPPEEVKDAFDDAIA 230

Query: 239 AEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYV 298
           A++DE RF+ E+  Y+  V   ARGE   + + + AYK+R I EA+G+  RF  +  +Y 
Sbjct: 231 AQEDEQRFIREAEAYAREVEPKARGEVERMAQQANAYKEREILEARGKVARFELLLPEYQ 290

Query: 299 NAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
            AP + RKR+YL+ M+ ++    KV+ID K +  + YLPL++
Sbjct: 291 AAPEVTRKRLYLDAMQQVMTDTNKVLIDAKNNGNLMYLPLDK 332


>gi|319786415|ref|YP_004145890.1| HflK protein [Pseudoxanthomonas suwonensis 11-1]
 gi|317464927|gb|ADV26659.1| HflK protein [Pseudoxanthomonas suwonensis 11-1]
          Length = 377

 Score =  163 bits (413), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 99/281 (35%), Positives = 165/281 (58%), Gaps = 13/281 (4%)

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQKIGGRSASVGS 126
           S  +V   ++ V LRFG+    V  PG ++   WPI++V  +KV   Q K         S
Sbjct: 68  SFTLVGEQQQGVVLRFGQFAR-VMQPGPNLKAPWPIERV--IKVNATQIK-------TFS 117

Query: 127 NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDI 186
           N+  +LT D+NIV +  +V Y V+DPRLYLF   +    L+QV++SA+RE VGR   +D 
Sbjct: 118 NTVPVLTRDENIVNVAMNVQYRVSDPRLYLFGSRDADRVLEQVAQSAVREQVGR-ATLDT 176

Query: 187 FRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRF 246
               R  +++     +Q ++D Y++G+++  ++++DA PP EV  AFDEV  A+Q +D+ 
Sbjct: 177 VLGARGPLSVSASQQLQASLDAYRTGLVVTELNLQDARPPEEVKPAFDEVNSAQQIKDQL 236

Query: 247 VEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRK 306
           + E+  Y+ +V+  ARGEA+  R  +  YK   I +A+G+  RF  +  +Y +AP + RK
Sbjct: 237 ISEARAYAAKVVPEARGEAARRRTVAEGYKAAKIAQAEGDVARFSLLRDEYRSAPEVTRK 296

Query: 307 RIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTK 347
           R++LET++ +L + +KVI    + ++ Y+P+  A    Q +
Sbjct: 297 RLWLETVQEVLARNRKVIGGDGRQLI-YVPMGNAPGATQPQ 336


>gi|307132702|ref|YP_003884718.1| modulator for HflB protease specific for phage lambda cII repressor
           [Dickeya dadantii 3937]
 gi|306530231|gb|ADN00162.1| modulator for HflB protease specific for phage lambda cII repressor
           [Dickeya dadantii 3937]
          Length = 419

 Score =  163 bits (413), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 94/270 (34%), Positives = 151/270 (55%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     +D V  V V          S    + SG
Sbjct: 93  YTIKEAERGVVTRFGKFSH-LVGPGLNWKPTFVDSVRAVNV---------ESVRELATSG 142

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VT P  YLF++ N  ++L+Q ++SA+R V+G+     I   
Sbjct: 143 VMLTSDENVVRVEMNVQYRVTQPDKYLFSVTNADDSLRQATDSALRGVIGKYTMDKILTE 202

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 203 GRTIVRTDTQRVLEETVRPYDMGITLLDVNFQTARPPEEVKAAFDDAIAARENEQQYIRE 262

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E S AYKDR + EAQGE  RF  +  +Y  AP + R+R+Y
Sbjct: 263 AEAYANEVQPRANGQAQRILEESRAYKDRTVLEAQGEVSRFSRLLPEYKAAPEITRERLY 322

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L    KV++  K + +  LPL++
Sbjct: 323 IETMERVLSHTNKVLVSDKSNNLMVLPLDQ 352


>gi|241662762|ref|YP_002981122.1| HflK protein [Ralstonia pickettii 12D]
 gi|240864789|gb|ACS62450.1| HflK protein [Ralstonia pickettii 12D]
          Length = 475

 Score =  163 bits (413), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 99/296 (33%), Positives = 167/296 (56%), Gaps = 10/296 (3%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQK 116
           +L+G + A    +IV   +  V L+FG+ K  +  PG++    +P++  EIV +   +  
Sbjct: 131 VLVGLWLA-SGFFIVQEGQTGVILQFGRFKY-LATPGINWRLPYPVESHEIVNLSGVRTL 188

Query: 117 IGGRSASVGSNS---GLILTGDQNIVGLHFSVLYVVTDPRLYLF-NLENPG---ETLKQV 169
             GR+  +   +     +LT D+NIV + FSV Y + +P  YLF N  + G   E + Q 
Sbjct: 189 EIGRTTQIKDTNLKDSSMLTQDENIVDVRFSVQYNIANPVDYLFYNRTDRGGDEELVTQA 248

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           +E+++RE+VGR     +    R  +   +   IQ+ +  YK+GI I +++++   PP +V
Sbjct: 249 AETSVREIVGRNKMDAVLYEGRDAVGRNLAESIQRILSAYKTGIRILSVNVQSVQPPEQV 308

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
             AFD+V +A QD +R + E   Y+N V+  A+G A+ + E +  YK R+I  A+G+A R
Sbjct: 309 QAAFDDVTKAGQDRERAISEGQAYANDVVPRAKGTAARLGEEAQGYKARVIARAEGDAAR 368

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQ 345
           F S+  +Y  AP + R RIYLETM+ I   + KV++D+    + YLPL++  ++ Q
Sbjct: 369 FASVQREYAKAPQVTRDRIYLETMQDIYANSTKVLVDQSNGSLLYLPLDKLIAQTQ 424


>gi|317493571|ref|ZP_07951992.1| HflK protein [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918514|gb|EFV39852.1| HflK protein [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 419

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 95/270 (35%), Positives = 154/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     +D+V  V V          S    + SG
Sbjct: 101 YTIKEAERGVVTRFGKFSH-LVQPGLNWKPTFVDEVTPVNV---------ESVRELAASG 150

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VT+P  YLFN+ N  ++L+Q ++SA+R V+G+     I   
Sbjct: 151 VMLTSDENVVRVEMNVQYRVTNPEEYLFNVTNADDSLRQATDSALRAVIGKYSMDKILTE 210

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + + ++ +T+  YK G+ +  ++ + A PP EV  AFD+   A + E + + E
Sbjct: 211 GRTIIRTDTQKVLDETIKPYKMGLTVLDVNFQAARPPEEVRAAFDKAIAAREKEQQSIRE 270

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y N+V   A G+A  I E + AYKD+ I EAQG+  R   +  +Y  +P + R+R+Y
Sbjct: 271 AEGYVNKVQPEANGKAQRILEDAKAYKDKTILEAQGDVGRLALLLPEYKASPQITRERLY 330

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           LETME +L+ ++KV+ID K + +  LPL++
Sbjct: 331 LETMEHVLENSRKVLIDDKSNNLMVLPLDQ 360


>gi|149192033|ref|ZP_01870260.1| HflK protein [Vibrio shilonii AK1]
 gi|148834134|gb|EDL51144.1| HflK protein [Vibrio shilonii AK1]
          Length = 400

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 101/306 (33%), Positives = 161/306 (52%), Gaps = 16/306 (5%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           +I L+  +   F   Y +   ER V LR GK  + +  PGL+     ID+ + V V    
Sbjct: 77  VIALIAVAIWFFSGFYTISEGERGVVLRLGK-FDRIVDPGLNWRPRFIDEYQPVNV---- 131

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
           Q I    AS     G +LT D+N+V +   V Y V+DP  YLF + N  ++L Q ++SA+
Sbjct: 132 QAIRSLRAS-----GTMLTKDENVVSVSMDVQYRVSDPYKYLFVVTNADDSLSQATDSAL 186

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           R V+G      I  S RQQI    +  + + +D Y  G+ I  ++ + A PP +V DAFD
Sbjct: 187 RAVIGDSLMDSILTSGRQQIRQSTQETLNEIIDNYDMGLSIVDVNFQSARPPEQVKDAFD 246

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +   A +DE+RF+ E+  Y N ++  A G +  +++ +  Y +RI  EA G+  +F  + 
Sbjct: 247 DAIAAREDEERFIREAEAYKNEIIPKATGRSERLKKEAQGYSERITNEALGQVAQFEKLL 306

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLN-----EAFSRIQTKR 348
            +Y  AP + R R+YL+TME +     KV+ID + S  + YLP++     E  S+ +  +
Sbjct: 307 PEYQAAPEVTRNRLYLDTMEEVYSNTSKVLIDSESSGNLLYLPIDKLAGQEGTSKSRKPK 366

Query: 349 EIRWYQ 354
           E   Y+
Sbjct: 367 ETSAYE 372


>gi|88608650|ref|YP_506061.1| HflK protein [Neorickettsia sennetsu str. Miyayama]
 gi|88600819|gb|ABD46287.1| HflK protein [Neorickettsia sennetsu str. Miyayama]
          Length = 347

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 105/310 (33%), Positives = 169/310 (54%), Gaps = 17/310 (5%)

Query: 28  FDVEAIIRYIKDKFDLIPFFKSYGS------VYIILLLIGSFCAFQSIYIVHPDERAVEL 81
           +D+E ++  ++ KF     F+  GS      +  +L L G        Y+V+P+E+AVEL
Sbjct: 28  YDIEGLLLSVRGKF-----FRRGGSRFSWWFILCLLSLFGILWVLSGFYVVNPEEQAVEL 82

Query: 82  RFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE-RQQKIGGRSASVGSNSGLILTGDQNIV 139
            FGK    +  PGL   F +PI +V+ VKV    + +IG  S   G   G++LTGD+NI+
Sbjct: 83  TFGKYTG-MADPGLRYHFPFPIGRVDKVKVAAINRNEIGYSSGKKGEGEGIMLTGDENIL 141

Query: 140 GLHFSVLYVVTDPRLYLFNLENPGETL--KQVSESAMREVVGRRFAVDIFRSQ-RQQIAL 196
             +F V + + D   +L+ + + G  L  K  +ESAMR+ +G+     I R + R +IA 
Sbjct: 142 DANFEVQWRIKDAYKFLYKVRDYGFGLSVKGAAESAMRDAIGQNEISFILRGEGRAKIAS 201

Query: 197 EVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNR 256
           + +  +Q+ +D Y  G+ I +I ++   PP +V DAF +VQ A  D++R + ++  Y N 
Sbjct: 202 DTKKQLQEILDGYDMGVEILSIQMKKVDPPEKVIDAFRDVQSARADKEREINQAYSYRND 261

Query: 257 VLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGI 316
            L  ARGEA    + + AYK   I  A G+  RF+ IY QY   P + + R+ +E +E +
Sbjct: 262 ALPRARGEAEVALQGAQAYKIEAINRAVGDTKRFIEIYNQYRVNPDITKMRMRIEMLEEV 321

Query: 317 LKKAKKVIID 326
            K  +K+I D
Sbjct: 322 YKNTEKIIAD 331


>gi|304321362|ref|YP_003855005.1| putative membrane bound protease protein [Parvularcula bermudensis
           HTCC2503]
 gi|303300264|gb|ADM09863.1| putative membrane bound protease protein [Parvularcula bermudensis
           HTCC2503]
          Length = 398

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 110/312 (35%), Positives = 163/312 (52%), Gaps = 28/312 (8%)

Query: 52  SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM-MFWPIDQVEIVKV 110
           +V I+LL +        +Y + P  R V   FG   + +  PGL+  + WP      V+V
Sbjct: 83  AVAIVLLWL-----LSGLYSLPPGARGVVTTFGN-YSALTGPGLNWRLPWPFQDHARVQV 136

Query: 111 IE-RQQKIG-GRSASVGSNSGLILTGDQNIVGLHFSVLYVVT-----------DPRLYLF 157
            + R   IG GR  S       ++T D NIV +  +V Y ++           +   Y+F
Sbjct: 137 DQDRSVTIGRGRQTS-------MVTSDLNIVDVQMTVDYQISPDVGLAEGELPNAAKYIF 189

Query: 158 NLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINT 217
           N+ENP   ++ VSESA+R+VVG      +    R  ++L  + +IQ+ +D Y SGI I  
Sbjct: 190 NIENPDGLVRAVSESALRQVVGESDFSQVIAENRASVSLRTQEIIQEILDSYSSGIEIIR 249

Query: 218 ISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKD 277
           ++   A PP +V  A  +V  A    ++ V E+N+Y N  +  ARGEA  I  ++ AY  
Sbjct: 250 VNFGQADPPEDVIPAQRDVIDARSGAEQLVNEANRYRNNRVPRARGEAREIELAAEAYGQ 309

Query: 278 RIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLP 336
           R+++EA+G A RF  IY +YV AP + R+R+YLETMEG+L    KV+ID      +PYL 
Sbjct: 310 RVVREARGAASRFNDIYAEYVQAPDVTRERMYLETMEGVLGTMNKVVIDDNAGGALPYLN 369

Query: 337 LNEAFSRIQTKR 348
           LNE     Q  R
Sbjct: 370 LNELVREGQRSR 381


>gi|197250885|ref|YP_002149277.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197214588|gb|ACH51985.1| HflK protein [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
          Length = 419

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 96/270 (35%), Positives = 155/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V  V V E  +++          SG
Sbjct: 98  YTIKEAERGVVTRFGK-FSHLVEPGLNWKPTFIDDVTPVNV-EAVRELAA--------SG 147

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP+ YLF++ +P ++L+Q ++SA+R V+G+     I   
Sbjct: 148 VMLTSDENVVRVEMNVQYRVTDPQKYLFSVTSPDDSLRQATDSALRGVIGKYTMDRILTE 207

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 208 GRTVIRSDTQRELEETIKPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 267

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK + I EAQGE  RF  I  +Y  AP + R+R+Y
Sbjct: 268 AEAYTNEVQPRANGQAQRILEEARAYKTQTILEAQGEVARFAKILPEYKAAPQITRERLY 327

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K   +  LPL++
Sbjct: 328 IETMEKVLSHTRKVLVNDKSGNLMVLPLDQ 357


>gi|187928159|ref|YP_001898646.1| HflK protein [Ralstonia pickettii 12J]
 gi|187725049|gb|ACD26214.1| HflK protein [Ralstonia pickettii 12J]
          Length = 477

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 98/299 (32%), Positives = 168/299 (56%), Gaps = 10/299 (3%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIER 113
           ++ +L+G + A    +IV   +  V L+FG+ K  +  PG++    +P++  EIV +   
Sbjct: 130 LLAVLVGLWLA-SGFFIVQEGQTGVILQFGRFKY-LATPGINWRLPYPVESHEIVNLSGV 187

Query: 114 QQKIGGRSASVGSNS---GLILTGDQNIVGLHFSVLYVVTDPRLYLF-NLENPG---ETL 166
           +    GR+  +   +     +LT D+NIV + FSV Y + +P  YLF N  + G   E +
Sbjct: 188 RTLEIGRTTQIKDTNLKDSSMLTQDENIVDVRFSVQYNIANPVDYLFYNRTDRGGDEELV 247

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
            Q +E+++RE+VGR     +    R  +   +   IQ+ +  YK+GI I +++++   PP
Sbjct: 248 TQAAETSVREIVGRNKMDAVLYEGRDAVGRNLAESIQRILSAYKTGIRILSVNVQSVQPP 307

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            +V  AFD+V +A QD +R + E   Y+N V+  A+G A+ + E +  YK R+   A+G+
Sbjct: 308 EQVQAAFDDVTKAGQDRERAISEGQAYANDVVPRAKGTAARLGEEAQGYKARVTARAEGD 367

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQ 345
           A RF S+  +Y  AP + R RIYLETM+ I   + KV++D+    + YLPL++  ++ Q
Sbjct: 368 AARFASVQREYAKAPQVTRDRIYLETMQDIYANSTKVLVDQSNGSLLYLPLDKLIAQTQ 426


>gi|300704407|ref|YP_003746010.1| protein hflk, cofactor of ATP-dependent protease ftsh [Ralstonia
           solanacearum CFBP2957]
 gi|299072071|emb|CBJ43403.1| Protein hflK, cofactor of ATP-dependent protease FtsH [Ralstonia
           solanacearum CFBP2957]
          Length = 461

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 100/312 (32%), Positives = 168/312 (53%), Gaps = 10/312 (3%)

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVI 111
           V ++L ++         +IV   +  V L+FG+ K  +  PG++    +PI+  EIV + 
Sbjct: 107 VGVLLAVLAGLWLASGFFIVQEGQTGVILQFGRFKY-LATPGINWRLPYPIESHEIVNLS 165

Query: 112 ERQQKIGGRSASVGSNS---GLILTGDQNIVGLHFSVLYVVTDPRLYLF----NLENPGE 164
             +    GR+  +   +     +LT D+NIV + FSV Y + DP  YLF    +     E
Sbjct: 166 GVRTLEIGRTTQIKDTNLKDSSMLTQDENIVDVRFSVQYNIADPVEYLFYNRTDQRGDEE 225

Query: 165 TLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS 224
            + Q +E+++RE+VGR     +    R  +   +   IQ+ +  YK+GI I +++++   
Sbjct: 226 LVTQAAETSVREIVGRNKMDAVLYEGRDAVGRNLAESIQRILSAYKTGIRILSVNVQSVQ 285

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  AFD+V +A QD +R + E   Y+N V+  A+G A+ + E +  YK R++  A+
Sbjct: 286 PPEQVQAAFDDVTKAGQDRERAISEGQAYANDVVPRAKGTAARLGEEAQGYKARVVARAE 345

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNEAFSR 343
           G+A RF S+  +Y  AP + R RIYLETM+ I   A KV++D+     + YLPL++  ++
Sbjct: 346 GDAARFASVQREYAKAPQVTRDRIYLETMQDIYGNATKVLVDQSGNGNLLYLPLDKLIAQ 405

Query: 344 IQTKREIRWYQS 355
            Q     R  Q+
Sbjct: 406 SQAGDTARAQQA 417


>gi|161617633|ref|YP_001591598.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|161366997|gb|ABX70765.1| hypothetical protein SPAB_05496 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 419

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 96/270 (35%), Positives = 155/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V  V V E  +++          SG
Sbjct: 98  YTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDDVTPVNV-EAVRELAA--------SG 147

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP+ YLF++ +P ++L+Q ++SA+R V+G+     I   
Sbjct: 148 VMLTSDENVVRVEMNVQYRVTDPQKYLFSVTSPDDSLRQATDSALRGVIGKYTMDRILTE 207

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 208 GRTVIRSDTQRELEETIKPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 267

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK + I EAQGE  RF  I  +Y  AP + R+R+Y
Sbjct: 268 AEAYTNEVQPRANGQAQRILEEARAYKTQTILEAQGEVARFAKILPEYKAAPQITRERLY 327

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K   +  LPL++
Sbjct: 328 IETMEKVLSHTRKVLVNDKSGNLMVLPLDQ 357


>gi|16767609|ref|NP_463224.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|56416154|ref|YP_153229.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62182809|ref|YP_219226.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|167554131|ref|ZP_02347872.1| HflK protein [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|168231398|ref|ZP_02656456.1| HflK protein [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|168239731|ref|ZP_02664789.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168244859|ref|ZP_02669791.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|168263285|ref|ZP_02685258.1| HflK protein [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|194442767|ref|YP_002043618.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194448275|ref|YP_002048406.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194472105|ref|ZP_03078089.1| HflK protein [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194735493|ref|YP_002117304.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197263245|ref|ZP_03163319.1| HflK protein [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197365080|ref|YP_002144717.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|200387882|ref|ZP_03214494.1| HflK protein [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|204926789|ref|ZP_03217991.1| HflK protein [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205355121|ref|YP_002228922.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207859509|ref|YP_002246160.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224586203|ref|YP_002640002.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238910521|ref|ZP_04654358.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|16422924|gb|AAL23183.1| component of modulator for protease specific for FtsH phage lambda
           cII repressor [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|56130411|gb|AAV79917.1| HflK protein [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. ATCC 9150]
 gi|62130442|gb|AAX68145.1| HflK, with HflC, part of modulator for protease specific for FtsH
           phage lambda cII repressor [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|194401430|gb|ACF61652.1| HflK protein [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194406579|gb|ACF66798.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194458469|gb|EDX47308.1| HflK protein [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194710995|gb|ACF90216.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197096557|emb|CAR62167.1| HflK protein [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. AKU_12601]
 gi|197241500|gb|EDY24120.1| HflK protein [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197287604|gb|EDY26996.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|199604980|gb|EDZ03525.1| HflK protein [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|204323454|gb|EDZ08649.1| HflK protein [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205274902|emb|CAR39969.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|205321597|gb|EDZ09436.1| HflK protein [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205334375|gb|EDZ21139.1| HflK protein [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|205336314|gb|EDZ23078.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205348006|gb|EDZ34637.1| HflK protein [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|206711312|emb|CAR35690.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|224470731|gb|ACN48561.1| HflK protein [Salmonella enterica subsp. enterica serovar Paratyphi
           C strain RKS4594]
 gi|261249454|emb|CBG27319.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267996694|gb|ACY91579.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301160852|emb|CBW20383.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|312915461|dbj|BAJ39435.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321222671|gb|EFX47743.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|322717311|gb|EFZ08882.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323132701|gb|ADX20131.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|326630278|gb|EGE36621.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|332991174|gb|AEF10157.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 419

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 96/270 (35%), Positives = 155/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V  V V E  +++          SG
Sbjct: 98  YTIKEAERGVVTRFGK-FSHLVEPGLNWKPTFIDDVTPVNV-EAVRELAA--------SG 147

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP+ YLF++ +P ++L+Q ++SA+R V+G+     I   
Sbjct: 148 VMLTSDENVVRVEMNVQYRVTDPQKYLFSVTSPDDSLRQATDSALRGVIGKYTMDRILTE 207

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 208 GRTVIRSDTQRELEETIKPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 267

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK + I EAQGE  RF  I  +Y  AP + R+R+Y
Sbjct: 268 AEAYTNEVQPRANGQAQRILEEARAYKTQTILEAQGEVARFAKILPEYKAAPQITRERLY 327

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K   +  LPL++
Sbjct: 328 IETMEKVLSHTRKVLVNDKSGNLMVLPLDQ 357


>gi|168822510|ref|ZP_02834510.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205341083|gb|EDZ27847.1| HflK protein [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|320088790|emb|CBY98548.1| protease specific for phage lambda cII repressor [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
          Length = 419

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 96/270 (35%), Positives = 155/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V  V V E  +++          SG
Sbjct: 98  YTIKEAERGVVTRFGK-FSHLVEPGLNWKPTFIDDVTPVNV-EAVRELAA--------SG 147

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP+ YLF++ +P ++L+Q ++SA+R V+G+     I   
Sbjct: 148 VMLTSDENVVRVEMNVQYRVTDPQKYLFSVTSPDDSLRQATDSALRGVIGKYTMDRILTE 207

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 208 GRTVIRSDTQRELEETIKPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 267

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK + I EAQGE  RF  I  +Y  AP + R+R+Y
Sbjct: 268 AEAYTNEVQPRANGQAQRILEEARAYKTQTILEAQGEVARFAKILPEYKAAPQITRERLY 327

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K   +  LPL++
Sbjct: 328 IETMEKVLSHTRKVLVNDKSGNLMVLPLDQ 357


>gi|168464753|ref|ZP_02698656.1| HflK protein [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|198245726|ref|YP_002218247.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|195632978|gb|EDX51432.1| HflK protein [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|197940242|gb|ACH77575.1| HflK protein [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|326626052|gb|EGE32397.1| HflK protein [Salmonella enterica subsp. enterica serovar Dublin
           str. 3246]
          Length = 419

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 96/270 (35%), Positives = 155/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V  V V E  +++          SG
Sbjct: 98  YTIKEAERGVVTRFGK-FSHLVEPGLNWKPTFIDDVTPVNV-EAVRELAA--------SG 147

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP+ YLF++ +P ++L+Q ++SA+R V+G+     I   
Sbjct: 148 VMLTSDENVVRVEMNVQYRVTDPQKYLFSVTSPDDSLRQATDSALRGVIGKYTMDRILTE 207

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 208 GRTVIRSDTQRELEETIKPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 267

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK + I EAQGE  RF  I  +Y  AP + R+R+Y
Sbjct: 268 AEAYTNEVQPRANGQAQRILEEARAYKTQTILEAQGEVARFAKILPEYKAAPQITRERLY 327

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K   +  LPL++
Sbjct: 328 IETMEKVLSHTRKVLVNDKSGNLMVLPLDQ 357


>gi|227115178|ref|ZP_03828834.1| FtsH protease regulator HflK [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 419

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 94/270 (34%), Positives = 151/270 (55%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V  V V          S    + SG
Sbjct: 97  YTIKEAERGVVTRFGKFSH-LVGPGLNWKPTFIDSVRAVNV---------ESVRELATSG 146

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VT P  YLF++ N  ++L+Q ++SA+R V+G+     I   
Sbjct: 147 VMLTSDENVVRVEMNVQYRVTQPEQYLFSVTNADDSLRQATDSALRGVIGKYTMDKILTE 206

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 207 GRTIVRTDTQRVLEETVRPYNMGITLLDVNFQTARPPEEVKAAFDDAIAARENEQQYIRE 266

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E S AYK R + EAQGE  RF  +  +Y  AP + R+R+Y
Sbjct: 267 AEAYANEVQPRANGQAQRILEESRAYKTRTVLEAQGEVARFARVLPEYKAAPEITRERLY 326

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K   +  LPL++
Sbjct: 327 IETMERVLSHTRKVLVNDKGGNLMVLPLDQ 356


>gi|58697352|ref|ZP_00372692.1| hflK protein [Wolbachia endosymbiont of Drosophila simulans]
 gi|58536263|gb|EAL59790.1| hflK protein [Wolbachia endosymbiont of Drosophila simulans]
          Length = 300

 Score =  163 bits (412), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 155/257 (60%), Gaps = 12/257 (4%)

Query: 48  KSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVE 106
           K Y  ++IILLL     A    YIVHP E  +EL FGK  N   + GL   F +PI +V 
Sbjct: 47  KPYFIIFIILLL----YACTGFYIVHPSEEGIELTFGKYSN-TEMSGLRYHFPYPIGKVF 101

Query: 107 IVKVIERQQKIGGRSASVGSNS----GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN- 161
            V V E  ++  G S+S G ++    G++LTGD+NIV ++F V + V D + YLF + + 
Sbjct: 102 KVNVKEVNREEIGVSSSYGRDTDRGEGVMLTGDENIVNVNFEVQWRVRDAKDYLFKVRDY 161

Query: 162 -PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
            PG ++K  +ESAMRE++G+          R +I+ + R L+Q+ +D Y+ GI I ++ +
Sbjct: 162 KPGFSVKNAAESAMREIIGKNTISFALGQGRPEISRDTRILLQQILDGYQMGIEILSVQM 221

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           +   PP +V  +F +VQ A  D++R + E+  Y+N ++  A+GEA  I+  + AY++ +I
Sbjct: 222 KKIDPPEKVISSFRDVQSARADKERTINEAYAYNNDIIPRAKGEAIKIKLDAQAYENEVI 281

Query: 281 QEAQGEADRFLSIYGQY 297
            EA+G A+RFLS+Y +Y
Sbjct: 282 NEAKGNANRFLSLYEEY 298


>gi|28899589|ref|NP_799194.1| HflK protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|153839630|ref|ZP_01992297.1| protein HflK [Vibrio parahaemolyticus AQ3810]
 gi|260361398|ref|ZP_05774460.1| protein HflK [Vibrio parahaemolyticus K5030]
 gi|260876670|ref|ZP_05889025.1| protein HflK [Vibrio parahaemolyticus AN-5034]
 gi|260896637|ref|ZP_05905133.1| protein HflK [Vibrio parahaemolyticus Peru-466]
 gi|260900897|ref|ZP_05909292.1| protein HflK [Vibrio parahaemolyticus AQ4037]
 gi|729708|sp|P40605|HFLK_VIBPA RecName: Full=Protein HflK
 gi|507734|gb|AAA62186.1| HflK [Vibrio parahaemolyticus]
 gi|28807825|dbj|BAC61078.1| HflK protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|149746851|gb|EDM57839.1| protein HflK [Vibrio parahaemolyticus AQ3810]
 gi|308086319|gb|EFO36014.1| protein HflK [Vibrio parahaemolyticus Peru-466]
 gi|308093966|gb|EFO43661.1| protein HflK [Vibrio parahaemolyticus AN-5034]
 gi|308106498|gb|EFO44038.1| protein HflK [Vibrio parahaemolyticus AQ4037]
 gi|308112899|gb|EFO50439.1| protein HflK [Vibrio parahaemolyticus K5030]
 gi|328472285|gb|EGF43155.1| HflK protein [Vibrio parahaemolyticus 10329]
          Length = 400

 Score =  163 bits (412), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 95/275 (34%), Positives = 150/275 (54%), Gaps = 11/275 (4%)

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVG 125
           F   Y +   ER V LR GK  + +  PGL+     ID+ E V V    Q I    AS  
Sbjct: 87  FAGFYTIGEAERGVVLRLGK-YDRIVDPGLNWRPRFIDEYEAVNV----QAIRSLRAS-- 139

Query: 126 SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVD 185
              GL+LT D+N+V +   V Y V DP  YL+ + N  ++L+Q ++SA+R V+G      
Sbjct: 140 ---GLMLTKDENVVTVAMDVQYRVADPYKYLYRVTNADDSLRQATDSALRAVIGDSLMDS 196

Query: 186 IFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDR 245
           I  S RQQI    +  + + +D Y  G++I  ++ + A PP +V DAFD+   A +DE+R
Sbjct: 197 ILTSGRQQIRQSTQETLNQIIDSYDMGLVIVDVNFQSARPPEQVKDAFDDAIAAREDEER 256

Query: 246 FVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLR 305
           F+ E+  Y N +L  A G A  +++ +  Y +R+  EA G+  +F  +  +Y  AP + R
Sbjct: 257 FIREAEAYKNEILPKATGRAERLKKEAQGYNERVTNEALGQVAQFEKLLPEYQAAPGVTR 316

Query: 306 KRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
            R+Y++ ME +     KV+ID + S  + YLP+++
Sbjct: 317 DRLYIDAMEEVYTNTSKVLIDSESSGNLLYLPIDK 351


>gi|293393211|ref|ZP_06637526.1| FtsH protease regulator HflK [Serratia odorifera DSM 4582]
 gi|291424357|gb|EFE97571.1| FtsH protease regulator HflK [Serratia odorifera DSM 4582]
          Length = 417

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 96/277 (34%), Positives = 157/277 (56%), Gaps = 11/277 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID+V  V V          S    + SG
Sbjct: 97  YTIKEAERGVVTRFGKFSH-LVQPGLNWKPTFIDEVRPVNV---------ESVRELAASG 146

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VT+P  YLF++ N  ++L Q ++SA+R V+G+     I   
Sbjct: 147 VMLTSDENVVRVEMNVQYRVTNPEAYLFSVVNADDSLSQATDSALRGVIGKYSMDRILTE 206

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  Y  GI +  ++ + A PP EV  +FD+   A ++E +++ E
Sbjct: 207 GRTVVRNDTQRMLEETIRPYNMGITLLDVNFQAARPPEEVKASFDDAIAARENEQQYIRE 266

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  + E S AYKDR + EAQGE  RF  +  +Y +AP + R+R+Y
Sbjct: 267 AEAYANEVQPRANGQAQRLLEDSKAYKDRTVLEAQGEVARFAKLLPEYKSAPEITRERLY 326

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQT 346
           +ETME +L   +KV++  K + +  LPL++   R QT
Sbjct: 327 IETMEKVLSHTRKVLVSDKGNNLMVLPLDQML-RGQT 362


>gi|71891870|ref|YP_277599.1| HflK [Candidatus Blochmannia pennsylvanicus str. BPEN]
 gi|71795976|gb|AAZ40727.1| HflK [Candidatus Blochmannia pennsylvanicus str. BPEN]
          Length = 431

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 109/337 (32%), Positives = 175/337 (51%), Gaps = 23/337 (6%)

Query: 3   YDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIP--------FFKSYGSVY 54
           +DKN+ D RP   S  + N       D +  +  I DK ++          F K+     
Sbjct: 19  HDKNDVD-RP---SIEDKNKSEFNILDSDKYLNKITDKLNIFSKQNKDSEKFPKNKNFFI 74

Query: 55  IILLLIGSFCAFQS-IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIER 113
           +++L+I  F    S +Y +   ER V LRFGK  + +  PGL+      D V  V V   
Sbjct: 75  MLMLIIVVFVWIISGLYTIKEAERGVVLRFGKYHH-LVQPGLNWKPTFFDVVIPVNV--- 130

Query: 114 QQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESA 173
                  S    + SG++LT D+N+V +  +V Y VTDP+ YLFN+ +  ++L+Q ++SA
Sbjct: 131 ------ESVRELAASGMMLTSDENVVRVEMNVQYRVTDPKNYLFNVIDADDSLRQATDSA 184

Query: 174 MREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAF 233
           +R V+G+     I    R  +  + R +++KT+  Y  GI +  ++ + A PP EV  AF
Sbjct: 185 LRGVIGKYNMDRILTEGRTVVRSDTRRVLEKTIHPYNMGITLLDVNFQTARPPEEVKAAF 244

Query: 234 DEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSI 293
           D+   A ++E +++ E+  Y+N V   A G A  I E   AYK R + EAQGE  RF  I
Sbjct: 245 DDAIAARENEQQYIREAEAYANEVQPRANGHAQRILEEGRAYKARTVLEAQGEVQRFTKI 304

Query: 294 YGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS 330
             +Y  AP + R+R+Y+ +ME +L   +K+ ++ K +
Sbjct: 305 LPEYKAAPEITRERLYINSMERVLSNTRKIFVNSKDT 341


>gi|99034119|ref|ZP_01314223.1| hypothetical protein Wendoof_01000988 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 224

 Score =  162 bits (411), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 137/212 (64%), Gaps = 3/212 (1%)

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN--PGETLKQVSESAMREVVGRRFAVDI 186
           G++LTGD+NIV ++F V + V D + YLF + +  PG ++K  +ESAMRE++G+      
Sbjct: 8   GVMLTGDENIVNVNFEVQWRVRDAKDYLFKVRDYKPGFSVKNAAESAMREIIGKNTISFA 67

Query: 187 FRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRF 246
               R +I+ + R L+Q+ +D Y+ GI I ++ ++   PP +V  +F +VQ A  D++R 
Sbjct: 68  LGQGRPEISRDTRILLQQILDGYQMGIEILSVQMKKIDPPEKVISSFRDVQSARADKERT 127

Query: 247 VEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRK 306
           + E+  Y+N ++  A+GEA  I+  + AY++ II EA+G A+RFLS+Y +Y   P+L++ 
Sbjct: 128 INEAYAYNNDIIPRAKGEAIKIKLDAQAYENEIINEAKGNANRFLSLYEEYRQNPSLVKN 187

Query: 307 RIYLETMEGILKKAKKVII-DKKQSVMPYLPL 337
           RIYLETME I  K  KV++ D  + +  YLPL
Sbjct: 188 RIYLETMENIFSKVDKVVVTDDLKGMFSYLPL 219


>gi|260599477|ref|YP_003212048.1| FtsH protease regulator HflK [Cronobacter turicensis z3032]
 gi|260218654|emb|CBA33979.1| Protein hflK [Cronobacter turicensis z3032]
          Length = 414

 Score =  162 bits (411), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 97/277 (35%), Positives = 155/277 (55%), Gaps = 10/277 (3%)

Query: 63  FCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSA 122
             A    Y +   ER V  RFGK  + +  PGL+     ID+V  V V E  +++     
Sbjct: 84  LWAVTGFYTIKEAERGVVTRFGK-FSHLVEPGLNWKPTFIDEVVPVNV-EAVRELAA--- 138

Query: 123 SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRF 182
                SG++LT D+N+V +  +V Y VTDPR YLF++ N  ++L+Q ++SA+R V+G+  
Sbjct: 139 -----SGIMLTSDENVVRVEMNVQYRVTDPRRYLFSVANADDSLRQATDSALRGVIGKYT 193

Query: 183 AVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQD 242
              I    R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++
Sbjct: 194 MDRILTEGRTVIRSDTQRELEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAAREN 253

Query: 243 EDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPT 302
           E +++ E+  Y+N V   A G+A    E + AYK + I EAQGE  RF  I  +Y  AP 
Sbjct: 254 EQQYIREAEAYTNEVQPRANGQAQRTLEEARAYKTQTILEAQGEVARFAKILPEYKAAPE 313

Query: 303 LLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           + R+R+Y+ETME +L   +KV+++ K   +  LPL++
Sbjct: 314 ITRERLYIETMEKVLSHTRKVLVNDKGGNLMVLPLDQ 350


>gi|253690080|ref|YP_003019270.1| HflK protein [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251756658|gb|ACT14734.1| HflK protein [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 420

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 93/270 (34%), Positives = 151/270 (55%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V  V V          S    + SG
Sbjct: 97  YTIKEAERGVVTRFGKFSH-LVGPGLNWKPTFIDSVRAVNV---------ESVRELATSG 146

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VT P  YLF++ N  ++L+Q ++SA+R V+G+     I   
Sbjct: 147 VMLTSDENVVRVEMNVQYRVTQPEQYLFSVTNADDSLRQATDSALRGVIGKYTMDKILTE 206

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  Y  G+ +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 207 GRTIVRTDTQRVLEETVRPYNMGVTLLDVNFQTARPPEEVKAAFDDAIAARENEQQYIRE 266

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E S AYK R + EAQGE  RF  +  +Y  AP + R+R+Y
Sbjct: 267 AEAYANEVQPRANGQAQRILEESRAYKTRTVLEAQGEVARFARVLPEYKAAPEITRERLY 326

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K   +  LPL++
Sbjct: 327 IETMERVLSHTRKVLVNDKGGNLMVLPLDQ 356


>gi|121604781|ref|YP_982110.1| HflK protein [Polaromonas naphthalenivorans CJ2]
 gi|120593750|gb|ABM37189.1| protease FtsH subunit HflK [Polaromonas naphthalenivorans CJ2]
          Length = 471

 Score =  162 bits (410), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 102/302 (33%), Positives = 168/302 (55%), Gaps = 7/302 (2%)

Query: 45  PFFKSYG-SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPID 103
           P  K+ G  V +I  ++         +IV   ++AV  +FGK ++ V       + +PI 
Sbjct: 117 PDMKNAGIGVGLIAAVVALIWLGTGFFIVQEGQQAVITQFGKYQSTVGAGFNWRLPYPIQ 176

Query: 104 QVEIVKVIERQQKIGGRSA---SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
           + EIV V + +    GR     + G     +LT D+NIV + F+V Y + + R YLF  +
Sbjct: 177 RHEIVVVTQIRSVDVGRDTILKATGLRDSAMLTEDENIVEIKFAVQYRLNNARAYLFESK 236

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
           +P   + Q +E+A+REVVG+         +R QI   VR L+Q  +D YK G+ +  I++
Sbjct: 237 DPSAAVVQAAETAVREVVGKMKMDMALAEERDQIGPRVRVLMQTILDRYKVGVEVVAINL 296

Query: 221 EDAS--PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDR 278
           + +   PP +V  AFD+V +A Q+ +R   E+  Y+N V+  A G AS ++E + AYK R
Sbjct: 297 QQSGVRPPEQVQAAFDDVLKAGQERERAKNEAQAYANDVVPRAVGSASRLKEEADAYKAR 356

Query: 279 IIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPL 337
           I+ +AQG+A RF S+  +Y  AP + R R+Y + M+ +     KV+++ +Q S + YLPL
Sbjct: 357 IVAQAQGDAQRFSSVLAEYQKAPQVTRDRMYTDAMQQVYTNVTKVLVESRQGSNLLYLPL 416

Query: 338 NE 339
           ++
Sbjct: 417 DK 418


>gi|294139258|ref|YP_003555236.1| hflK protein [Shewanella violacea DSS12]
 gi|293325727|dbj|BAJ00458.1| hflK protein [Shewanella violacea DSS12]
          Length = 380

 Score =  162 bits (410), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 108/340 (31%), Positives = 177/340 (52%), Gaps = 18/340 (5%)

Query: 19  NGNGDGLPPFDVEAIIRYIKDKFDLI------PFFKSYGSVYIILLLIGSFCAFQSIYIV 72
           N +G+   P D++ + R +  +F         P   S+G + I+L +          Y V
Sbjct: 17  NKSGNDKGPPDLDEVFRNLSKRFGGGKGNGSGPKVSSFGLI-IVLGIAVVVWGLSGFYTV 75

Query: 73  HPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLIL 132
              E+ V LRFG+   +V  PGL      IDQV  V V          +      SG +L
Sbjct: 76  KEAEKGVALRFGEYIGEVD-PGLQWKATFIDQVFPVNV---------NTVRSIPASGSML 125

Query: 133 TGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQ 192
           T D+N+V +   V Y VT+   +LF+  +  E+L++ ++SA+R V+G     DI  + R 
Sbjct: 126 TTDENVVLVELDVQYRVTNAYNFLFSAVDANESLREATDSALRYVIGHNSMDDILTTGRD 185

Query: 193 QIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNK 252
           +I  +  + +++ ++ YK GI I  ++   A PP EV DAFD+   A++DE RF+ E+  
Sbjct: 186 KIRRDTWSEVERIIEPYKLGITIVDVNFLPARPPEEVKDAFDDAISAQEDEQRFIREAEA 245

Query: 253 YSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLET 312
           YS  +   ARG+   + + + AYK+R + EA G+  RF  +  +Y +AP + R R+YL+ 
Sbjct: 246 YSRAIEPKARGQVQRMEQQAKAYKEREVLEATGKVARFNLLLPEYKSAPKVTRDRLYLDA 305

Query: 313 MEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQTKREIR 351
           M+ +L    KV++D K S  M YLPL++   + Q+  + R
Sbjct: 306 MQIVLSGTSKVLVDSKSSNNMMYLPLDKLMQKSQSNAKPR 345


>gi|85058317|ref|YP_454019.1| FtsH protease regulator HflK [Sodalis glossinidius str.
           'morsitans']
 gi|84778837|dbj|BAE73614.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 414

 Score =  162 bits (410), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 96/276 (34%), Positives = 153/276 (55%), Gaps = 11/276 (3%)

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASV 124
           A  S Y +   ER V LRFGK  + +  PGL+     ID V  V V          S   
Sbjct: 87  AGSSFYTIKEAERGVVLRFGK-FDHLVQPGLNWKPTFIDTVTAVNV---------ESVRE 136

Query: 125 GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAV 184
            + SG++LT D+N+V +  +V Y VTDP  YLF + N  ++L+Q ++SA+R V+G+    
Sbjct: 137 LAASGVMLTSDENVVRVEMNVQYRVTDPERYLFRVTNADDSLRQATDSALRGVIGKYTMD 196

Query: 185 DIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDED 244
            I    R  +  + + ++++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E 
Sbjct: 197 RILTEGRTVVRSDTQRVLEETIQPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQ 256

Query: 245 RFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLL 304
           +++ E+  YSN V   A G+A  I E   AYK R + EAQGE  RF  +  +Y  AP + 
Sbjct: 257 QYIREAEAYSNEVQPRANGQAQRILEEGRAYKARTVLEAQGEVQRFAKVLPEYKAAPEIT 316

Query: 305 RKRIYLETMEGILKKAKKVII-DKKQSVMPYLPLNE 339
           R+R+Y++ ME +L   +K+++ DK  + +  LPL++
Sbjct: 317 RERLYIDAMERVLSNTRKILVNDKGSNNLMVLPLDQ 352


>gi|157825299|ref|YP_001493019.1| protease activity modulator HflK [Rickettsia akari str. Hartford]
 gi|157799257|gb|ABV74511.1| protease activity modulator HflK [Rickettsia akari str. Hartford]
          Length = 345

 Score =  162 bits (410), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 96/309 (31%), Positives = 177/309 (57%), Gaps = 17/309 (5%)

Query: 41  FDLIPFFKSYGSVYIILLLIGSFCAF--QSIYIVHPDERAVELRFGKPKNDVFLPGLHMM 98
           FD   F  ++    IIL ++     +    IY +   + A  +RFG+     + PGL+  
Sbjct: 37  FDKFQFQFNFNVKTIILAVVAVIALWLASGIYEIKEGDEAAVIRFGRFVRKGY-PGLNYH 95

Query: 99  F-WPIDQVEIVKVIE-RQQKIGGRSA----SVGSNS------GLILTGDQNIVGLHFSVL 146
              P +++ + KV + R+ +IG R+     S G N+       ++LTGD+NIV L+  V+
Sbjct: 96  LPVPFEKIIVEKVKQSRRIEIGYRTNNSVRSGGDNTKNIAGESIMLTGDENIVALNCDVM 155

Query: 147 YVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTM 206
           + + +   ++FN++ P ET+K   ESA+REV+G      +   Q+Q+I  ++  L QK +
Sbjct: 156 WHINNLEDFIFNVQRPAETVKATVESAVREVIGNTPISCVLSDQKQEITYKIEKLAQKIL 215

Query: 207 DYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEAS 266
           D Y +G++I  + +  A PP EV D++ +VQ ++ D+++ + ++  Y+N++L  ARG A+
Sbjct: 216 DSYNAGVMIEKVQLLKAEPPAEVIDSYRDVQTSKADKEKEINQAQAYNNKILPEARGAAA 275

Query: 267 HIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID 326
            I + +  Y++ +I +A+G++ RF +IY QY     + R R+YLE +E IL  + K II+
Sbjct: 276 KIIQEAEGYREEVISKAEGDSQRFNAIYKQYTVGRQVTRDRLYLEVVEEILGGSNKTIIN 335

Query: 327 KKQSVMPYL 335
              +++P++
Sbjct: 336 --NALLPHM 342


>gi|254362808|ref|ZP_04978887.1| hypothetical protein MHA_2401 [Mannheimia haemolytica PHL213]
 gi|153094438|gb|EDN75283.1| hypothetical protein MHA_2401 [Mannheimia haemolytica PHL213]
          Length = 407

 Score =  162 bits (410), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 94/285 (32%), Positives = 155/285 (54%), Gaps = 10/285 (3%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           ++L L          Y V   ER V  R GK  ND+ LPGL+     ID V  V V ER 
Sbjct: 83  VVLGLAAVVWVGSGFYTVQEAERGVVTRLGK-LNDIVLPGLNWKPTFIDSVTRVNV-ERV 140

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
            ++        + SG +LT D+N+V +  +V Y V DP  YLF++ NP ++LKQ ++SA+
Sbjct: 141 SEL--------NTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFSVSNPDDSLKQATDSAL 192

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           R V+G     +I  + R  +     + ++  +  Y  G+L+  ++ + A PP EV  AFD
Sbjct: 193 RYVIGHMTMDEILTTGRATVRERTWSTLRDIIKTYDMGLLVTDVNFQYARPPEEVKAAFD 252

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +  +A++DE R + E+  Y+      ARG+A    E + AYK+ ++  A+GE +R   + 
Sbjct: 253 DAIKAQEDEQRLIREAEAYARGEEPIARGQAQRTIEQAQAYKEAVVLNAKGEVERLSQLL 312

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
            +Y  +P L R+R+Y++TME ++K   KV++D   + +  LP ++
Sbjct: 313 PEYKASPELTRERLYIQTMEKVMKNTPKVVMDSSGNNLNVLPFDK 357


>gi|270265001|ref|ZP_06193264.1| hypothetical protein SOD_k00370 [Serratia odorifera 4Rx13]
 gi|270040935|gb|EFA14036.1| hypothetical protein SOD_k00370 [Serratia odorifera 4Rx13]
          Length = 419

 Score =  162 bits (409), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 92/270 (34%), Positives = 154/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID+V  V V          S    + SG
Sbjct: 98  YTIKEAERGVVTRFGKFSH-LVQPGLNWKPTFIDEVRPVNV---------ESVRELAASG 147

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VT+P  YLF++ +  ++L Q ++SA+R V+G+     I   
Sbjct: 148 VMLTSDENVVRVEMNVQYRVTNPEAYLFSVTSADDSLSQATDSALRGVIGKYTMDKILTE 207

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 208 GRTIVRSDTQRVLEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 267

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  + E + AYKDR + EAQGE  RF  +  +Y +AP + R+R+Y
Sbjct: 268 AEAYANEVQPRANGQAQRLLEDAKAYKDRTVLEAQGEVARFAKLLPEYKSAPEITRERLY 327

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K + +  LPL +
Sbjct: 328 IETMEKVLSHTRKVLVNDKGNNLMVLPLEQ 357


>gi|213029441|ref|ZP_03343888.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
          Length = 368

 Score =  162 bits (409), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 95/270 (35%), Positives = 155/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V  V V E  +++          SG
Sbjct: 83  YTIKEAERGVVTRFGK-FSHLVEPGLNWKPTFIDDVTPVNV-EAVRELAA--------SG 132

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP+ YLF++ +P ++L+Q ++SA+R V+G+     I   
Sbjct: 133 VMLTSDENVVRVEMNVQYRVTDPQKYLFSVTSPDDSLRQATDSALRGVIGKYTMDRILTE 192

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP E+  AFD+   A ++E +++ E
Sbjct: 193 GRTVIRSDTQRELEETIKPYNMGITLLDVNFQAARPPEEMKAAFDDAIAARENEQQYIRE 252

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK + I EAQGE  RF  I  +Y  AP + R+R+Y
Sbjct: 253 AEAYTNEVQPRANGQAQRILEEARAYKTQTILEAQGEVARFAKILPEYKAAPQITRERLY 312

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K   +  LPL++
Sbjct: 313 IETMEKVLSHTRKVLVNDKSGNLMVLPLDQ 342


>gi|37528398|ref|NP_931743.1| FtsH protease regulator HflK [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36787836|emb|CAE16951.1| protease specific for phage lambda cII repressor [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 406

 Score =  162 bits (409), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 95/272 (34%), Positives = 155/272 (56%), Gaps = 10/272 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  R GK  + +  PGL+     ID+V  V V          S    + SG
Sbjct: 90  YTIKETERGVVTRLGKLSH-IVQPGLNWKPTFIDEVVPVNV---------ESVRELATSG 139

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+++V +  +V Y VTDP  YL+++ +P  +L+Q ++SA+R VVG+     I  +
Sbjct: 140 VMLTSDESVVRVEMNVQYRVTDPAAYLYSVTSPDNSLRQATDSAVRGVVGKYSMDKILTA 199

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + +  ++KT+  Y+ GI +  ++ + A PP EV  AFD+V  A ++E + + E
Sbjct: 200 NRMIVRDDTQRELEKTILPYRMGITLLDVNFQAARPPEEVKAAFDDVIAARENEQQSIRE 259

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  YSN VL  A+G+A  I E + AYK R++ EAQGE   F  +  +Y  AP + R+R+Y
Sbjct: 260 AEAYSNEVLPRAKGDAQRIIEEAKAYKARVVLEAQGEVAGFAKMLPRYKEAPEITRERLY 319

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNEAF 341
           +ETME +L + +KVI++   + +  LPL +  
Sbjct: 320 IETMEKVLSRTRKVIVNDHNNNLLVLPLEQML 351


>gi|16763182|ref|NP_458799.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29144661|ref|NP_808003.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213428670|ref|ZP_03361420.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213612846|ref|ZP_03370672.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213648971|ref|ZP_03379024.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|289829978|ref|ZP_06547429.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|25512194|pir||AC1049 HflK protein [imported] - Salmonella enterica subsp. enterica
           serovar Typhi (strain CT18)
 gi|16505490|emb|CAD06840.1| HflK protein [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29140300|gb|AAO71863.1| HflK protein [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
          Length = 419

 Score =  162 bits (409), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 95/270 (35%), Positives = 155/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V  V V E  +++          SG
Sbjct: 98  YTIKEAERGVVTRFGK-FSHLVEPGLNWKPTFIDDVTPVNV-EAVRELAA--------SG 147

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP+ YLF++ +P ++L+Q ++SA+R V+G+     I   
Sbjct: 148 VMLTSDENVVRVEMNVQYRVTDPQKYLFSVTSPDDSLRQATDSALRGVIGKYTMDRILTE 207

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP E+  AFD+   A ++E +++ E
Sbjct: 208 GRTVIRSDTQRELEETIKPYNMGITLLDVNFQAARPPEEMKAAFDDAIAARENEQQYIRE 267

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK + I EAQGE  RF  I  +Y  AP + R+R+Y
Sbjct: 268 AEAYTNEVQPRANGQAQRILEEARAYKTQTILEAQGEVARFAKILPEYKAAPQITRERLY 327

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K   +  LPL++
Sbjct: 328 IETMEKVLSHTRKVLVNDKSGNLMVLPLDQ 357


>gi|157368680|ref|YP_001476669.1| FtsH protease regulator HflK [Serratia proteamaculans 568]
 gi|157320444|gb|ABV39541.1| HflK protein [Serratia proteamaculans 568]
          Length = 419

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 95/277 (34%), Positives = 157/277 (56%), Gaps = 11/277 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID+V  V V          S    + SG
Sbjct: 98  YTIKEAERGVVTRFGKFSH-LVQPGLNWKPTFIDEVRPVNV---------ESVRELAASG 147

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VT+P  YLF++ N  ++L Q ++SA+R V+G+     I   
Sbjct: 148 VMLTSDENVVRVEMNVQYRVTNPEAYLFSVTNADDSLSQATDSALRGVIGKYTMDKILTE 207

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 208 GRTIVRSDTQRVLEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 267

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  + E + AYKDR + EAQGE   F  +  +Y +AP + R+R+Y
Sbjct: 268 AEAYANEVQPRANGQAQRLLEDAKAYKDRTVLEAQGEVAGFAKLLPEYKSAPQITRERLY 327

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQT 346
           +ETME +L   +KV+++ K + +  LPL++   R QT
Sbjct: 328 IETMEKVLSHTRKVLVNDKGNNLMVLPLDQML-RGQT 363


>gi|149910174|ref|ZP_01898820.1| HflK protein [Moritella sp. PE36]
 gi|149806760|gb|EDM66724.1| HflK protein [Moritella sp. PE36]
          Length = 389

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 160/291 (54%), Gaps = 11/291 (3%)

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE 112
           V ++L ++    A    Y +   ER V LRFG+    V  PGL  +   +D+V  V V  
Sbjct: 63  VSLVLGVLAVIWAVSGFYTIKEAERGVVLRFGQYSQTV-EPGLSWLPTFVDRVIPVDV-- 119

Query: 113 RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
                  RS      +G +LT D+N+V +   + Y V +PR YLF++ NP ++L Q  +S
Sbjct: 120 -------RSIRSMPAAGSMLTKDENVVDVKMDIQYRVINPREYLFSVTNPDDSLHQAIDS 172

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           A+R V+G     D+  + R+ +    R+ I+  +D Y  GI +  ++   A PP  V DA
Sbjct: 173 ALRFVIGHTTMDDVITTGREVVRQSTRDNIEAIIDEYHMGIELVDVNFLSARPPEAVKDA 232

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           FD+   A++DE R++ E+  Y+  +  +ARG+   I + + AY+ +I+ +AQGE  RF S
Sbjct: 233 FDDAIAAQEDEQRYIREAEAYARAIEPTARGQVKRIEQEAQAYQQQIVLKAQGEVARFNS 292

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFS 342
           +  QY  AP + R+R+YLETME +     K+++D K +  M YLPL++  S
Sbjct: 293 LLPQYQLAPEVTRQRLYLETMETVYSNTTKIVVDTKGTGNMLYLPLDKIMS 343


>gi|209696181|ref|YP_002264111.1| HflK protein [Aliivibrio salmonicida LFI1238]
 gi|208010134|emb|CAQ80459.1| HflK protein [Aliivibrio salmonicida LFI1238]
          Length = 407

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 97/310 (31%), Positives = 165/310 (53%), Gaps = 13/310 (4%)

Query: 44  IPFFKSYGSVYIILLLIGSFCA--FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWP 101
           +P F + G++ + L+ + +     F   Y +   ER V LR GK  + +  PGL+     
Sbjct: 69  LPSFGNGGAIGLGLIAVVAIAIWIFSGFYTIGESERGVVLRLGK-YDRMVDPGLNWKPTF 127

Query: 102 IDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
           IDQV  V +         +S    ++ GL+LT D+N+V +   V Y V D R YL+ + N
Sbjct: 128 IDQVTAVNI---------QSIRSLNSKGLMLTKDENVVTVEMGVQYRVADARKYLYTVVN 178

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
             ++L+Q ++SA+R V+G     DI  S RQ I    +  + + +D Y  G+++  ++ +
Sbjct: 179 ADDSLRQATDSALRAVIGDAKMDDILTSGRQVIRQRTQETLNRIIDKYDMGLIVVDVNFQ 238

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
            A PP EV  +FD+   A +DE+RF+ E+  YSN +L  A G A  +++ +  Y +R + 
Sbjct: 239 LARPPEEVKASFDDAIAAREDEERFIREAEAYSNDILPKATGRAERLKKEAQGYTERTVN 298

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEA 340
            A G+  +F  +  +Y  AP + R R+YL+TME +     KV+ID + +  + YLPL++ 
Sbjct: 299 GAIGQIAQFEKLLPEYNKAPEVTRTRLYLDTMERVYSNTSKVLIDSESNGNLLYLPLDKM 358

Query: 341 FSRIQTKREI 350
               Q   ++
Sbjct: 359 VGNQQGSAKV 368


>gi|310823110|ref|YP_003955468.1| HflK protein [Stigmatella aurantiaca DW4/3-1]
 gi|309396182|gb|ADO73641.1| HflK protein [Stigmatella aurantiaca DW4/3-1]
          Length = 324

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 104/305 (34%), Positives = 160/305 (52%), Gaps = 19/305 (6%)

Query: 52  SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKV 110
           ++ +  L++G   A    Y   P+ERAV  RFG        PGLH    + ID+V+ V  
Sbjct: 16  NLLVAALILGGMAAQNLFYTAQPEERAVITRFGAVIGQTG-PGLHFKLPFGIDEVQKV-A 73

Query: 111 IER--QQKIGGR---SASVGSNSGL---------ILTGDQNIVGLHFSVLYVVTDPRLYL 156
            ER  +Q+ G R   S   G N  L         +LTGD N++ + + V Y + DP  YL
Sbjct: 74  TERVLKQEFGFRMESSGEGGRNRALTEGYEEEREMLTGDLNMIDVSWVVQYQIQDPIKYL 133

Query: 157 FNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILIN 216
             L  P  TL+  SE+ MR +VG R A D+  + R +I+L  R+ IQ+ M+ Y SG+ I 
Sbjct: 134 HQLREPERTLRDASEAVMRHLVGNRLARDVLTTGRAEISLLARDGIQEAMNGYNSGLRIT 193

Query: 217 TISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYK 276
            + ++   PP+ V  +F+EV  A Q+ +R + E+ K  N+ +  A GEA      + AY 
Sbjct: 194 AVELQSVVPPQRVRSSFNEVNEARQERERMINEAIKQKNQAIPKAIGEAKRTIAEAEAYA 253

Query: 277 DRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMP--Y 334
                 A+G+  RF +I  +Y+ AP + RKR+YLE +  ++ KA K+I+ ++    P  +
Sbjct: 254 VERTHRAKGDVARFQAILKEYLLAPEVTRKRLYLEAIREVVPKAGKIIVVQEGESRPQSF 313

Query: 335 LPLNE 339
             LNE
Sbjct: 314 FHLNE 318


>gi|291619088|ref|YP_003521830.1| HflK [Pantoea ananatis LMG 20103]
 gi|291154118|gb|ADD78702.1| HflK [Pantoea ananatis LMG 20103]
 gi|327395420|dbj|BAK12842.1| protein HflK [Pantoea ananatis AJ13355]
          Length = 410

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 94/270 (34%), Positives = 153/270 (56%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     IDQV  V V E  +++          SG
Sbjct: 91  YTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDQVRAVNV-EAVRELAA--------SG 140

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YLF + +  ++L+Q ++SA+R V+GR     I   
Sbjct: 141 VMLTSDENVVRVEMNVQYRVTDPERYLFAVTSADDSLRQATDSALRGVIGRSTMDRILTE 200

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  E +  I +T+  Y  GI +  ++ + A PP EV  AFD+   A ++ +++V E
Sbjct: 201 GRTVVRSETQREIDETIRPYNMGITVLDVNFQAARPPEEVKSAFDDAIAARENREQYVRE 260

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G A  + E + AYK+R + EAQGE  RF  +  +Y  AP + ++R+Y
Sbjct: 261 AEAYANEVQPRANGRAQRVLEEARAYKERTVLEAQGEVARFAKLLPEYKAAPEITKERLY 320

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ + + +  LPL++
Sbjct: 321 IETMERVLSHTRKVLVNDRGNNLMVLPLDQ 350


>gi|157828037|ref|YP_001494279.1| protease activity modulator HflK [Rickettsia rickettsii str.
           'Sheila Smith']
 gi|165932735|ref|YP_001649524.1| protease activity modulator [Rickettsia rickettsii str. Iowa]
 gi|157800518|gb|ABV75771.1| protease activity modulator HflK [Rickettsia rickettsii str.
           'Sheila Smith']
 gi|165907822|gb|ABY72118.1| protease activity modulator [Rickettsia rickettsii str. Iowa]
          Length = 346

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 90/281 (32%), Positives = 166/281 (59%), Gaps = 15/281 (5%)

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE-RQQKIGGRSASV-- 124
           IY +   E A  +RFG+     + PGL+     P +++ + KV + R+ +IG R+ S   
Sbjct: 67  IYEIKEGEEAAVIRFGRFVRKGY-PGLNYHLPAPFEKIIVEKVKQSRRIEIGYRTNSSLR 125

Query: 125 --GSNS------GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMRE 176
             G N+       ++LTGD+NI+ L+  V++ + +   ++FN++ P ET+K   ESA+RE
Sbjct: 126 SGGDNTKNIAGESIMLTGDENIIALNCDVMWHINNLEDFIFNVQRPAETVKATVESAVRE 185

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
           V+G      +   Q+Q+I  ++  L QK +D Y +G++I  + +  A PP EV DA+ +V
Sbjct: 186 VIGNTPISWVLSDQKQEITYKIEKLAQKILDSYNAGVMIEKVQLLKAEPPAEVIDAYRDV 245

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
           Q ++ D+++ + ++  Y+N++L  ARG A+ I + +  Y+  +I +A+G++ RF +IY Q
Sbjct: 246 QTSKADKEKEINQAQAYNNKILPEARGAAAKIIQEAEGYRAEVISKAEGDSQRFNAIYKQ 305

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPL 337
           Y     + R R+YLE +E +L  + K II+   +++P++ +
Sbjct: 306 YATGRQVTRDRLYLEVVEEVLGGSNKTIIN--NALLPHMAI 344


>gi|264679416|ref|YP_003279323.1| HflK protein [Comamonas testosteroni CNB-2]
 gi|299530498|ref|ZP_07043918.1| HflK protein [Comamonas testosteroni S44]
 gi|262209929|gb|ACY34027.1| HflK protein [Comamonas testosteroni CNB-2]
 gi|298721474|gb|EFI62411.1| HflK protein [Comamonas testosteroni S44]
          Length = 463

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 105/301 (34%), Positives = 175/301 (58%), Gaps = 23/301 (7%)

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQ 115
           +L+ +G+       +IV   ++AV  +FGK K+ V       + +P+ + E+V V +   
Sbjct: 126 VLIWLGT-----GFFIVQEGQQAVITQFGKYKSTVGAGFNWRLPYPVQKHELVYVSQI-- 178

Query: 116 KIGGRSASVGSN-----SGL----ILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
               RSA VGS+     +GL    +LT D+NIV + F+V Y ++D R +LF   +P E +
Sbjct: 179 ----RSAEVGSDNIVRSTGLRESAMLTEDENIVEIKFAVQYRLSDARAWLFESRSPSEAV 234

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDAS-- 224
            QV+ESA+REVVG+         +R QIA  VR+L+Q  +D YK G+ +  I+++     
Sbjct: 235 IQVAESAVREVVGKMKMDAALAEERDQIAPRVRDLMQSILDRYKVGVEVVGINMQQGGVR 294

Query: 225 PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQ 284
           PP +V  +FD+V +A Q+ +R   E+  Y+N V+  A G A+ + E + AYK +I+ +AQ
Sbjct: 295 PPEQVQASFDDVLKAGQERERAKNEAQAYANDVVPRAAGAAARLGEEAAAYKSKIVAQAQ 354

Query: 285 GEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFSR 343
           G+A RF S+Y +Y  AP + R R+Y++ M+ +     KV+++ +Q S + YLPL++    
Sbjct: 355 GDAGRFSSLYSEYQKAPQVTRDRLYIDAMQQVYTNVTKVLVESRQGSNLLYLPLDKIMQN 414

Query: 344 I 344
           +
Sbjct: 415 V 415


>gi|156932405|ref|YP_001436321.1| FtsH protease regulator HflK [Cronobacter sakazakii ATCC BAA-894]
 gi|156530659|gb|ABU75485.1| hypothetical protein ESA_00184 [Cronobacter sakazakii ATCC BAA-894]
          Length = 414

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 96/270 (35%), Positives = 155/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID+V  V V E  +++          SG
Sbjct: 91  YTIKEAERGVVTRFGK-FSHLVEPGLNWKPTFIDEVVPVNV-EAVRELAA--------SG 140

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP+ YLF++ N  ++L+Q ++SA+R V+G+     I   
Sbjct: 141 IMLTSDENVVRVEMNVQYRVTDPQRYLFSVANADDSLRQATDSALRGVIGKYTMDRILTE 200

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 201 GRTVIRSDTQRELEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 260

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  YSN V   A G+A  I E + AYK + + EAQGE  RF  I  +Y  AP + R+R+Y
Sbjct: 261 AEAYSNEVQPRANGQAQRILEEARAYKTQTVLEAQGEVARFAKILPEYKAAPEITRERLY 320

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K   +  LPL++
Sbjct: 321 IETMEKVLSHTRKVLVNDKGGNLMVLPLDQ 350


>gi|304396953|ref|ZP_07378833.1| HflK protein [Pantoea sp. aB]
 gi|304355749|gb|EFM20116.1| HflK protein [Pantoea sp. aB]
          Length = 412

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/270 (34%), Positives = 151/270 (55%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     IDQV  V V          S    + SG
Sbjct: 91  YTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDQVRAVNV---------ESVRELAASG 140

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YL+ + +  ++L+Q ++SA+R V+GR     I   
Sbjct: 141 VMLTSDENVVRVEMNVQYRVTDPERYLYAVTSADDSLRQATDSALRGVIGRSTMDRILTE 200

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  E +  I +T+  Y  G+ +  ++ + A PP EV  AFD+   A ++ +++V E
Sbjct: 201 GRTVVRSETQREIDETIRPYNMGVAVVDVNFQAARPPEEVKSAFDDAIAARENREQYVRE 260

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G A  I E + AYK+R + EAQGE  RF  I  +Y  AP + ++R+Y
Sbjct: 261 AEAYANEVQPRANGRAQRILEEARAYKERTVLEAQGEVARFAKILPEYKAAPEITKERLY 320

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ + + +  LPL++
Sbjct: 321 IETMERVLSHTRKVLVNDRGNNLMVLPLDQ 350


>gi|127511502|ref|YP_001092699.1| HflK protein [Shewanella loihica PV-4]
 gi|126636797|gb|ABO22440.1| HflK protein [Shewanella loihica PV-4]
          Length = 380

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 115/339 (33%), Positives = 172/339 (50%), Gaps = 24/339 (7%)

Query: 19  NGNGDGLPPFDVEAIIRYIKDKFDLIPF-----FKSYGSVYIILLLIGSFC-AFQSIYIV 72
           N NG+   P D++ + + I  +F          F + G  +II+L I          Y V
Sbjct: 16  NKNGNDKGPPDLDEVFKNISKRFGGKGNGAGGGFSALG--FIIVLGIAVVVWGLSGFYTV 73

Query: 73  HPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGS--NSGL 130
              E+ V LRFGK    V  PGL      ID+V  V V           ++V S   SG 
Sbjct: 74  KEAEKGVALRFGKYIGQV-EPGLQWKATFIDEVFPVNV-----------SNVRSIPASGS 121

Query: 131 ILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQ 190
           +LT D+N+V +   V Y+V D   YLF+  +   +L++ ++SA+R VVG     DI  + 
Sbjct: 122 MLTADENVVLVELDVQYIVVDAYRYLFSAVDANSSLREATDSALRYVVGHNKMDDILTTG 181

Query: 191 RQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEES 250
           R QI  +    +++ +  Y  GI I  ++   A PP EV DAFD+   A++DE RF+ E+
Sbjct: 182 RDQIRRDTWEEVERIIKPYNLGIEIRDVNFLPARPPEEVKDAFDDAIAAQEDEQRFIREA 241

Query: 251 NKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYL 310
             YS  V   ARG    + + + AYK+R I EA+G+  RF  +  +Y  AP + R R+Y+
Sbjct: 242 EAYSREVEPKARGTVQRMEQQANAYKEREILEARGKVARFEKLLPEYKAAPEVTRARLYI 301

Query: 311 ETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFS-RIQTK 347
           + M  +L    KV++D K  + M YLPL++    R QTK
Sbjct: 302 DAMSNVLSGTNKVLVDSKAGNNMMYLPLDKLMEQRPQTK 340


>gi|91794551|ref|YP_564202.1| HflK protein [Shewanella denitrificans OS217]
 gi|91716553|gb|ABE56479.1| HflK protein [Shewanella denitrificans OS217]
          Length = 386

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 106/341 (31%), Positives = 174/341 (51%), Gaps = 21/341 (6%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLI--------PFFKSYGSVYIILLLIGSFCAFQS 68
           G+  N D  PP D++ + R +  +F             F + G V   ++ +  + A   
Sbjct: 15  GNKSNNDKGPP-DLDEVFRNLSKRFGGGGKGDGGSGASFSTAGFVIFAVIALVVWAA-SG 72

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +Y +   ER V LRFG+ + +V  PGLH     ID+V  V V          +      S
Sbjct: 73  LYTIKEAERGVMLRFGQFQEEVG-PGLHWKATFIDKVYPVDV---------ETVRSVPAS 122

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           G +LT D+N+V +   + Y V +   YLF+  +  E+L++ ++SA+R VVG     DI  
Sbjct: 123 GSMLTSDENVVKVELDIQYRVLNAYEYLFSAVDANESLREATDSALRYVVGHNRMDDILT 182

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
           + R  I  +    ++  ++ YK G++I  ++   A PP EV DAFD+   A++DE RF+ 
Sbjct: 183 TGRDAIRRDTWKELELILEPYKLGLVIVDVNFLPARPPEEVKDAFDDAISAQEDEQRFIR 242

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           E+  Y+  +   ARGE   + + + AYK R + EA+G+  RF  +  +Y  AP + R R+
Sbjct: 243 EAEAYAREIEPKARGEVQRMFQQASAYKQREVLEARGKVARFEKLLPEYKAAPEVTRNRL 302

Query: 309 YLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQTKR 348
           Y++ M+ +     KV+ID K S  M YLPL++  ++    R
Sbjct: 303 YIDAMQSVFADTNKVLIDTKNSGNMMYLPLDKMMNQGSKTR 343


>gi|320539675|ref|ZP_08039339.1| modulator for HflB protease specific for phage lambda cII repressor
           [Serratia symbiotica str. Tucson]
 gi|320030287|gb|EFW12302.1| modulator for HflB protease specific for phage lambda cII repressor
           [Serratia symbiotica str. Tucson]
          Length = 419

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 91/272 (33%), Positives = 154/272 (56%), Gaps = 10/272 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID+V  V V          S    + SG
Sbjct: 97  YTIKEAERGVVTRFGKFSH-LVQPGLNWKPTFIDEVRPVNV---------ESVRELAASG 146

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N++ +  +V Y VT+P  YLF++ N  ++L Q ++SA+R V+G+     I   
Sbjct: 147 VMLTSDENVLRVEMNVQYRVTNPETYLFSVVNADDSLSQATDSALRGVIGKYSMDRILTE 206

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  Y  GI +  ++ + A PP EV  +FD+   A ++E +++ E
Sbjct: 207 GRTVVRNDTQRMLEETIRPYNMGITLLDVNFQAARPPEEVKASFDDAIAARENEQQYIRE 266

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  + E + AYKDR + EAQGE  RF  +  +Y +AP + R+R+Y
Sbjct: 267 AEAYANEVQPRANGQAQRLLEDAKAYKDRTVLEAQGEVARFAKLLPEYKSAPDITRERLY 326

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNEAF 341
           +ETME +L   +KV++  K + +  LPL++  
Sbjct: 327 IETMEKVLSHTRKVLVSDKGNNLMVLPLDQML 358


>gi|237729107|ref|ZP_04559588.1| FtsH protease regulator HflK [Citrobacter sp. 30_2]
 gi|226908836|gb|EEH94754.1| FtsH protease regulator HflK [Citrobacter sp. 30_2]
          Length = 417

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/270 (35%), Positives = 156/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     +D+V  V V E  +++          SG
Sbjct: 98  YTIKEAERGVVTRFGK-FSHLVEPGLNWKPTFVDEVTPVNV-EAVRELAA--------SG 147

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP+ YLF++ +  ++L+Q ++SA+R V+G+     I   
Sbjct: 148 VMLTSDENVVRVEMNVQYRVTDPQRYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTE 207

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 208 GRTVIRSDTQRELEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 267

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK + I EAQGE  RF  I  +Y  AP + R+R+Y
Sbjct: 268 AEAYTNEVQPRANGQAQRILEEARAYKTQTILEAQGEVARFAKILPEYKAAPQITRERLY 327

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K S +  LPL++
Sbjct: 328 IETMEKVLSNTRKVLVNDKGSNLMVLPLDQ 357


>gi|332531845|ref|ZP_08407730.1| protein HflK [Pseudoalteromonas haloplanktis ANT/505]
 gi|332038821|gb|EGI75263.1| protein HflK [Pseudoalteromonas haloplanktis ANT/505]
          Length = 389

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 106/354 (29%), Positives = 181/354 (51%), Gaps = 30/354 (8%)

Query: 17  GSNGN---------GDGLPPFDVEAIIRYIKDKFDLI----------PFFKSYGSVYIIL 57
           G+NGN         G    P D++ + R   +KF  +                  +  IL
Sbjct: 7   GNNGNDKDPWNNKGGRDQGPPDLDEVFRKFSNKFSGLFGGKKSGNGSGGGLGGAGISFIL 66

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           ++     A   IY V   ER V L+FGK  + +  PGL    W +  +E V  ++ +   
Sbjct: 67  IIAVIVWALSGIYTVKEAERGVVLQFGK-YDRIADPGLR---WKMTFIETVIPVDIE--- 119

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
             RS S    SG +LT D+N+V + F V Y V DP LY F++ N   +L++  +SA+R V
Sbjct: 120 AVRSLSA---SGFMLTEDENVVSVEFQVQYRVIDPYLYEFSVTNADSSLEEALDSALRYV 176

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG      +  + R+ +     + + K ++ Y  G+++  ++ +D+ PP EV DAFD+  
Sbjct: 177 VGHAKMDQVLTNGREVVRQNTWDELNKIIEPYNLGLIVTDVNFKDSRPPTEVKDAFDDAI 236

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
            A++DE+RF+ E+  Y+  +   ARG+ + + + +  Y++RI  EAQGE  RF  +  +Y
Sbjct: 237 AAQEDEERFIREAEAYAREIEPRARGQVTRMTQEAEGYQERITLEAQGEVARFEKLLPEY 296

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSRIQTKREI 350
             A  + R+R+Y++ ME +L  + K+++D K  + M YLPL++   +  T   +
Sbjct: 297 QAAKEVTRERLYIDAMEEVLGSSSKILVDVKGGNNMMYLPLDKIMDKQGTATRV 350


>gi|238784771|ref|ZP_04628773.1| hypothetical protein yberc0001_7560 [Yersinia bercovieri ATCC
           43970]
 gi|238714284|gb|EEQ06294.1| hypothetical protein yberc0001_7560 [Yersinia bercovieri ATCC
           43970]
          Length = 333

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 93/275 (33%), Positives = 153/275 (55%), Gaps = 10/275 (3%)

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASV 124
           A    Y +   ER V  R GK  + +  PGL+     ID+V  V V          S   
Sbjct: 5   AASGFYTIKEAERGVVTRLGKLSH-IVQPGLNWKPTFIDEVTPVNV---------ESVRE 54

Query: 125 GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAV 184
            + SG++LT D+N+V +  +V Y VTDP  YLF++ NP ++L+Q ++SA+R V+G+    
Sbjct: 55  LAASGVMLTSDENVVRIEMNVQYRVTDPAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMD 114

Query: 185 DIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDED 244
            I    R  +  + + ++++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E 
Sbjct: 115 KILTEGRTIVRSDTQRVLEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQ 174

Query: 245 RFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLL 304
           +++ E+  Y+N V   A G+A  + E + AY  R + EAQGE   F  +  +Y  AP + 
Sbjct: 175 QYIREAEAYTNEVQPRANGQAQRLLEDARAYAARKVLEAQGEVAGFAKLLPEYKAAPEIT 234

Query: 305 RKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           R+R+Y+ETME +L K +KV+ + K + +  LPL++
Sbjct: 235 RERLYIETMEKVLGKTRKVLANDKGNSLMVLPLDQ 269


>gi|15601982|ref|NP_245054.1| HflK [Pasteurella multocida subsp. multocida str. Pm70]
 gi|12720330|gb|AAK02201.1| HflK [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 419

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 98/301 (32%), Positives = 164/301 (54%), Gaps = 12/301 (3%)

Query: 49  SYGSVYIILLLIGSFC-AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEI 107
           + G +  I  +IG+        Y V   ER V +RFG+  + +  PGL+     ID+V  
Sbjct: 86  NLGKLLPIAAVIGAIVWGVSGFYTVKEAERGVVMRFGE-LHAIVQPGLNWKPTFIDRVIP 144

Query: 108 VKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
           V V E+ +++           G +LT D+N+V +  +V Y V DP  YLF++ N  ++L 
Sbjct: 145 VNV-EQVKEL--------RTQGSMLTQDENMVKVEMTVQYRVHDPAKYLFSVTNADDSLN 195

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPR 227
           Q ++SA+R V+G     DI  + R  +       +   ++ Y  G+ +  ++ + A PP 
Sbjct: 196 QATDSALRYVIGHMSMDDILTTGRSVVRENTWKTLNTIIEPYNMGLEVVDVNFQSARPPE 255

Query: 228 EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEA 287
           EV DAFD+  +A++DE R++ E+  Y+      ARG+A  I E + AYKDR++ +A+GE 
Sbjct: 256 EVKDAFDDAIKAQEDEQRYIREAEAYAREREPIARGDAQRILEEATAYKDRVVLDAKGEV 315

Query: 288 DRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFSRIQT 346
           +RF  +  ++  AP LLR+R+Y++TME ++    KV++D    + +  LPL +     QT
Sbjct: 316 ERFERLLPEFKAAPELLRERLYIQTMEKVMANTPKVMLDGNSGNNLTVLPLEQILKGQQT 375

Query: 347 K 347
           K
Sbjct: 376 K 376


>gi|329123842|ref|ZP_08252400.1| FtsH protease regulator HflK [Haemophilus aegyptius ATCC 11116]
 gi|327469329|gb|EGF14800.1| FtsH protease regulator HflK [Haemophilus aegyptius ATCC 11116]
          Length = 409

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 95/296 (32%), Positives = 162/296 (54%), Gaps = 12/296 (4%)

Query: 50  YGSVYIILLLIGSFC-AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIV 108
           +G V  + ++IG+        Y +   ER V LRFG+  + +  PGL+     +D+V  V
Sbjct: 83  FGKVIPLAVVIGAIIWGVNGFYTIKEAERGVVLRFGE-LHSIVQPGLNWKPTFVDKVLPV 141

Query: 109 KVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
            V E+ +++           G +LT D+N+V +  +V Y V DP  YLF++ N  ++L Q
Sbjct: 142 NV-EQVKEL--------RTQGAMLTQDENMVKVEMTVQYRVQDPAKYLFSVTNADDSLNQ 192

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
            ++SA+R V+G     DI  + R  +       + + +  Y  G+ +  ++ + A PP E
Sbjct: 193 ATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIKSYDMGLEVIDVNFQSARPPEE 252

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V DAFD+  +A++DE RF+ E+  Y+      ARG+A  I E + AYKDRI+ +A+GE +
Sbjct: 253 VKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQRILEEATAYKDRIVLDAKGEVE 312

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFSR 343
           R   +  ++  AP LLR+R+Y++TME ++    KV++D    + +  LPL +   +
Sbjct: 313 RLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDGNNGNNLTVLPLEQIMGK 368


>gi|119502794|ref|ZP_01624879.1| Heat shock protein HslU [marine gamma proteobacterium HTCC2080]
 gi|119461140|gb|EAW42230.1| Heat shock protein HslU [marine gamma proteobacterium HTCC2080]
          Length = 391

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 97/287 (33%), Positives = 164/287 (57%), Gaps = 13/287 (4%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           +I   + +  A    Y +   ERA+ LRFGK       PGL      ID  E++KV    
Sbjct: 68  VIAAGVITVWALLGFYQLDEQERAIVLRFGKYAG-TMQPGLQWNPPLID--EVIKV--NT 122

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
            KI  R+A V     ++LT D+NIV +  S+ Y++ DP  ++  + +P  +L+  ++SA+
Sbjct: 123 TKI--RAAQVRE---VMLTQDENIVEVTMSLQYIIDDPEKFVLEVRDPEVSLQHAAQSAL 177

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           R VVG      +    R  IA +VR+ +Q  +D Y +GI ++ I+I++  PP +V  AFD
Sbjct: 178 RHVVGDSTMDLVLTEGRAAIAGDVRDRLQTYLDTYGTGIRVSKINIDEGKPPAQVQGAFD 237

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +V +A +DE+R   E+  Y+N ++  ARG A  + E + AY+ +++ +A+GEA RF  + 
Sbjct: 238 DVIKAREDEERVKNEAQSYANGIVPEARGRAQRVFEEASAYQQQVMAQAEGEASRFTQLL 297

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
            +Y  +P + R R+YL+ M+ ++    KV++D +   +VM YLPL++
Sbjct: 298 AEYEKSPKVTRDRLYLDAMQTVMANTNKVLVDVEGGNNVM-YLPLDK 343


>gi|157373938|ref|YP_001472538.1| HflK protein [Shewanella sediminis HAW-EB3]
 gi|157316312|gb|ABV35410.1| HflK protein [Shewanella sediminis HAW-EB3]
          Length = 381

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 111/341 (32%), Positives = 174/341 (51%), Gaps = 20/341 (5%)

Query: 19  NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGS-----VYIILLLIGSFCAFQSIYIVH 73
           N NG+   P D++ + R I  +F       S        + I+L +          Y V 
Sbjct: 16  NKNGNDKGPPDLDEVFRNISKRFGGGKGSGSGPGVSSFGLVIVLGIALVVWGLSGFYTVK 75

Query: 74  PDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGS--NSGLI 131
             ER V LRFG+   +V  PGL      ID+V  V V           ++V S   SG +
Sbjct: 76  EAERGVALRFGEYIGEV-EPGLQWKATFIDEVYPVNV-----------STVRSIPASGSM 123

Query: 132 LTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQR 191
           LT D+N+V +   V Y V D   +LF+  +   +L++ ++SA+R VVG     DI  + R
Sbjct: 124 LTADENVVLVELDVQYRVVDAYRFLFSAVDANASLREATDSALRYVVGHNKMDDILTTGR 183

Query: 192 QQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESN 251
            QI  +    +++ ++ Y+ GI I  ++   A PP EV DAFD+   A++DE RF+ E+ 
Sbjct: 184 DQIRRDTWEEVERIIEPYQLGINIVDVNFLPARPPEEVKDAFDDAISAQEDEQRFIREAE 243

Query: 252 KYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLE 311
            Y+  +   ARG+   + + + AYK+R I EA+G+   F  +  QY  AP + R+R+YL+
Sbjct: 244 AYARAIEPKARGQVQRMEQQANAYKEREILEAKGKVASFELLLPQYTAAPEVTRERLYLD 303

Query: 312 TMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQTKREIR 351
            M+ +LK   KV++D K S  M YLPL++     Q+  + R
Sbjct: 304 AMQTVLKDTNKVLVDSKSSGNMMYLPLDKLMQSGQSDTKPR 344


>gi|300715042|ref|YP_003739845.1| Protease specific for phage lambda cII repressor [Erwinia
           billingiae Eb661]
 gi|299060878|emb|CAX57985.1| Protease specific for phage lambda cII repressor [Erwinia
           billingiae Eb661]
          Length = 416

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 94/270 (34%), Positives = 154/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     IDQV  V V E  +++          SG
Sbjct: 93  YTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDQVRAVNV-EAVRELAA--------SG 142

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
            +LT D+N+V +  +V Y VT+P  YLF + +  ++L+Q ++SA+R V+GR     I   
Sbjct: 143 TMLTSDENVVRVEMNVQYRVTNPERYLFAVTSADDSLRQATDSALRGVIGRSTMDRILTE 202

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + +  +++T+  Y  GI +  ++ + A PP EV  +FD+   A ++ +++V E
Sbjct: 203 GRTVVRSDTQRELEETIRPYDMGITLLDVNFQAARPPEEVKASFDDAIAARENREQYVRE 262

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK R + EAQGE DRF  +  +Y  AP + R+R+Y
Sbjct: 263 AEAYANEVQPRANGQAQRILEEARAYKTRTVLEAQGEVDRFAKLLPEYKAAPEITRERLY 322

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K + +  LPL++
Sbjct: 323 IETMERVLSHTRKVLVNDKGNNLMVLPLDQ 352


>gi|68248759|ref|YP_247871.1| HflK [Haemophilus influenzae 86-028NP]
 gi|68056958|gb|AAX87211.1| HflK [Haemophilus influenzae 86-028NP]
          Length = 410

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 97/301 (32%), Positives = 163/301 (54%), Gaps = 14/301 (4%)

Query: 45  PFFKSYGSVYIILLLIGSFC-AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPID 103
           PF   +G V  + + IG+        Y +   ER V LRFG+  + +  PGL+     +D
Sbjct: 81  PFH--FGKVIPLAVAIGAIIWGVSGFYTIKEAERGVVLRFGE-LHSIVQPGLNWKPTFVD 137

Query: 104 QVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           +V  V V E+ +++           G +LT D+N+V +  +V Y V DP  YLF++ N  
Sbjct: 138 KVLPVNV-EQVKEL--------RTQGAMLTQDENMVKVEMTVQYRVQDPAKYLFSVTNAD 188

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           ++L Q ++SA+R V+G     DI  + R  +       + + +  Y  G+ +  ++ + A
Sbjct: 189 DSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIKSYDMGLEVIDVNFQSA 248

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  I E + AYKDRI+ +A
Sbjct: 249 RPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQRILEEATAYKDRIVLDA 308

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFS 342
           +GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D    + +  LPL +   
Sbjct: 309 KGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDGNNGNNLTVLPLEQIMG 368

Query: 343 R 343
           +
Sbjct: 369 K 369


>gi|16272119|ref|NP_438321.1| HflK [Haemophilus influenzae Rd KW20]
 gi|260581312|ref|ZP_05849129.1| HflK protein [Haemophilus influenzae RdAW]
 gi|1170267|sp|P44546|HFLK_HAEIN RecName: Full=Protein HflK
 gi|1573108|gb|AAC21822.1| hflK protein (hflK) [Haemophilus influenzae Rd KW20]
 gi|260092061|gb|EEW76007.1| HflK protein [Haemophilus influenzae RdAW]
          Length = 410

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 97/301 (32%), Positives = 163/301 (54%), Gaps = 14/301 (4%)

Query: 45  PFFKSYGSVYIILLLIGSFC-AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPID 103
           PF   +G V  + + IG+        Y +   ER V LRFG+  + +  PGL+     +D
Sbjct: 81  PFH--FGKVIPLAVAIGAIIWGVNGFYTIKEAERGVVLRFGE-LHSIVQPGLNWKPTFVD 137

Query: 104 QVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           +V  V V E+ +++           G +LT D+N+V +  +V Y V DP  YLF++ N  
Sbjct: 138 KVLPVNV-EQVKEL--------RTQGAMLTQDENMVKVEMTVQYRVQDPAKYLFSVTNAD 188

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           ++L Q ++SA+R V+G     DI  + R  +       + + +  Y  G+ +  ++ + A
Sbjct: 189 DSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIKSYDMGLEVIDVNFQSA 248

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  I E + AYKDRI+ +A
Sbjct: 249 RPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQRILEEATAYKDRIVLDA 308

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFS 342
           +GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D    + +  LPL +   
Sbjct: 309 KGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDGNNGNNLTVLPLEQIMG 368

Query: 343 R 343
           +
Sbjct: 369 K 369


>gi|238650702|ref|YP_002916555.1| protease activity modulator HflK [Rickettsia peacockii str. Rustic]
 gi|238624800|gb|ACR47506.1| protease activity modulator HflK [Rickettsia peacockii str. Rustic]
          Length = 346

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 90/281 (32%), Positives = 164/281 (58%), Gaps = 15/281 (5%)

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE-RQQKIGGRSASV-- 124
           IY +   E A  +RFG+     + PGL+     P +++ + KV + R+ +IG R+ S   
Sbjct: 67  IYEIKEGEEAAVIRFGRFVRKGY-PGLNYHLPAPFEKIIVEKVKQSRRIEIGYRTNSSLR 125

Query: 125 --GSNS------GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMRE 176
             G N+       ++LTGD+NI+ L+  V++ + +   ++FN++ P ET+K   ESA+RE
Sbjct: 126 SGGDNTKNIAGESIMLTGDENIIALNCDVMWHINNLEDFIFNVQRPAETVKATVESAVRE 185

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
           V+G      +   Q+Q+I  ++  L QK +D Y  G++I  + +  A PP EV DA+ +V
Sbjct: 186 VIGNTPISWVLSDQKQEITYKIEKLAQKILDSYNVGVMIEKVQLLKAEPPAEVIDAYRDV 245

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
           Q ++ D+++ + ++  Y+N++L  ARG A+ I + +  Y+  +I +A+G+  RF +IY Q
Sbjct: 246 QTSKADKEKEINQAQAYNNKILPEARGAAAKIIQEAEGYRAEVISKAEGDGQRFNAIYKQ 305

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPL 337
           Y     + R R+YLE +E +L  + K II+   +++P++ +
Sbjct: 306 YATGRQVTRDRLYLEVVEEVLGGSNKTIIN--NALLPHMAI 344


>gi|319898118|ref|YP_004136315.1| hflk [Haemophilus influenzae F3031]
 gi|317433624|emb|CBY82009.1| HflK [Haemophilus influenzae F3031]
          Length = 406

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 97/301 (32%), Positives = 163/301 (54%), Gaps = 14/301 (4%)

Query: 45  PFFKSYGSVYIILLLIGSFC-AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPID 103
           PF   +G V  + + IG+        Y +   ER V LRFG+  + +  PGL+     +D
Sbjct: 77  PFH--FGKVIPLAVAIGAIIWGVSGFYTIKEAERGVVLRFGE-LHSIVQPGLNWKPTFVD 133

Query: 104 QVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           +V  V V E+ +++           G +LT D+N+V +  +V Y V DP  YLF++ N  
Sbjct: 134 KVLPVNV-EQVKEL--------RTQGAMLTQDENMVKVEMTVQYRVQDPAKYLFSVTNAD 184

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           ++L Q ++SA+R V+G     DI  + R  +       + + +  Y  G+ +  ++ + A
Sbjct: 185 DSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIKSYDMGLEVIDVNFQSA 244

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  I E + AYKDRI+ +A
Sbjct: 245 RPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQRILEEATAYKDRIVLDA 304

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFS 342
           +GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D    + +  LPL +   
Sbjct: 305 KGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDGNNGNNLTVLPLEQIMG 364

Query: 343 R 343
           +
Sbjct: 365 K 365


>gi|308188267|ref|YP_003932398.1| protease specific for phage lambda cII repressor [Pantoea vagans
           C9-1]
 gi|308058777|gb|ADO10949.1| protease specific for phage lambda cII repressor [Pantoea vagans
           C9-1]
          Length = 412

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 93/270 (34%), Positives = 154/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     +DQV  V V E  +++          SG
Sbjct: 91  YTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFVDQVRAVNV-EAVRELAA--------SG 140

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YL+ + +  ++L+Q ++SA+R V+GR     I   
Sbjct: 141 VMLTSDENVVRVEMNVQYRVTDPERYLYAVTSADDSLRQATDSALRGVIGRSTMDRILTE 200

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + +  I +T+  Y  GI +  ++ + A PP EV  AFD+   A ++ +++V E
Sbjct: 201 GRTVVRSDTQREIDETIRPYNMGIAVLDVNFQAARPPEEVKSAFDDAIAARENREQYVRE 260

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK+R + EAQGE  RF  I  +Y  AP + ++R+Y
Sbjct: 261 AEAYANEVQPRANGQAQRILEEARAYKERTVLEAQGEVARFAKILPEYKAAPEITKERLY 320

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ + + +  LPL++
Sbjct: 321 IETMERVLSHTRKVLVNDRGNNLMMLPLDQ 350


>gi|229845453|ref|ZP_04465583.1| HflK [Haemophilus influenzae 6P18H1]
 gi|229811649|gb|EEP47348.1| HflK [Haemophilus influenzae 6P18H1]
          Length = 406

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 97/301 (32%), Positives = 163/301 (54%), Gaps = 14/301 (4%)

Query: 45  PFFKSYGSVYIILLLIGSFC-AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPID 103
           PF   +G V  + + IG+        Y +   ER V LRFG+  + +  PGL+     +D
Sbjct: 77  PFH--FGKVIPLAVAIGAIIWGVSGFYTIKEAERGVVLRFGE-LHSIVQPGLNWKPTFVD 133

Query: 104 QVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           +V  V V E+ +++           G +LT D+N+V +  +V Y V DP  YLF++ N  
Sbjct: 134 KVLPVNV-EQVKEL--------RTQGAMLTQDENMVKVEMTVQYRVQDPAKYLFSVTNAD 184

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           ++L Q ++SA+R V+G     DI  + R  +       + + +  Y  G+ +  ++ + A
Sbjct: 185 DSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIKSYDMGLEVIDVNFQSA 244

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  I E + AYKDRI+ +A
Sbjct: 245 RPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQRILEEATAYKDRIVLDA 304

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFS 342
           +GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D    + +  LPL +   
Sbjct: 305 KGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDGNNGNNLTVLPLEQIMG 364

Query: 343 R 343
           +
Sbjct: 365 K 365


>gi|145639793|ref|ZP_01795395.1| HflK [Haemophilus influenzae PittII]
 gi|148825581|ref|YP_001290334.1| FtsH protease regulator HflK [Haemophilus influenzae PittEE]
 gi|229847269|ref|ZP_04467372.1| HflK [Haemophilus influenzae 7P49H1]
 gi|145271161|gb|EDK11076.1| HflK [Haemophilus influenzae PittII]
 gi|148715741|gb|ABQ97951.1| HflK [Haemophilus influenzae PittEE]
 gi|229809812|gb|EEP45535.1| HflK [Haemophilus influenzae 7P49H1]
          Length = 406

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 97/301 (32%), Positives = 163/301 (54%), Gaps = 14/301 (4%)

Query: 45  PFFKSYGSVYIILLLIGSFC-AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPID 103
           PF   +G V  + + IG+        Y +   ER V LRFG+  + +  PGL+     +D
Sbjct: 77  PFH--FGKVIPLAVAIGAIIWGVSGFYTIKEAERGVVLRFGE-LHSIVQPGLNWKPTFVD 133

Query: 104 QVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           +V  V V E+ +++           G +LT D+N+V +  +V Y V DP  YLF++ N  
Sbjct: 134 KVLPVNV-EQVKEL--------RTQGAMLTQDENMVKVEMTVQYRVQDPAKYLFSVTNAD 184

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           ++L Q ++SA+R V+G     DI  + R  +       + + +  Y  G+ +  ++ + A
Sbjct: 185 DSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIKSYDMGLEVIDVNFQSA 244

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  I E + AYKDRI+ +A
Sbjct: 245 RPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQRILEEATAYKDRIVLDA 304

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFS 342
           +GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D    + +  LPL +   
Sbjct: 305 KGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDGNNGNNLTVLPLEQIMG 364

Query: 343 R 343
           +
Sbjct: 365 K 365


>gi|145641484|ref|ZP_01797062.1| HflK [Haemophilus influenzae R3021]
 gi|145273775|gb|EDK13643.1| HflK [Haemophilus influenzae 22.4-21]
 gi|301168804|emb|CBW28395.1| modulator for HflB protease specific for phage lambda cII repressor
           [Haemophilus influenzae 10810]
          Length = 406

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 97/301 (32%), Positives = 163/301 (54%), Gaps = 14/301 (4%)

Query: 45  PFFKSYGSVYIILLLIGSFC-AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPID 103
           PF   +G V  + + IG+        Y +   ER V LRFG+  + +  PGL+     +D
Sbjct: 77  PFH--FGKVIPLAVAIGAIIWGVNGFYTIKEAERGVVLRFGE-LHSIVQPGLNWKPTFVD 133

Query: 104 QVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           +V  V V E+ +++           G +LT D+N+V +  +V Y V DP  YLF++ N  
Sbjct: 134 KVLPVNV-EQVKEL--------RTQGAMLTQDENMVKVEMTVQYRVQDPAKYLFSVTNAD 184

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           ++L Q ++SA+R V+G     DI  + R  +       + + +  Y  G+ +  ++ + A
Sbjct: 185 DSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIKSYDMGLEVIDVNFQSA 244

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  I E + AYKDRI+ +A
Sbjct: 245 RPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQRILEEATAYKDRIVLDA 304

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFS 342
           +GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D    + +  LPL +   
Sbjct: 305 KGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDGNNGNNLTVLPLEQIMG 364

Query: 343 R 343
           +
Sbjct: 365 K 365


>gi|145633578|ref|ZP_01789306.1| HflK [Haemophilus influenzae 3655]
 gi|145635302|ref|ZP_01791005.1| HflK [Haemophilus influenzae PittAA]
 gi|145637887|ref|ZP_01793532.1| HflK [Haemophilus influenzae PittHH]
 gi|148827292|ref|YP_001292045.1| FtsH protease regulator HflK [Haemophilus influenzae PittGG]
 gi|319775977|ref|YP_004138465.1| HflK [Haemophilus influenzae F3047]
 gi|144985784|gb|EDJ92398.1| HflK [Haemophilus influenzae 3655]
 gi|145267446|gb|EDK07447.1| HflK [Haemophilus influenzae PittAA]
 gi|145268922|gb|EDK08880.1| HflK [Haemophilus influenzae PittHH]
 gi|148718534|gb|ABQ99661.1| HflK [Haemophilus influenzae PittGG]
 gi|317450568|emb|CBY86785.1| HflK [Haemophilus influenzae F3047]
          Length = 406

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 97/301 (32%), Positives = 163/301 (54%), Gaps = 14/301 (4%)

Query: 45  PFFKSYGSVYIILLLIGSFC-AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPID 103
           PF   +G V  + + IG+        Y +   ER V LRFG+  + +  PGL+     +D
Sbjct: 77  PFH--FGKVIPLAVAIGAIIWGVSGFYTIKEAERGVVLRFGE-LHSIVQPGLNWKPTFVD 133

Query: 104 QVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           +V  V V E+ +++           G +LT D+N+V +  +V Y V DP  YLF++ N  
Sbjct: 134 KVLPVNV-EQVKEL--------RTQGAMLTQDENMVKVEMTVQYRVQDPAKYLFSVTNAD 184

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           ++L Q ++SA+R V+G     DI  + R  +       + + +  Y  G+ +  ++ + A
Sbjct: 185 DSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIKSYDMGLEVIDVNFQSA 244

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  I E + AYKDRI+ +A
Sbjct: 245 RPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQRILEEATAYKDRIVLDA 304

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFS 342
           +GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D    + +  LPL +   
Sbjct: 305 KGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDGNNGNNLTVLPLEQIMG 364

Query: 343 R 343
           +
Sbjct: 365 K 365


>gi|53802382|ref|YP_112846.1| hflK protein [Methylococcus capsulatus str. Bath]
 gi|53756143|gb|AAU90434.1| putative hflK protein [Methylococcus capsulatus str. Bath]
          Length = 329

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 106/303 (34%), Positives = 167/303 (55%), Gaps = 19/303 (6%)

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVI 111
           V I+L L+G + A+   Y +  +   V LRFGK  + V  PGLH    + ID V I    
Sbjct: 27  VLIVLALMGLWTAY---YTIPAESEGVVLRFGKYIHKV-PPGLHFKLPYGIDGV-IAVPT 81

Query: 112 ERQQKIGGRSASVGSN----SGL-------ILTGDQNIVGLHFSVLYVVTDPRLYLFNLE 160
           +RQ K+     S G+     +GL       ++TGD N   + + V Y +T+P+ YLF + 
Sbjct: 82  QRQLKLEFGFFSPGATNPDQAGLEPGKERSMVTGDLNAALVEWIVQYRITEPQDYLFAVR 141

Query: 161 NPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISI 220
           +PG+TL+ +SES MR VVG R   +I    RQ+I       ++   + Y  G+ I+ + +
Sbjct: 142 DPGQTLRDISESVMRAVVGDRTVDEIITIGRQEIEDTSLQRMRALAELYHLGVFISQVQL 201

Query: 221 EDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           ++ +PP  V  +F+EV RA+QD +  +  +N   N+ +  ARGEA     ++  Y+ + I
Sbjct: 202 KNVNPPEPVQPSFNEVNRAQQDRENAINLANGDYNKAVPRARGEADQQIRAAEGYRFKRI 261

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYLPLN 338
            EA+G+   F ++  QYV AP + R R+YLETM  +L +AK+ I+  D  Q ++P LPL+
Sbjct: 262 NEAEGDVAAFSAVLEQYVKAPEVTRMRLYLETMGEVLPQAKQSIVVDDTVQQILPMLPLS 321

Query: 339 EAF 341
            A 
Sbjct: 322 TAM 324


>gi|261823149|ref|YP_003261255.1| FtsH protease regulator HflK [Pectobacterium wasabiae WPP163]
 gi|261607162|gb|ACX89648.1| HflK protein [Pectobacterium wasabiae WPP163]
          Length = 415

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 92/272 (33%), Positives = 150/272 (55%), Gaps = 10/272 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V  V V          S    + SG
Sbjct: 96  YTIKEAERGVVTRFGKFSH-LVGPGLNWKPTFIDSVRAVNV---------ESVRELATSG 145

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VT P  YLF++ N  ++L+Q ++SA+R V+G+     I   
Sbjct: 146 VMLTSDENVVRVEMNVQYRVTQPEQYLFSVTNADDSLRQATDSALRGVIGKYTMDKILTE 205

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 206 GRTIVRTDTQRVLEETVRPYNMGITLLDVNFQTARPPEEVKAAFDDAIAARENEQQYIRE 265

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E S AYK R + EAQG+   F  +  +Y  AP + R+R+Y
Sbjct: 266 AEAYANEVQPKANGQAQRILEESRAYKTRTVLEAQGDVASFARVLPEYKAAPEITRERLY 325

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNEAF 341
           +ETME +L   +KV+++ K   +  LPL++  
Sbjct: 326 IETMERVLSHTRKVLVNDKGGNLMVLPLDQML 357


>gi|322615525|gb|EFY12445.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322618585|gb|EFY15474.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322622002|gb|EFY18852.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322627726|gb|EFY24517.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322631033|gb|EFY27797.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322637748|gb|EFY34449.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322642412|gb|EFY39016.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322644019|gb|EFY40567.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322650487|gb|EFY46895.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322653548|gb|EFY49876.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322659734|gb|EFY55977.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322662055|gb|EFY58271.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322666196|gb|EFY62374.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322672616|gb|EFY68727.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322676046|gb|EFY72117.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322680530|gb|EFY76568.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322684576|gb|EFY80580.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323192891|gb|EFZ78117.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323197233|gb|EFZ82373.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323201650|gb|EFZ86714.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323206164|gb|EFZ91126.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323213173|gb|EFZ97975.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323215546|gb|EGA00290.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323219531|gb|EGA04016.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323227834|gb|EGA11988.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323229004|gb|EGA13133.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323236384|gb|EGA20460.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323238711|gb|EGA22763.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323241838|gb|EGA25867.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323248013|gb|EGA31950.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323254656|gb|EGA38467.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323258285|gb|EGA41962.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323263569|gb|EGA47090.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323265835|gb|EGA49331.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323270279|gb|EGA53727.1| FtsH protease regulator HflK [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 419

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 94/270 (34%), Positives = 154/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V  V V E  +++          SG
Sbjct: 98  YTIKEAERGVVTRFGK-FSHLVEPGLNWKPTFIDDVTPVNV-EAVRELAA--------SG 147

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VT+P  YL+++ +P ++L+Q ++SA+R V+G+     I   
Sbjct: 148 VMLTSDENVVRVEMNVQYRVTNPEKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRILTE 207

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 208 GRTVIRSDTQRELEETIKPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 267

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK + I EAQGE  RF  I  +Y  AP + R+R+Y
Sbjct: 268 AEAYTNEVQPRANGQAQRILEEARAYKTQTILEAQGEVARFAKILPEYKAAPQITRERLY 327

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K   +  LPL++
Sbjct: 328 IETMEKVLSHTRKVLVNDKSGNLMVLPLDQ 357


>gi|312173796|emb|CBX82050.1| protease specific for phage lambda cII repressor [Erwinia amylovora
           ATCC BAA-2158]
          Length = 417

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 96/270 (35%), Positives = 151/270 (55%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     IDQV  V V          S    S SG
Sbjct: 95  YTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDQVRAVNV---------ESVRELSASG 144

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
            +LT D+N+V +  +V Y VT+P  YLF + +  ++L+Q ++SA+R V+GR     I   
Sbjct: 145 TMLTSDENVVRVEMNVQYRVTNPERYLFAVTSADDSLRQATDSALRGVIGRSTMDRILTE 204

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + +  +++T+  Y  GI +  ++ + A PP +V  +FD+   A ++ ++ V E
Sbjct: 205 GRTVVRSDTQRELEETIRPYDMGITLLDVNFQTARPPEDVKASFDDAIAARENREQSVRE 264

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N  L  ARG+A  I E + AYK R+  EAQGE D F  I  +Y  AP + R+R+Y
Sbjct: 265 AEAYANDKLPRARGDAQGILEKARAYKARVTLEAQGEVDSFARILPEYKAAPQITRERLY 324

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K S +  LPL++
Sbjct: 325 IETMERVLGHTRKVLVNDKGSNLMVLPLDQ 354


>gi|238764694|ref|ZP_04625638.1| hypothetical protein ykris0001_14920 [Yersinia kristensenii ATCC
           33638]
 gi|238697090|gb|EEP89863.1| hypothetical protein ykris0001_14920 [Yersinia kristensenii ATCC
           33638]
          Length = 426

 Score =  159 bits (402), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 92/270 (34%), Positives = 152/270 (56%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  R GK  + +  PGL+     ID+V  V V          S    + SG
Sbjct: 100 YTIKEAERGVVTRLGKLSH-IVQPGLNWKPTFIDEVTPVNV---------ESVRELAASG 149

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YLF++ NP ++L+Q ++SA+R V+G+     I   
Sbjct: 150 VMLTSDENVVRIEMNVQYRVTDPAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTE 209

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  YK GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 210 GRTIVRSDTQRVLEETIRPYKMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 269

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  + E + AY  R + EAQGE   F  +  +Y  AP + R+R+Y
Sbjct: 270 AEAYTNEVQPRANGQAQRLLEDARAYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLY 329

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+ + K + +  LPL++
Sbjct: 330 IETMEKVLGHTRKVLANDKGNSLMVLPLDQ 359


>gi|145631617|ref|ZP_01787382.1| HflK [Haemophilus influenzae R3021]
 gi|144982751|gb|EDJ90280.1| HflK [Haemophilus influenzae R3021]
          Length = 406

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 97/301 (32%), Positives = 163/301 (54%), Gaps = 14/301 (4%)

Query: 45  PFFKSYGSVYIILLLIGSFC-AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPID 103
           PF   +G V  + + IG+        Y +   ER V LRFG+  + +  PGL+     +D
Sbjct: 77  PFH--FGKVIPLAVAIGAIIWGVSGFYTIKEAERGVVLRFGE-LHSIVQPGLNWKPTFVD 133

Query: 104 QVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           +V  V V E+ +++           G +LT D+N+V +  +V Y V DP  YLF++ N  
Sbjct: 134 KVLPVNV-EQVKEL--------RTQGAMLTQDENMVKVEMTVQYRVQDPAKYLFSVTNAD 184

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           ++L Q ++SA+R V+G     DI  + R  +       + + +  Y  G+ +  ++ + A
Sbjct: 185 DSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIKSYDMGLEVIDVNFQSA 244

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  I E + AYKDRI+ +A
Sbjct: 245 RPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQRILEEATAYKDRIVLDA 304

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFS 342
           +GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D    + +  LPL +   
Sbjct: 305 KGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDGNNGNNLTVLPLEQIMG 364

Query: 343 R 343
           +
Sbjct: 365 K 365


>gi|284006628|emb|CBA71889.1| HflK protein (regulator of FtsH protease) [Arsenophonus nasoniae]
          Length = 405

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 93/270 (34%), Positives = 152/270 (56%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   +R V  RFGK  + V  PGL+   W  + +E  KVI     +   +    + SG
Sbjct: 92  YTIKESDRGVVFRFGKYSHTV-EPGLN---WKPNFIE--KVI----PVNVETIREQATSG 141

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N++ +  +V Y VTDP  YLFN+ NP  +L+Q  +SA+R ++G+     +  +
Sbjct: 142 MMLTSDENVIQVEMNVQYRVTDPAQYLFNVTNPDNSLRQAIDSAVRGIIGQSAMEQVLTT 201

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
           +R  I  E +  ++ T+  Y  GI I  ++ + A PP  V  AFD+V  A ++E + + E
Sbjct: 202 KRAFIRDETQKELENTIRPYNMGITILDVNFQAARPPEAVKAAFDDVIAAREEEQKTIRE 261

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y N VL  A+G A  + E + AYK  ++ +A+GE   F  +  +Y  AP + R+R+Y
Sbjct: 262 AQAYRNEVLPLAKGNAQKLIEEATAYKSSVVFKAEGEVASFAKMLPEYRAAPQITRERLY 321

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KVI++ K + M  LPL +
Sbjct: 322 IETMERVLGNTRKVIVNDKSNSMLVLPLEQ 351


>gi|95930671|ref|ZP_01313405.1| HflK protein [Desulfuromonas acetoxidans DSM 684]
 gi|95133323|gb|EAT14988.1| HflK protein [Desulfuromonas acetoxidans DSM 684]
          Length = 343

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 104/304 (34%), Positives = 164/304 (53%), Gaps = 20/304 (6%)

Query: 51  GSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVK 109
           G V + L++IG   AF   Y V  +E  V LR GK       PGLHM   + IDQV  VK
Sbjct: 37  GLVIVFLVVIGGQSAF---YKVDTEETGVLLRLGKSIGTA-PPGLHMKLPFGIDQVYRVK 92

Query: 110 VIE-RQQKIGGRSASVG----------SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN 158
                +++ G R+   G          S   L LTGD N+  + + V Y + DP  YLFN
Sbjct: 93  TGRVLKEEFGFRTEQAGIRTTYSNRDYSEESLTLTGDLNVSDVEWIVQYQIVDPEKYLFN 152

Query: 159 LENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTI 218
           + +P  T++ +SE+ +R ++G      +  ++R  +A+ V   +Q  ++ Y  GI + T+
Sbjct: 153 IADPRATIRDLSEAEVRRIIGNSNVTQVLTTERAYLAMAVEKGLQDILNSYNIGIRVVTV 212

Query: 219 SIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEA-SHIRESSIAYKD 277
             +D +PP +V  AF+EV  AEQ ++  + ++ +  NR +  ARG A S I E+   Y  
Sbjct: 213 KFQDVNPPDQVKAAFNEVNEAEQQKESLIFQAREQYNREVPKARGVARSRILEAE-GYAL 271

Query: 278 RIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII--DKKQSVMPYL 335
             I  A+GEA+RF S+  +Y  AP + ++R++LETM+ IL K  ++ +  DK   ++P L
Sbjct: 272 ERINSAKGEAERFNSLVAEYRKAPKVTKQRLFLETMDKILPKVDEIYVVDDKSGGILPLL 331

Query: 336 PLNE 339
           PL +
Sbjct: 332 PLGK 335


>gi|145589465|ref|YP_001156062.1| HflK protein [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145047871|gb|ABP34498.1| protease FtsH subunit HflK [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 503

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 94/312 (30%), Positives = 165/312 (52%), Gaps = 21/312 (6%)

Query: 45  PFFKSYGS-VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPI 102
           PF    GS V I  +     C+    +I+   +  V + FGK  +    PG++    WPI
Sbjct: 129 PFSSKSGSLVAIAAVFFIWVCS--GFFIIQEGQAGVVMTFGK-YDYTAKPGINWHLPWPI 185

Query: 103 DQVEIVKVIERQQKIGGRSASVG---------SNSGLILTGDQNIVGLHFSVLYVVTDPR 153
              E V +       G RS  VG              +LT D+NI+ + F+V Y + DP 
Sbjct: 186 QSAETVNLS------GVRSVEVGRPTLIKATNQKDSSMLTEDENIIDVRFAVQYRLKDPT 239

Query: 154 LYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGI 213
            YLFN  +P   +   +E+A+RE+V R     +    R++I +++   IQK +D YK+GI
Sbjct: 240 DYLFNDRDPDAAVVLAAETAVREIVARSKMDTVLYEGREKIGIDLAASIQKILDSYKTGI 299

Query: 214 LINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSI 273
            + ++++++  PP +V  AFD+  +A QD++R   E   Y+N ++  A+G A+ + + + 
Sbjct: 300 YVTSVTVQNVQPPEQVQAAFDDAVKAGQDQERLKSEGQAYANDIIPRAKGTAARLIQEAE 359

Query: 274 AYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVM 332
            YK R++  A+G+A RF  I  +Y  AP + R R+Y++TM  +     K+++D  K + +
Sbjct: 360 GYKARVVATAEGDAARFKQILVEYSKAPQVTRDRMYIDTMREMYTNVTKILVDTTKSNNL 419

Query: 333 PYLPLNEAFSRI 344
            +LPL++  +++
Sbjct: 420 LFLPLDKIIAQV 431


>gi|309750431|gb|ADO80415.1| Protease modulator complex HflKC, subunit HflK [Haemophilus
           influenzae R2866]
          Length = 410

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 97/301 (32%), Positives = 163/301 (54%), Gaps = 14/301 (4%)

Query: 45  PFFKSYGSVYIILLLIGSFC-AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPID 103
           PF   +G V  + + IG+        Y +   ER V LRFG+  + +  PGL+     +D
Sbjct: 81  PFH--FGKVIPLAVAIGAIIWGVSGFYTIKEAERGVVLRFGE-LHSIVQPGLNWKPTFLD 137

Query: 104 QVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           +V  V V E+ +++           G +LT D+N+V +  +V Y V DP  YLF++ N  
Sbjct: 138 KVLPVNV-EQVKEL--------RTQGAMLTQDENMVKVEMTVQYRVQDPAKYLFSVTNAD 188

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           ++L Q ++SA+R V+G     DI  + R  +       + + +  Y  G+ +  ++ + A
Sbjct: 189 DSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIKSYDMGLEVIDVNFQSA 248

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  I E + AYKDRI+ +A
Sbjct: 249 RPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQRILEEATAYKDRIVLDA 308

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFS 342
           +GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D    + +  LPL +   
Sbjct: 309 KGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDGNNGNNLTVLPLEQIMG 368

Query: 343 R 343
           +
Sbjct: 369 K 369


>gi|260582367|ref|ZP_05850159.1| HflK protein [Haemophilus influenzae NT127]
 gi|260094518|gb|EEW78414.1| HflK protein [Haemophilus influenzae NT127]
          Length = 410

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 97/301 (32%), Positives = 163/301 (54%), Gaps = 14/301 (4%)

Query: 45  PFFKSYGSVYIILLLIGSFC-AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPID 103
           PF   +G V  + + IG+        Y +   ER V LRFG+  + +  PGL+     +D
Sbjct: 81  PFH--FGKVIPLAVAIGAIIWGVSGFYTIKEAERGVVLRFGE-LHSIVQPGLNWKPTFLD 137

Query: 104 QVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           +V  V V E+ +++           G +LT D+N+V +  +V Y V DP  YLF++ N  
Sbjct: 138 KVLPVNV-EQVKEL--------RTQGAMLTQDENMVKVEMTVQYRVQDPAKYLFSVTNAD 188

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           ++L Q ++SA+R V+G     DI  + R  +       + + +  Y  G+ +  ++ + A
Sbjct: 189 DSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIKSYDMGLEVIDVNFQSA 248

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  I E + AYKDRI+ +A
Sbjct: 249 RPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQRILEEATAYKDRIVLDA 308

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFS 342
           +GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D    + +  LPL +   
Sbjct: 309 KGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDGNNGNNLTVLPLEQIMG 368

Query: 343 R 343
           +
Sbjct: 369 K 369


>gi|188535083|ref|YP_001908880.1| FtsH protease regulator HflK [Erwinia tasmaniensis Et1/99]
 gi|188030125|emb|CAO98011.1| Protease specific for phage lambda cII repressor [Erwinia
           tasmaniensis Et1/99]
          Length = 417

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 98/270 (36%), Positives = 153/270 (56%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + V  PGL+     ID+V  V V E  +++        S SG
Sbjct: 95  YTIKEAERGVVTRFGKFSHQVE-PGLNWKPTFIDRVRAVNV-EAVREL--------SASG 144

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
            +LT D+N+V +  +V Y VT+P  YLF + +  ++L+Q ++SA+R V+GR     I   
Sbjct: 145 TMLTSDENVVRVEMNVQYRVTNPERYLFAVTSADDSLRQATDSALRGVIGRSTMDRILTE 204

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  E +  +++T+  Y  GI +  ++ + A PP  V  AFD+   A ++ ++ V E
Sbjct: 205 GRTVVRSETQRELEETIRPYDMGITLLDVNFQTARPPEAVKAAFDDAIAARENREQAVRE 264

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N  L  ARG+A  I E + AYK R+  EAQGE D F  I  +Y  AP + R+R+Y
Sbjct: 265 AEAYANDKLPRARGDAQGILEQARAYKARVTLEAQGEVDSFARILPEYKAAPQITRERLY 324

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K S +  LPL++
Sbjct: 325 IETMERVLGHTRKVLVNDKGSNLMVLPLDQ 354


>gi|17545941|ref|NP_519343.1| hypothetical protein RSc1222 [Ralstonia solanacearum GMI1000]
 gi|17428236|emb|CAD14924.1| putative membrane protease subunits, stomatin/prohibitin homologs
           transmembrane protein [Ralstonia solanacearum GMI1000]
          Length = 447

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 98/291 (33%), Positives = 160/291 (54%), Gaps = 10/291 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +IV   +  V L+FG+ K     PG++    +PI+  EIV +   +    GR+  +   +
Sbjct: 112 FIVQEGQTGVILQFGRFKYQA-TPGINWRLPYPIETHEIVNLSGVRTLEIGRTTQIKDTN 170

Query: 129 ---GLILTGDQNIVGLHFSVLYVVTDPRLYLF----NLENPGETLKQVSESAMREVVGRR 181
                +LT D+NIV + FSV Y + DP  YLF    +     E + Q +E+++RE+VGR 
Sbjct: 171 LKDSSMLTQDENIVDVRFSVQYNIADPVEYLFYNRTDQRGDEELVTQAAETSVREIVGRN 230

Query: 182 FAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQ 241
               +    R  +   +   IQ+ +  YK+GI I +++++   PP +V  AFD+V +A Q
Sbjct: 231 KMDAVLYEGRDAVGRNLAESIQRILSAYKTGIRILSVNVQSVQPPEQVQSAFDDVTKAGQ 290

Query: 242 DEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAP 301
           D +R + E   Y+N V+  A+G A+ + E +  YK R++  A+G+A RF S+  +Y  AP
Sbjct: 291 DRERAISEGQAYANDVVPRAKGTAARLGEEAQGYKARVVARAEGDAARFASVQREYAKAP 350

Query: 302 TLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNEAFSRIQTKREIR 351
            + R RIYLETM+ I   A KV++D+     + YLPL++  ++ QT    R
Sbjct: 351 QVTRDRIYLETMQDIYANATKVLVDQSGNGNLLYLPLDKLIAQSQTGDAAR 401


>gi|215489518|ref|YP_002331949.1| FtsH protease regulator HflK [Escherichia coli O127:H6 str.
           E2348/69]
 gi|306815611|ref|ZP_07449760.1| FtsH protease regulator HflK [Escherichia coli NC101]
 gi|215267590|emb|CAS12045.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli O127:H6 str. E2348/69]
 gi|222035944|emb|CAP78689.1| Protein hflK [Escherichia coli LF82]
 gi|305851273|gb|EFM51728.1| FtsH protease regulator HflK [Escherichia coli NC101]
 gi|312948823|gb|ADR29650.1| FtsH protease regulator HflK [Escherichia coli O83:H1 str. NRG
           857C]
 gi|323189947|gb|EFZ75225.1| hflK protein [Escherichia coli RN587/1]
          Length = 419

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 94/270 (34%), Positives = 156/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID+V+ V V E  +++          SG
Sbjct: 98  YTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDEVKPVNV-EAVRELAA--------SG 147

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YL+++ +P ++L+Q ++SA+R V+G+     I   
Sbjct: 148 VMLTSDENVVRVEMNVQYRVTDPEKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRILTE 207

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 208 GRTVIRSDTQRELEETIRPYDMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 267

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK + I EAQGE  RF  +  +Y  AP + R+R+Y
Sbjct: 268 AEAYTNEVQPRANGQAQRILEEARAYKAQTILEAQGEVARFAKLLPEYKAAPEITRERLY 327

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K   +  LPL++
Sbjct: 328 IETMEKVLGNTRKVLVNDKGGNLMVLPLDQ 357


>gi|90408491|ref|ZP_01216650.1| Membrane protease, stomatin/prohibitin family protein [Psychromonas
           sp. CNPT3]
 gi|90310423|gb|EAS38549.1| Membrane protease, stomatin/prohibitin family protein [Psychromonas
           sp. CNPT3]
          Length = 391

 Score =  159 bits (402), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 95/289 (32%), Positives = 153/289 (52%), Gaps = 11/289 (3%)

Query: 52  SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI 111
           +V +I+ ++     F   Y +   +R V LRFG   N    PGLH     ID++  + V 
Sbjct: 61  AVMVIISVLAIIWFFSGWYTIKESDRGVVLRFGA-YNGQVEPGLHWHPKFIDKIIPINV- 118

Query: 112 ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSE 171
                   ++      SG +LT D+N+V +   V Y +  P  YLF++ N   +L Q  +
Sbjct: 119 --------KAFRTMPTSGFMLTEDENVVKVSMEVQYRIIAPEKYLFSVTNADNSLLQALD 170

Query: 172 SAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231
           S++R VVG     D+  + R+ +  E   ++ K ++ Y  GI +  ++++   PP EV  
Sbjct: 171 SSLRFVVGHSTMDDVLTTGREVVRQEAWEMLDKIIEPYNLGIEVVDVNLQQTRPPEEVKA 230

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           AFD+   A++DE+RFV E+  Y       ARG+   I + + AY + ++ +AQGE  RF 
Sbjct: 231 AFDDAISAQEDEERFVREAEAYQRAKEPLARGQVKRIEQQAQAYTEGVVLKAQGEVARFN 290

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNE 339
            +   Y +AP + R+RIY+ETME +L    KV+ID K  S M +LPL++
Sbjct: 291 KLLPAYQSAPEITRQRIYIETMETVLSNTSKVLIDNKSGSNMTFLPLDK 339


>gi|329297956|ref|ZP_08255292.1| FtsH protease regulator HflK [Plautia stali symbiont]
          Length = 411

 Score =  159 bits (401), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 92/270 (34%), Positives = 155/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     IDQV  V V E  +++          SG
Sbjct: 91  YTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDQVRAVNV-EAVRELAA--------SG 140

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YL+ + +  ++L+Q ++SA+R+V+GR     I   
Sbjct: 141 VMLTSDENVVRVEMNVQYRVTDPERYLYAVTSADDSLRQATDSALRDVIGRSTMDRILTE 200

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + +  I +T+  Y  GI +  ++ + A PP EV  AFD+   A ++ +++V E
Sbjct: 201 GRTVVRSDTQREIDETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENREQYVRE 260

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK+R + EAQGE  RF  +  +Y  AP + ++R+Y
Sbjct: 261 AEAYANEVQPRANGQAQRILEEARAYKERTVLEAQGEVARFARLLPEYKAAPQITKERLY 320

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +E+ME +L   +KV+++ + + +  LPL++
Sbjct: 321 IESMERVLSHTRKVLVNDRGNSLMVLPLDQ 350


>gi|91213723|ref|YP_543709.1| FtsH protease regulator HflK [Escherichia coli UTI89]
 gi|117626521|ref|YP_859844.1| FtsH protease regulator HflK [Escherichia coli APEC O1]
 gi|218561333|ref|YP_002394246.1| FtsH protease regulator HflK [Escherichia coli S88]
 gi|237703841|ref|ZP_04534322.1| FtsH protease regulator HflK [Escherichia sp. 3_2_53FAA]
 gi|91075297|gb|ABE10178.1| HflK protein regulator of FtsH protease, subunit of HflK-HflC
           complex [Escherichia coli UTI89]
 gi|115515645|gb|ABJ03720.1| HflK protein, regulator of FtsH protease, subunit of HflK-HflC
           complex [Escherichia coli APEC O1]
 gi|218368102|emb|CAR05909.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli S88]
 gi|226901753|gb|EEH88012.1| FtsH protease regulator HflK [Escherichia sp. 3_2_53FAA]
 gi|294492354|gb|ADE91110.1| HflK protein [Escherichia coli IHE3034]
 gi|307629245|gb|ADN73549.1| FtsH protease regulator HflK [Escherichia coli UM146]
 gi|315288455|gb|EFU47853.1| HflK protein [Escherichia coli MS 110-3]
 gi|323950757|gb|EGB46635.1| HflK protein [Escherichia coli H252]
 gi|323955461|gb|EGB51225.1| HflK protein [Escherichia coli H263]
          Length = 419

 Score =  159 bits (401), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 94/272 (34%), Positives = 156/272 (57%), Gaps = 10/272 (3%)

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSN 127
             Y +   ER V  RFGK  + +  PGL+     ID+V+ V V E  +++          
Sbjct: 96  GFYTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDEVKPVNV-EAVRELAA-------- 145

Query: 128 SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIF 187
           SG++LT D+N+V +  +V Y VTDP  YL+++ +P ++L+Q ++SA+R V+G+     I 
Sbjct: 146 SGVMLTSDENVVRVEMNVQYRVTDPEKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRIL 205

Query: 188 RSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFV 247
              R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++
Sbjct: 206 TEGRTVIRSDTQRELEETIRPYDMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYI 265

Query: 248 EESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKR 307
            E+  Y+N V   A G+A  I E + AYK + I EAQGE  RF  +  +Y  AP + R+R
Sbjct: 266 REAEAYTNEVQPRANGQAQRILEEARAYKAQTILEAQGEVARFAKLLPEYKAAPEITRER 325

Query: 308 IYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +Y+ETME +L   +KV+++ K   +  LPL++
Sbjct: 326 LYIETMEKVLGNTRKVLVNDKGGNLMVLPLDQ 357


>gi|324005237|gb|EGB74456.1| HflK protein [Escherichia coli MS 57-2]
          Length = 419

 Score =  159 bits (401), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 93/272 (34%), Positives = 154/272 (56%), Gaps = 10/272 (3%)

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSN 127
             Y +   ER V  RFGK  + +  PGL+     ID+V+ V V          +    + 
Sbjct: 96  GFYTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDEVKPVNV---------EAVRELAA 145

Query: 128 SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIF 187
           SG++LT D+N+V +  +V Y VTDP  YL+++ +P ++L+Q ++SA+R V+G+     I 
Sbjct: 146 SGVMLTSDENVVRVEMNVQYRVTDPEKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRIL 205

Query: 188 RSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFV 247
              R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++
Sbjct: 206 TEGRTVIRSDTQRELEETIRPYDMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYI 265

Query: 248 EESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKR 307
            E+  Y+N V   A G+A  I E + AYK + I EAQGE  RF  +  +Y  AP + R+R
Sbjct: 266 REAEAYTNEVQPRANGQAQRILEEARAYKAQTILEAQGEVARFAKLLPEYKAAPEITRER 325

Query: 308 IYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +Y+ETME +L   +KV+++ K   +  LPL++
Sbjct: 326 LYIETMEKVLGNTRKVLVNDKGGNLMVLPLDQ 357


>gi|26251066|ref|NP_757106.1| FtsH protease regulator HflK [Escherichia coli CFT073]
 gi|110644531|ref|YP_672261.1| FtsH protease regulator HflK [Escherichia coli 536]
 gi|170682628|ref|YP_001746569.1| FtsH protease regulator HflK [Escherichia coli SMS-3-5]
 gi|191170702|ref|ZP_03032254.1| HflK protein [Escherichia coli F11]
 gi|191174518|ref|ZP_03036016.1| HflK protein [Escherichia coli F11]
 gi|218692508|ref|YP_002400720.1| FtsH protease regulator HflK [Escherichia coli ED1a]
 gi|218702871|ref|YP_002410500.1| FtsH protease regulator HflK [Escherichia coli IAI39]
 gi|227886783|ref|ZP_04004588.1| FtsH protease regulator HflK [Escherichia coli 83972]
 gi|293407901|ref|ZP_06651741.1| FtsH protease regulator HflK [Escherichia coli B354]
 gi|300940661|ref|ZP_07155222.1| HflK protein [Escherichia coli MS 21-1]
 gi|300987261|ref|ZP_07178090.1| HflK protein [Escherichia coli MS 45-1]
 gi|300988649|ref|ZP_07178789.1| HflK protein [Escherichia coli MS 200-1]
 gi|301045954|ref|ZP_07193138.1| HflK protein [Escherichia coli MS 185-1]
 gi|331650299|ref|ZP_08351371.1| protein HflK [Escherichia coli M605]
 gi|331660749|ref|ZP_08361681.1| protein HflK [Escherichia coli TA206]
 gi|331671324|ref|ZP_08372122.1| protein HflK [Escherichia coli TA280]
 gi|331681193|ref|ZP_08381830.1| protein HflK [Escherichia coli H299]
 gi|26111498|gb|AAN83680.1|AE016771_191 HflK protein [Escherichia coli CFT073]
 gi|110346123|gb|ABG72360.1| HflK protein [Escherichia coli 536]
 gi|170520346|gb|ACB18524.1| HflK protein [Escherichia coli SMS-3-5]
 gi|190905198|gb|EDV64839.1| HflK protein [Escherichia coli F11]
 gi|190908926|gb|EDV68513.1| HflK protein [Escherichia coli F11]
 gi|218372857|emb|CAR20737.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli IAI39]
 gi|218430072|emb|CAR11062.2| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli ED1a]
 gi|227836356|gb|EEJ46822.1| FtsH protease regulator HflK [Escherichia coli 83972]
 gi|281181270|dbj|BAI57600.1| hypothetical phage protein [Escherichia coli SE15]
 gi|291472152|gb|EFF14634.1| FtsH protease regulator HflK [Escherichia coli B354]
 gi|300302037|gb|EFJ58422.1| HflK protein [Escherichia coli MS 185-1]
 gi|300305882|gb|EFJ60402.1| HflK protein [Escherichia coli MS 200-1]
 gi|300407738|gb|EFJ91276.1| HflK protein [Escherichia coli MS 45-1]
 gi|300454549|gb|EFK18042.1| HflK protein [Escherichia coli MS 21-1]
 gi|307556341|gb|ADN49116.1| HflK protein regulator of FtsH protease [Escherichia coli ABU
           83972]
 gi|315293544|gb|EFU52896.1| HflK protein [Escherichia coli MS 153-1]
 gi|315299055|gb|EFU58309.1| HflK protein [Escherichia coli MS 16-3]
 gi|320193554|gb|EFW68191.1| HflK protein [Escherichia coli WV_060327]
 gi|324013816|gb|EGB83035.1| HflK protein [Escherichia coli MS 60-1]
 gi|330908516|gb|EGH37035.1| HflK protein [Escherichia coli AA86]
 gi|331040693|gb|EGI12851.1| protein HflK [Escherichia coli M605]
 gi|331051791|gb|EGI23830.1| protein HflK [Escherichia coli TA206]
 gi|331071169|gb|EGI42526.1| protein HflK [Escherichia coli TA280]
 gi|331081414|gb|EGI52575.1| protein HflK [Escherichia coli H299]
          Length = 419

 Score =  159 bits (401), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 93/272 (34%), Positives = 154/272 (56%), Gaps = 10/272 (3%)

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSN 127
             Y +   ER V  RFGK  + +  PGL+     ID+V+ V V          +    + 
Sbjct: 96  GFYTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDEVKPVNV---------EAVRELAA 145

Query: 128 SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIF 187
           SG++LT D+N+V +  +V Y VTDP  YL+++ +P ++L+Q ++SA+R V+G+     I 
Sbjct: 146 SGVMLTSDENVVRVEMNVQYRVTDPEKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRIL 205

Query: 188 RSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFV 247
              R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++
Sbjct: 206 TEGRTVIRSDTQRELEETIRPYDMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYI 265

Query: 248 EESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKR 307
            E+  Y+N V   A G+A  I E + AYK + I EAQGE  RF  +  +Y  AP + R+R
Sbjct: 266 REAEAYTNEVQPRANGQAQRILEEARAYKAQTILEAQGEVARFAKLLPEYKAAPEITRER 325

Query: 308 IYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +Y+ETME +L   +KV+++ K   +  LPL++
Sbjct: 326 LYIETMEKVLGNTRKVLVNDKGGNLMVLPLDQ 357


>gi|261492387|ref|ZP_05988944.1| HflK protein [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261495890|ref|ZP_05992315.1| HflK protein [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261308445|gb|EEY09723.1| HflK protein [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261311916|gb|EEY13062.1| HflK protein [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 407

 Score =  159 bits (401), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 92/285 (32%), Positives = 155/285 (54%), Gaps = 10/285 (3%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQ 114
           ++L L     A    Y V   ER V  R GK  + + +PGL+     ID V  V V ER 
Sbjct: 83  VVLGLAAIVWAGSGFYTVQEAERGVVTRLGK-LDSIVMPGLNWKPTFIDSVTRVNV-ERV 140

Query: 115 QKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAM 174
            ++        + SG +LT D+N+V +  +V Y V DP  YLF++ NP ++LKQ ++SA+
Sbjct: 141 SEL--------NTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFSVSNPDDSLKQATDSAL 192

Query: 175 REVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFD 234
           R V+G     +I  + R  +     + ++  +  Y  G+L+  ++ + A PP EV  AFD
Sbjct: 193 RYVIGHMTMDEILTTGRATVRERTWSTLRDIIKTYDMGLLVTDVNFQYARPPEEVKAAFD 252

Query: 235 EVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIY 294
           +  +A++DE R + E+  Y+      ARG+A    E + AYK+ ++  A+GE +R   + 
Sbjct: 253 DAIKAQEDEQRLIREAEAYARGEEPIARGQAQRTIEQAQAYKEAVVLNAKGEVERLSQLL 312

Query: 295 GQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
            +Y  +P L R+R+Y++TME ++K   KV++D   + +  LP ++
Sbjct: 313 PEYKASPELTRERLYIQTMEKVMKNTPKVVMDSSGNNLNVLPFDK 357


>gi|301168425|emb|CBW28015.1| putative membrane protein [Bacteriovorax marinus SJ]
          Length = 336

 Score =  159 bits (401), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 110/329 (33%), Positives = 176/329 (53%), Gaps = 32/329 (9%)

Query: 15  LSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYII-LLLIGSFCAFQSIYIVH 73
           +S +NGN     P D    I  +K++F     F   G + +I LL+IG+F +F   Y V 
Sbjct: 1   MSFNNGNN----PNDFINDIDRMKNEFRNSAKF--LGPIIVIGLLVIGAFTSF---YTVE 51

Query: 74  PDERAVELRFGKPKNDVFL----PGLHMMF-WPIDQVEIVKVIERQQKIGG--------R 120
           PDE AV +RFGK     +L    PGLH      +DQV  VK     Q   G        R
Sbjct: 52  PDEEAVVIRFGK-----YLTTNPPGLHFKVPMGVDQVIKVKTKRVLQAEFGFRTQDTRTR 106

Query: 121 SASVGSNS----GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMRE 176
             +  SNS     L+LTGD N+  + ++V + ++DP  YLF   +P   ++ VSES MR 
Sbjct: 107 RTTYSSNSYKTESLMLTGDLNVADVEWAVQFQISDPFKYLFQTSSPEVNIRDVSESIMRR 166

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
           VVG R   DI  + + +I      L+Q+ ++ Y  G+ I T+ ++D +PP  V  +F+EV
Sbjct: 167 VVGDRSVTDILTTGKVEIETRALVLMQEVLNKYDMGVRIVTVKLQDVNPPEVVKPSFNEV 226

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
             A+Q++++ + ++    N+++  ARG+A  +   +  Y    +  + G+A++F +I+ +
Sbjct: 227 NEAKQEQEKSINQAEGEYNKIIPEARGKAQKLISEAEGYASAEVNRSLGDAEKFEAIFKE 286

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVII 325
           Y  AP + RKRIYLETM  I K+ + + +
Sbjct: 287 YKRAPQITRKRIYLETMSTIFKRFENITV 315


>gi|315127879|ref|YP_004069882.1| hypothetical protein PSM_A2818 [Pseudoalteromonas sp. SM9913]
 gi|315016393|gb|ADT69731.1| hypothetical protein PSM_A2818 [Pseudoalteromonas sp. SM9913]
          Length = 389

 Score =  159 bits (401), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 103/347 (29%), Positives = 179/347 (51%), Gaps = 30/347 (8%)

Query: 17  GSNGN---------GDGLPPFDVEAIIRYIKDKFDLI----------PFFKSYGSVYIIL 57
           G+NGN         G    P D++ + R   +KF+ +                  +  +L
Sbjct: 7   GNNGNDKDPWNNKGGRDQGPPDLDEVFRKFSNKFNGLFGGKKSGNGSGGGLGGAGISFVL 66

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKI 117
           ++     A   IY V   ER V L+FGK  + +  PGL    W +  VE V  ++ +   
Sbjct: 67  IIAAIVWALSGIYTVKEAERGVVLQFGK-FDRIADPGLR---WKMTFVETVIPVDIE--- 119

Query: 118 GGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREV 177
             RS S    SG +LT D+N+V + F V Y V DP LY F++ N   +L++  +SA+R V
Sbjct: 120 AVRSLSA---SGFMLTEDENVVSVEFEVQYRVIDPYLYKFSVTNADSSLEEALDSALRYV 176

Query: 178 VGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQ 237
           VG      +  + R+ +     + + + ++ Y  G+++  ++ +D+ PP EV DAFD+  
Sbjct: 177 VGHSKMDQVLTNGREVVRQNTWDELNQIIEPYNLGLIVTDVNFKDSRPPMEVKDAFDDAI 236

Query: 238 RAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQY 297
            A++DE RF+ E+  Y+  +   ARG+ + + + +  Y++RI  EAQGE  RF  +  +Y
Sbjct: 237 AAQEDEQRFIREAEAYAREIEPRARGQVTRMTQEAEGYQERITLEAQGEVARFEKLLPEY 296

Query: 298 VNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNEAFSR 343
             A  + R+R+Y++ M+ +L  + K+++D K  + M YLPL++   +
Sbjct: 297 QAAKEVTRERLYIDAMQEVLGNSSKILVDVKGGNNMMYLPLDKIMEK 343


>gi|332304697|ref|YP_004432548.1| HflK protein [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172026|gb|AEE21280.1| HflK protein [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 382

 Score =  159 bits (401), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 101/275 (36%), Positives = 150/275 (54%), Gaps = 11/275 (4%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V LRFG+  + V  PGL      +D V  V V         ++     +SG
Sbjct: 75  YTIREAERGVVLRFGEFSHFV-EPGLRWKPTFVDSVLPVDV---------QTVRSLPSSG 124

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
            +LT D+N+V +   V Y + +P  Y F++ +P  +L Q  +SA+R VVG     D+  S
Sbjct: 125 SMLTEDENVVRVEMEVQYRILEPYKYSFSVTSPETSLSQAFDSAIRYVVGHSKMDDVLTS 184

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R+     VR  +Q  ++ Y  GI I  ++ +DA PP EV  AFD+   A++DE RF+ E
Sbjct: 185 GREVARQNVREELQAILEPYDMGISIVDMNFKDARPPEEVKAAFDDAIAAQEDEQRFINE 244

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  YS  +   ARG+ + + E + AYK++ I +AQGE  RF  +  QY  AP + R RIY
Sbjct: 245 AEAYSREIEPRARGQVNRMAEEAQAYKEQAILQAQGEVARFEELLPQYQAAPEVTRSRIY 304

Query: 310 LETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSR 343
           LET+E +  K  K+++D K S  M YLPL++   R
Sbjct: 305 LETLEEVYSKTSKIMVDTKGSGNMLYLPLDKILER 339


>gi|238797606|ref|ZP_04641103.1| hypothetical protein ymoll0001_5760 [Yersinia mollaretii ATCC
           43969]
 gi|238718603|gb|EEQ10422.1| hypothetical protein ymoll0001_5760 [Yersinia mollaretii ATCC
           43969]
          Length = 422

 Score =  159 bits (401), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 92/270 (34%), Positives = 151/270 (55%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  R GK  + +  PGL+     ID+V  V V          S    + SG
Sbjct: 99  YTIKEAERGVVTRLGKLSH-IVQPGLNWKPTFIDEVTPVNV---------ESVRELAASG 148

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YLF++ NP ++L+Q ++SA+R V+G+     I   
Sbjct: 149 VMLTSDENVVRIEMNVQYRVTDPAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTE 208

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 209 GRTIVRSDTQRVLEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 268

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  + E + AY  R + EAQGE   F  +  +Y  AP + R+R+Y
Sbjct: 269 AEAYTNEVQPRANGQAQRLLEDARAYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLY 328

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L K +KV+   K + +  LPL++
Sbjct: 329 IETMEKVLGKTRKVLASDKGNSLMVLPLDQ 358


>gi|309796985|ref|ZP_07691385.1| HflK protein [Escherichia coli MS 145-7]
 gi|308119398|gb|EFO56660.1| HflK protein [Escherichia coli MS 145-7]
          Length = 419

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 93/272 (34%), Positives = 154/272 (56%), Gaps = 10/272 (3%)

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSN 127
             Y +   ER V  RFGK  + +  PGL+     ID+V+ V V          +    + 
Sbjct: 96  GFYTIKEAERGVVTRFGK-FSHLVEPGLNWKPTFIDEVKPVNV---------EAVRELAA 145

Query: 128 SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIF 187
           SG++LT D+N+V +  +V Y VT+P  YLF++ +P ++L+Q ++SA+R V+G+     I 
Sbjct: 146 SGVMLTSDENVVRVEMNVQYRVTNPEKYLFSVTSPDDSLRQATDSALRGVIGKYTMDRIL 205

Query: 188 RSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFV 247
              R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++
Sbjct: 206 TEGRTVIRSDTQRELEETIRPYDMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYI 265

Query: 248 EESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKR 307
            E+  Y+N V   A G+A  I E + AYK + I EAQGE  RF  +  +Y  AP + R+R
Sbjct: 266 REAEAYTNEVQPRANGQAQRILEEARAYKAQTILEAQGEVARFAKLLPEYKAAPEITRER 325

Query: 308 IYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +Y+ETME +L   +KV+++ K   +  LPL++
Sbjct: 326 LYIETMEKVLGNTRKVLVNDKGGNLMVLPLDQ 357


>gi|325578997|ref|ZP_08148953.1| FtsH protease regulator HflK [Haemophilus parainfluenzae ATCC
           33392]
 gi|325159232|gb|EGC71366.1| FtsH protease regulator HflK [Haemophilus parainfluenzae ATCC
           33392]
          Length = 417

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 97/307 (31%), Positives = 164/307 (53%), Gaps = 15/307 (4%)

Query: 44  IPFFKSYGSVYIILLLIGSFC-AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPI 102
           +P F + G +  I ++IG         Y +   ER V LRFG+  + +  PGL+     +
Sbjct: 81  MPSF-NLGKILPIAVVIGGIIWGASGFYTIKEAERGVTLRFGE-FHSIVQPGLNWKPTFV 138

Query: 103 DQVEIVKVIE-RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
           D+V  V V + R+ K            G +LT D+N+V +  +V Y V +P  YLF++ N
Sbjct: 139 DKVIPVNVEQVRELKT----------QGAMLTKDENMVKVEMTVQYRVQNPEKYLFSVSN 188

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
              +L Q ++SA+R V+G     D+  + R  +  +    +   +  Y  G+ +  ++ +
Sbjct: 189 ADNSLGQATDSALRYVIGHMTMNDVLTTGRAVVREDTWKALNDIIKPYDMGLEVIDVNFQ 248

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
            A PP EV DAFD+  +A++DE R++ E+  Y+      ARG+A  I E + AYKDRI+ 
Sbjct: 249 SARPPEEVKDAFDDAIKAQEDEQRYIREAEAYAREKEPIARGDAQRIVEEATAYKDRIVL 308

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEA 340
           +AQGE +R   +  ++  AP LL++R+Y++TME ++    KV++D    + +  LPL + 
Sbjct: 309 DAQGEVERLQRLLPEFKAAPDLLKERLYIQTMEKVMANTPKVMLDSNNGNNLTVLPLEQL 368

Query: 341 FSRIQTK 347
             +  TK
Sbjct: 369 MGKKATK 375


>gi|238795255|ref|ZP_04638838.1| hypothetical protein yinte0001_20940 [Yersinia intermedia ATCC
           29909]
 gi|238725423|gb|EEQ16994.1| hypothetical protein yinte0001_20940 [Yersinia intermedia ATCC
           29909]
          Length = 427

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 92/270 (34%), Positives = 151/270 (55%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  R GK  + +  PGL+     ID+V  V V          S    + SG
Sbjct: 100 YTIKEAERGVVTRLGKLSH-IVQPGLNWKPTFIDEVTPVNV---------ESVRELAASG 149

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YLF++ NP ++L+Q ++SA+R V+G+     I   
Sbjct: 150 VMLTSDENVVRIEMNVQYRVTDPAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTE 209

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  YK GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 210 GRTIVRSDTQRVLEETIRPYKMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 269

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  + E + AY  R + EAQGE   F  +  +Y  AP + R+R+Y
Sbjct: 270 AEAYTNEVQPRANGQAQRLLEDARAYSARKVLEAQGEVAGFAKLLPEYKAAPEITRERLY 329

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+   K + +  LPL++
Sbjct: 330 IETMEKVLGHTRKVLASDKGNSLMVLPLDQ 359


>gi|329906384|ref|ZP_08274392.1| HflK protein [Oxalobacteraceae bacterium IMCC9480]
 gi|327547301|gb|EGF32142.1| HflK protein [Oxalobacteraceae bacterium IMCC9480]
          Length = 312

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 94/269 (34%), Positives = 151/269 (56%), Gaps = 8/269 (2%)

Query: 81  LRFGKPKNDVFLPGLHMMFWP--IDQVEIVKVIE-RQQKIG--GRSASVGSNSGLILTGD 135
           + FGK  +    P      WP  I   EIV V   R  ++G  G + +      L+LT D
Sbjct: 1   MTFGKVSH--MTPAGFNWRWPTPIQSHEIVNVSSVRTVEVGYRGNAKNKQLQESLMLTED 58

Query: 136 QNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIA 195
           +NI+ + F+V Y + +   +LFN  +  E +K V+ES++REVVG      +    R+++A
Sbjct: 59  ENIIDIQFAVQYRLKNAADWLFNNRDQEEMIKMVAESSIREVVGHSKMDFVLYEGREKVA 118

Query: 196 LEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSN 255
           L+V  L+Q+ +D YKSG+ +  ++++   PP +V  AFD+  +A QD +R   E   Y+N
Sbjct: 119 LDVGQLMQQILDRYKSGVQVANVTMQGVQPPEQVQAAFDDAVKAGQDRERAKNEGQAYAN 178

Query: 256 RVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEG 315
            V+  ARG  S + + +  YK R++  ++G+A RF  +  +Y  AP + R RIYLETM+ 
Sbjct: 179 DVIPKARGAVSRLLQEAEGYKSRVVSTSEGDASRFKQVLVEYEKAPAVTRDRIYLETMQQ 238

Query: 316 ILKKAKKVIIDKKQ-SVMPYLPLNEAFSR 343
           I     KV++D K  S + YLPL++  S+
Sbjct: 239 IFTNTSKVMVDAKSGSNLLYLPLDKLISQ 267


>gi|194366788|ref|YP_002029398.1| HflK protein [Stenotrophomonas maltophilia R551-3]
 gi|194349592|gb|ACF52715.1| HflK protein [Stenotrophomonas maltophilia R551-3]
          Length = 377

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 92/274 (33%), Positives = 158/274 (57%), Gaps = 13/274 (4%)

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQKIGGRSASV 124
           F S  ++   +R V LRFG+  + +  PG +    WPI+ V  V   E    I   S  V
Sbjct: 63  FSSFQLIGEQQRGVVLRFGQ-FSRILTPGPNFKLPWPIESVTKVNATE----IKTFSIQV 117

Query: 125 GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAV 184
                 +LT D+NIV +  +V Y + DP+ YLF   +  + L+Q ++SA+RE VGR   +
Sbjct: 118 -----PVLTRDENIVNVSLNVQYRIDDPQQYLFGTVDANQVLEQSAQSAVREEVGR-ADL 171

Query: 185 DIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDED 244
           +   + R  +A+     +Q  +  +K+G+ +  ++++DA PP EV  AFDEV  A+Q ++
Sbjct: 172 NAVLNNRGPLAVAAEERLQALLKAFKTGLTVTGLTLQDARPPEEVKPAFDEVNGAQQVKE 231

Query: 245 RFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLL 304
           R + E+  Y+ +V+  ARG+AS  R ++  YK  ++ +A+G+A RF  +  QY +AP + 
Sbjct: 232 RLINEAQAYAAKVVPEARGQASRARTTAEGYKQAVVSKAEGDAQRFSLLQAQYKDAPEVT 291

Query: 305 RKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLN 338
           RKR++LET++ +L + +KVI    + ++ Y+P+ 
Sbjct: 292 RKRLWLETVQQVLSENRKVIGGDGRQLI-YVPMT 324


>gi|122087723|emb|CAL10508.1| putative membrane protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 335

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 92/275 (33%), Positives = 152/275 (55%), Gaps = 10/275 (3%)

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASV 124
           A    Y +   ER V  R GK  + +  PGL+     ID+V  V V          S   
Sbjct: 5   AASGFYTIKEAERGVVTRLGKLSH-IVQPGLNWKPTFIDEVTPVNV---------ESVRE 54

Query: 125 GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAV 184
            + SG++LT D+N+V +  +V Y VTDP  YLF++ NP ++L+Q ++SA+R V+G+    
Sbjct: 55  LAASGVMLTSDENVVRIEMNVQYRVTDPAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMD 114

Query: 185 DIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDED 244
            I    R  +  + + ++++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E 
Sbjct: 115 KILTEGRTIVRSDTQRVLEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQ 174

Query: 245 RFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLL 304
           +++ E+  Y+N V   A G+A  + E + AY  R + EAQGE   F  +  +Y  AP + 
Sbjct: 175 QYIREAEAYTNEVQPRANGQAQRLLEDARAYAARKVLEAQGEVAGFAKLLPEYKAAPEIT 234

Query: 305 RKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           R+R+Y+ETME +L   +KV+ + K + +  LPL++
Sbjct: 235 RERLYIETMEKVLGHTRKVLANDKGNSLMVLPLDQ 269


>gi|221066041|ref|ZP_03542146.1| HflK protein [Comamonas testosteroni KF-1]
 gi|220711064|gb|EED66432.1| HflK protein [Comamonas testosteroni KF-1]
          Length = 463

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 108/316 (34%), Positives = 177/316 (56%), Gaps = 27/316 (8%)

Query: 45  PFFKSYGSVYI----ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFW 100
           PF    G   I    +L+ +G+       +IV   ++AV  +FGK K  V       + +
Sbjct: 111 PFNPGKGIFLIAGVAVLIWLGT-----GFFIVQEGQQAVITQFGKYKGTVGAGFNWRLPY 165

Query: 101 PIDQVEIVKVIERQQKIGGRSASVGSN-----SGL----ILTGDQNIVGLHFSVLYVVTD 151
           PI + E+V V +       RSA VGS+     +GL    +LT D+NIV + F+V Y +++
Sbjct: 166 PIQKHELVYVSQI------RSAEVGSDNIVRGTGLRASAMLTEDENIVEIKFAVQYRLSN 219

Query: 152 PRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKS 211
            R +LF   NP E + QV+ESA+REVVG+         +R QIA  VR+L+Q  +D Y+ 
Sbjct: 220 ARDWLFESRNPSEAVVQVAESAVREVVGKMKMDAALSEERDQIAPRVRDLMQTILDRYQI 279

Query: 212 GILINTISIEDAS--PPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIR 269
           G+ +  I+++     PP +V  +FD+V +A Q+ +R   E+  Y+N V+  A G A+ + 
Sbjct: 280 GVEVVGINMQQGGVRPPEQVQASFDDVLKAGQERERAKNEAQAYANDVVPRAAGAAARLG 339

Query: 270 ESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ 329
           E +  YK +I+ +AQG+A RF S+Y +Y  AP + R R+Y++ M+ +     KV+++ +Q
Sbjct: 340 EEAAGYKSKIVAQAQGDAGRFSSLYSEYQKAPQVTRDRLYIDAMQQVYTNVTKVLVESRQ 399

Query: 330 -SVMPYLPLNEAFSRI 344
            S + YLPL++    +
Sbjct: 400 GSNLLYLPLDKIMQNV 415


>gi|238750073|ref|ZP_04611576.1| hypothetical protein yrohd0001_6530 [Yersinia rohdei ATCC 43380]
 gi|238711617|gb|EEQ03832.1| hypothetical protein yrohd0001_6530 [Yersinia rohdei ATCC 43380]
          Length = 425

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 92/270 (34%), Positives = 151/270 (55%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  R GK  + +  PGL+     ID+V  V V          S    + SG
Sbjct: 99  YTIKEAERGVVTRLGKLSH-IVQPGLNWKPTFIDEVTPVNV---------ESVRELAASG 148

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YLF++ NP ++L+Q ++SA+R V+G+     I   
Sbjct: 149 VMLTSDENVVRIEMNVQYRVTDPAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTE 208

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 209 GRTIVRSDTQRVLEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 268

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  + E + AY  R + EAQGE   F  +  +Y  AP + R+R+Y
Sbjct: 269 AEAYTNEVQPRANGQAQRLLEDARAYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLY 328

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L K  KV+ + K + +  LPL++
Sbjct: 329 IETMEKVLGKTHKVLANDKGNNLMVLPLDQ 358


>gi|299067273|emb|CBJ38470.1| Protein hflK, cofactor of ATP-dependent protease FtsH [Ralstonia
           solanacearum CMR15]
          Length = 459

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 97/291 (33%), Positives = 159/291 (54%), Gaps = 10/291 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQKIGGRSASVGSNS 128
           +IV   +  V L+FG+ K     PG++    +PI+  EIV +   +    GR+  +   +
Sbjct: 124 FIVQEGQTGVILQFGRFKYQA-TPGINWRLPYPIETHEIVNLSGVRTLEIGRTTQIKDTN 182

Query: 129 ---GLILTGDQNIVGLHFSVLYVVTDPRLYLF----NLENPGETLKQVSESAMREVVGRR 181
                +LT D+NIV + FSV Y + DP  YLF    +     E + Q +E+++RE+VGR 
Sbjct: 183 LKDSSMLTQDENIVDVRFSVQYNIADPVEYLFYNRTDQRGDEELVTQAAETSVREIVGRN 242

Query: 182 FAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQ 241
               +    R  +   +   IQ+ +  YK+GI I +++++   PP +V  AFD+V +A Q
Sbjct: 243 KMDAVLYEGRDAVGRNLAESIQRILSAYKTGIRILSVNVQSVQPPEQVQSAFDDVTKAGQ 302

Query: 242 DEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAP 301
           D +R + E   Y+N V+  A+G A+ + E +  YK R++  A+G+A RF S+  +Y  AP
Sbjct: 303 DRERAISEGQAYANDVVPRAKGTAARLGEEAQGYKARVVARAEGDAARFASVQREYAKAP 362

Query: 302 TLLRKRIYLETMEGILKKAKKVIIDKK-QSVMPYLPLNEAFSRIQTKREIR 351
            + R RIYLETM+ I     KV++D+     + YLPL++  ++ QT    R
Sbjct: 363 QVTRDRIYLETMQDIYANTTKVLVDQSGNGSLLYLPLDKLIAQSQTGDAAR 413


>gi|24115529|ref|NP_710039.1| FtsH protease regulator HflK [Shigella flexneri 2a str. 301]
 gi|30065546|ref|NP_839717.1| FtsH protease regulator HflK [Shigella flexneri 2a str. 2457T]
 gi|24054857|gb|AAN45746.1| protease specific for phage lambda cII repressor [Shigella flexneri
           2a str. 301]
 gi|30043810|gb|AAP19529.1| protease specific for phage lambda cII repressor [Shigella flexneri
           2a str. 2457T]
 gi|281603636|gb|ADA76620.1| Protease specific for phage lambda cII repressor [Shigella flexneri
           2002017]
 gi|313646351|gb|EFS10813.1| hflK protein [Shigella flexneri 2a str. 2457T]
 gi|332749050|gb|EGJ79473.1| hflK protein [Shigella flexneri K-671]
 gi|332761901|gb|EGJ92175.1| hflK protein [Shigella flexneri 2747-71]
 gi|332763222|gb|EGJ93465.1| hflK protein [Shigella flexneri 2930-71]
 gi|333012016|gb|EGK31401.1| hflK protein [Shigella flexneri K-304]
          Length = 419

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 94/272 (34%), Positives = 156/272 (57%), Gaps = 10/272 (3%)

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSN 127
             Y +   ER V  RFGK  + +  PGL+     ID+V+ V V E  +++          
Sbjct: 96  GFYTIKEAERGVVTRFGK-FSHLVEPGLNWKPTFIDEVKPVNV-EAVRELAA-------- 145

Query: 128 SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIF 187
           SG++LT D+N+V +  +V Y VT+P  YL+++ +P ++L+Q ++SA+R V+G+     I 
Sbjct: 146 SGVMLTSDENVVRVEMNVQYRVTNPEKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRIL 205

Query: 188 RSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFV 247
              R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++
Sbjct: 206 TEGRTVIRSDTQRELEETIRPYDMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYI 265

Query: 248 EESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKR 307
            E+  YSN V   A G+A  I E + AYK + I EAQGE  RF  +  +Y  AP + R+R
Sbjct: 266 REAEAYSNEVQPRANGQAQRILEEARAYKAQTILEAQGEVARFAKLLPEYKAAPEITRER 325

Query: 308 IYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +Y+ETME +L   +KV+++ K   +  LPL++
Sbjct: 326 LYIETMEKVLGNTRKVLVNDKGGNLMVLPLDQ 357


>gi|152973044|ref|YP_001338190.1| FtsH protease regulator HflK [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238892658|ref|YP_002917392.1| FtsH protease regulator HflK [Klebsiella pneumoniae NTUH-K2044]
 gi|262045394|ref|ZP_06018418.1| FtsH protease regulator HflK [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|150957893|gb|ABR79923.1| protease specific for phage lambda cII repressor [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|238544974|dbj|BAH61325.1| protease specific for phage lambda cII repressor [Klebsiella
           pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|259037312|gb|EEW38559.1| FtsH protease regulator HflK [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 420

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 95/271 (35%), Positives = 152/271 (56%), Gaps = 11/271 (4%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V+ V V          S    + SG
Sbjct: 97  YTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDNVQAVNV---------ESVRELAASG 146

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YLF++ +  ++L+Q ++SA+R V+G+     I   
Sbjct: 147 VMLTSDENVVRVEMNVQYRVTDPERYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTE 206

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 207 GRTVIRSDTQRELEETIRPYNMGITLLDVNFQTARPPEEVKAAFDDAIAARENEQQYIRE 266

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK + + EAQGE  RF  I  +Y  AP + R+R+Y
Sbjct: 267 AEAYTNEVQPRANGQAQRILEEARAYKTQTVLEAQGEVARFAKILPEYKAAPEITRERLY 326

Query: 310 LETMEGILKKAKKVII-DKKQSVMPYLPLNE 339
           +ETME +L   +KV++ D K   +  LPL++
Sbjct: 327 IETMEKVLSHTRKVLVNDSKNGNLMVLPLDQ 357


>gi|253991551|ref|YP_003042907.1| FtsH protease regulator HflK [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|211638429|emb|CAR67051.1| protease specific for phage lambda cii repressor [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253783001|emb|CAQ86166.1| protease specific for phage lambda cii repressor [Photorhabdus
           asymbiotica]
          Length = 408

 Score =  158 bits (399), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 92/293 (31%), Positives = 163/293 (55%), Gaps = 15/293 (5%)

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIV 108
           S  +V I+++   S       Y +   ER V  R GK  + +  PGL+     ID+V  V
Sbjct: 75  SLAAVAIVVIWAAS-----GFYTIKETERGVVTRLGKLSH-IVQPGLNWKPTFIDEVVPV 128

Query: 109 KVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
            V E  +++          SG++LT D+N+V +  +V Y VT+P  YL+++ +P  +L+Q
Sbjct: 129 NV-ESVRELAA--------SGVMLTSDENVVRVEMNVQYRVTNPAAYLYSVTSPDNSLRQ 179

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
            ++SA+R V+G+     I    R  +  + + ++++T+  YK GI +  ++ + A PP E
Sbjct: 180 ATDSAVRGVIGKYTMDKILTEGRTIVRSDTQRVLEETIRPYKMGITLLDVNFQAARPPEE 239

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V  +FD+   A ++E +++ E+  Y+N V   A G+A  + E + AYK R++ EAQGE  
Sbjct: 240 VKASFDDAIAARENEQQYIREAEAYANEVQPRANGQAQRLIEDAKAYKARVVLEAQGEVA 299

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAF 341
            F  +  +Y  AP + R+R+Y+E+ME +L   +KV+ ++  + +  LPL + F
Sbjct: 300 SFAKMLPEYKAAPEITRERLYIESMEKVLSNTRKVVANENSNSLMVLPLEQLF 352


>gi|218513693|ref|ZP_03510533.1| hydrolase serine protease transmembrane subunit K protein
           [Rhizobium etli 8C-3]
          Length = 185

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 79/162 (48%), Positives = 107/162 (66%), Gaps = 4/162 (2%)

Query: 12  PTRLSGSNGNGDGLPPFDVEAIIRYIKDKF-DLIPFFKSYGSVYIILLLIGSFCAFQSIY 70
           P R  GS G G    P D+E IIR  +D+  +++P   + G   I+L ++  F   Q +Y
Sbjct: 27  PNRPRGSGGKGG---PPDLEDIIRRGQDQLRNIVPGGFNGGVTVIVLAIVAVFWLIQCVY 83

Query: 71  IVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGL 130
            V PDER VELRFGKP+  V +PGLH  FWP+D VEIVKV E+   +GG   S  +  GL
Sbjct: 84  TVQPDERGVELRFGKPRETVSMPGLHFHFWPMDTVEIVKVTEQLLNVGGTQGSSNTAGGL 143

Query: 131 ILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
           +L+GDQNI+ + F+VLY ++D R YLFN+E+P +TL+QVSES
Sbjct: 144 MLSGDQNILNVRFNVLYQISDARAYLFNVESPAQTLQQVSES 185


>gi|309972726|gb|ADO95927.1| Protease modulator complex HflKC, subunit HflK [Haemophilus
           influenzae R2846]
          Length = 410

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 97/301 (32%), Positives = 162/301 (53%), Gaps = 14/301 (4%)

Query: 45  PFFKSYGSVYIILLLIGSFC-AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPID 103
           PF   +G V  + + IG+        Y +   ER V LRFG+  + +  PGL+     +D
Sbjct: 81  PFH--FGKVIPLAVAIGAIIWGVSGFYTIKEAERGVVLRFGE-LHSIVQPGLNWKPTFVD 137

Query: 104 QVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           +V  V V E+ +++           G +LT D+N+V +  +V Y V DP  Y F++ N  
Sbjct: 138 KVLPVNV-EQVKEL--------RTQGAMLTQDENMVKVEMTVQYRVQDPAKYRFSVTNAD 188

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           ++L Q ++SA+R VVG     DI  + R  +       + + +  Y  G+ +  ++ + A
Sbjct: 189 DSLNQATDSALRYVVGHMSMNDILTTGRSVVRENTWKALNEIIKSYDMGLEVIDVNFQSA 248

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  I E + AYKDRI+ +A
Sbjct: 249 RPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQRILEEATAYKDRIVLDA 308

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFS 342
           +GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D    + +  LPL +   
Sbjct: 309 KGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDGNNGNNLTVLPLEQIMG 368

Query: 343 R 343
           +
Sbjct: 369 K 369


>gi|190575457|ref|YP_001973302.1| putative HflK protein [Stenotrophomonas maltophilia K279a]
 gi|190013379|emb|CAQ47013.1| putative HflK protein [Stenotrophomonas maltophilia K279a]
          Length = 377

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 92/274 (33%), Positives = 158/274 (57%), Gaps = 13/274 (4%)

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQKIGGRSASV 124
           F S  ++   +R V LRFG+  + +  PG +    WPI+ V  V   E    I   S  V
Sbjct: 63  FSSFQLIGEQQRGVVLRFGQ-FSRILQPGPNFKLPWPIESVTKVNATE----IKTFSIQV 117

Query: 125 GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAV 184
                 +LT D+NIV +  +V Y + DP+ YLF   +  + L+Q ++SA+RE VGR   +
Sbjct: 118 -----PVLTRDENIVNVSLNVQYRIDDPQQYLFGTVDANQVLEQSAQSAVREEVGR-ADL 171

Query: 185 DIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDED 244
           +   + R  +A+     +Q  +  +K+G+ +  ++++DA PP EV  AFDEV  A+Q ++
Sbjct: 172 NAVLNNRGPLAVAAEERLQALLKAFKTGLTVTGLTLQDARPPEEVKPAFDEVNGAQQVKE 231

Query: 245 RFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLL 304
           R + E+  Y+ +V+  ARG+AS  R ++  YK  ++ +A+G+A RF  +  QY +AP + 
Sbjct: 232 RLINEAQAYAAKVVPEARGQASRARTTAEGYKQAVVSKAEGDAQRFSLLQAQYKDAPEVT 291

Query: 305 RKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLN 338
           RKR++LET++ +L + +KVI    + ++ Y+P+ 
Sbjct: 292 RKRLWLETVQQVLSENRKVIGGDGRQLI-YVPMT 324


>gi|283834792|ref|ZP_06354533.1| HflK protein [Citrobacter youngae ATCC 29220]
 gi|291069038|gb|EFE07147.1| HflK protein [Citrobacter youngae ATCC 29220]
          Length = 417

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 94/270 (34%), Positives = 152/270 (56%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     +D+V  V V          S    + SG
Sbjct: 98  YTIKEAERGVVTRFGK-FSHLVEPGLNWKPTFVDEVIPVNV---------ESVRELAASG 147

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YLF++ +  ++L+Q ++SA+R V+G+     I   
Sbjct: 148 VMLTSDENVVRVEMNVQYRVTDPEKYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTE 207

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 208 GRTVIRSDTQRELEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 267

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK + I EAQGE  RF  I  +Y  AP + R+R+Y
Sbjct: 268 AEAYTNEVQPRANGQAQRILEEARAYKTQTILEAQGEVARFAKILPEYKAAPQITRERLY 327

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K   +  LPL++
Sbjct: 328 IETMEKVLSHTRKVLVNDKGGNLMVLPLDQ 357


>gi|254521603|ref|ZP_05133658.1| HflK protein [Stenotrophomonas sp. SKA14]
 gi|219719194|gb|EED37719.1| HflK protein [Stenotrophomonas sp. SKA14]
          Length = 377

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 92/274 (33%), Positives = 158/274 (57%), Gaps = 13/274 (4%)

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQKIGGRSASV 124
           F S  ++   +R V LRFG+  + +  PG +    WPI+ V  V   E    I   S  V
Sbjct: 63  FSSFQLIGEQQRGVVLRFGQ-FSRILQPGPNFKLPWPIESVTKVNATE----IKTFSIQV 117

Query: 125 GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAV 184
                 +LT D+NIV +  +V Y + DP+ YLF   +  + L+Q ++SA+RE VGR   +
Sbjct: 118 -----PVLTRDENIVNVSLNVQYRIDDPQQYLFGTVDANQVLEQSAQSAVREEVGR-ADL 171

Query: 185 DIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDED 244
           +   + R  +A+     +Q  +  +K+G+ +  ++++DA PP EV  AFDEV  A+Q ++
Sbjct: 172 NAVLNNRGPLAVAAEERLQALLKAFKTGLTVTGLTLQDARPPEEVKPAFDEVNGAQQVKE 231

Query: 245 RFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLL 304
           R + E+  Y+ +V+  ARG+AS  R ++  YK  ++ +A+G+A RF  +  QY +AP + 
Sbjct: 232 RLINEAQAYAAKVVPEARGQASRARTTAEGYKQAVVSKAEGDAQRFSLLQAQYKDAPEVT 291

Query: 305 RKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLN 338
           RKR++LET++ +L + +KVI    + ++ Y+P+ 
Sbjct: 292 RKRLWLETVQQVLSENRKVIGGDGRQLI-YVPMT 324


>gi|292489618|ref|YP_003532508.1| protease specific for phage lambda cII repressor [Erwinia amylovora
           CFBP1430]
 gi|292898162|ref|YP_003537531.1| protein hflk [Erwinia amylovora ATCC 49946]
 gi|291198010|emb|CBJ45112.1| protein hflk [Erwinia amylovora ATCC 49946]
 gi|291555055|emb|CBA23137.1| protease specific for phage lambda cII repressor [Erwinia amylovora
           CFBP1430]
          Length = 417

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 95/270 (35%), Positives = 151/270 (55%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID+V  V V          S    S SG
Sbjct: 95  YTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDRVRAVNV---------ESVRELSASG 144

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
            +LT D+N+V +  +V Y VT+P  YLF + +  ++L+Q ++SA+R V+GR     I   
Sbjct: 145 TMLTSDENVVRVEMNVQYRVTNPERYLFAVTSADDSLRQATDSALRGVIGRSTMDRILTE 204

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + +  +++T+  Y  GI +  ++ + A PP +V  +FD+   A ++ ++ V E
Sbjct: 205 GRTVVRSDTQRELEETIRPYDMGITLLDVNFQTARPPEDVKASFDDAIAARENREQSVRE 264

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N  L  ARG+A  I E + AYK R+  EAQGE D F  I  +Y  AP + R+R+Y
Sbjct: 265 AEAYANDKLPRARGDAQGILEKARAYKARVTLEAQGEVDSFARILPEYKAAPQITRERLY 324

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K S +  LPL++
Sbjct: 325 IETMERVLGHTRKVLVNDKGSNLMVLPLDQ 354


>gi|313575267|emb|CBI71205.1| putative hydrolase serine protease transmembrane subunit K protein
           [uncultured bacterium]
          Length = 181

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 102/140 (72%), Gaps = 2/140 (1%)

Query: 29  DVEAIIRYIKDKF-DLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPK 87
           D+E IIR  +D+   ++P   + G+  I+L++I +F AFQS+Y V PDER VELRFG+PK
Sbjct: 43  DLEDIIRRSQDRLRGVMPGGFNGGAFAIVLIVIIAFLAFQSVYTVQPDERGVELRFGRPK 102

Query: 88  NDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147
           +++ +PGLH  FWP + VEIVKV E+QQ IG    S  SN+G +LTGDQNIV + FSVL+
Sbjct: 103 DEISMPGLHFHFWPFESVEIVKVTEQQQNIGAARGS-SSNAGWMLTGDQNIVNVQFSVLF 161

Query: 148 VVTDPRLYLFNLENPGETLK 167
            VTDP+ YLFNLE P  TL+
Sbjct: 162 TVTDPKAYLFNLEGPASTLQ 181


>gi|219872173|ref|YP_002476548.1| protein HflK/membrane protease subunit, stomatin/prohibitin-like
           protein [Haemophilus parasuis SH0165]
 gi|219692377|gb|ACL33600.1| protein HflK/membrane protease subunit, stomatin/prohibitin-like
           protein [Haemophilus parasuis SH0165]
          Length = 404

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 91/257 (35%), Positives = 146/257 (56%), Gaps = 10/257 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y V   ER V  RFGK  +++ LPGL+     ID V  V  IER  ++          +G
Sbjct: 95  YTVQEAERGVVTRFGK-LHEIVLPGLNWKPTFIDNVTPVN-IERVLEL--------RTNG 144

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
            +LT D+N+V +  +V Y + DP  YLF++  P ++LKQ ++SA+R V+G     DI  +
Sbjct: 145 SMLTQDENMVLVEMTVQYRIEDPAKYLFSVTKPDDSLKQATDSALRYVIGHMTMDDILTT 204

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  +  N ++  +  Y  G+LI  ++ + A PP EV  AFD+  +A++DE R + E
Sbjct: 205 GRAIVREKTWNALRDIIKNYDMGLLITDVNFQYARPPEEVKAAFDDAIKAQEDEQRLIRE 264

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+      ARG+A  I E + AYK++++  AQGE  RF  +  +Y  AP + R R+Y
Sbjct: 265 AEAYARGQEPIARGQAQRILEQANAYKEQVVLNAQGEVQRFTQLLPEYKAAPEVTRDRLY 324

Query: 310 LETMEGILKKAKKVIID 326
           ++TME ++K   K+++D
Sbjct: 325 IQTMEKVMKNTPKLMVD 341


>gi|318607418|emb|CBY28916.1| hflk protein [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 427

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 91/270 (33%), Positives = 151/270 (55%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  R GK  + +  PGL+     ID+V  V V          S    + SG
Sbjct: 102 YTIKEAERGVVTRLGKLSH-IVQPGLNWKPTFIDEVTPVNV---------ESVRELAASG 151

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YLF++ NP ++L+Q ++SA+R V+G+     I   
Sbjct: 152 VMLTSDENVVRIEMNVQYRVTDPAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTE 211

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 212 GRTIVRSDTQRVLEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 271

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  + E + AY  R + EAQGE   F  +  +Y  AP + R+R+Y
Sbjct: 272 AEAYTNEVQPRANGQAQRLLEDARAYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLY 331

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+ + K + +  LPL++
Sbjct: 332 IETMEKVLGHTRKVLANDKGNSLMVLPLDQ 361


>gi|285005766|ref|YP_001004754.2| hypothetical protein YE0379 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 427

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 91/270 (33%), Positives = 151/270 (55%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  R GK  + +  PGL+     ID+V  V V          S    + SG
Sbjct: 102 YTIKEAERGVVTRLGKLSH-IVQPGLNWKPTFIDEVTPVNV---------ESVRELAASG 151

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YLF++ NP ++L+Q ++SA+R V+G+     I   
Sbjct: 152 VMLTSDENVVRIEMNVQYRVTDPAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTE 211

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 212 GRTIVRSDTQRVLEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 271

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  + E + AY  R + EAQGE   F  +  +Y  AP + R+R+Y
Sbjct: 272 AEAYTNEVQPRANGQAQRLLEDARAYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLY 331

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+ + K + +  LPL++
Sbjct: 332 IETMEKVLGHTRKVLANDKGNSLMVLPLDQ 361


>gi|157147857|ref|YP_001455176.1| FtsH protease regulator HflK [Citrobacter koseri ATCC BAA-895]
 gi|157085062|gb|ABV14740.1| hypothetical protein CKO_03661 [Citrobacter koseri ATCC BAA-895]
          Length = 418

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 94/270 (34%), Positives = 155/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID+V  V V E  +++          SG
Sbjct: 98  YTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDEVTPVNV-EAVRELAA--------SG 147

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP+ YLF++ +  ++L+Q ++SA+R V+G+     I   
Sbjct: 148 VMLTSDENVVRVEMNVQYRVTDPQRYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTE 207

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 208 GRTVIRSDTQRELEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 267

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AY+ + I EAQGE  RF  I  +Y  AP + R+R+Y
Sbjct: 268 AEAYTNEVQPRANGQAQRILEEARAYRTQTILEAQGEVARFAKILPEYKAAPEITRERLY 327

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K   +  LPL++
Sbjct: 328 IETMEKVLSHTRKVLVNDKGGNLMVLPLDQ 357


>gi|226939622|ref|YP_002794695.1| transmembrane protein HflK [Laribacter hongkongensis HLHK9]
 gi|226714548|gb|ACO73686.1| Probable transmembrane protein HflK [Laribacter hongkongensis
           HLHK9]
          Length = 412

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 101/296 (34%), Positives = 166/296 (56%), Gaps = 15/296 (5%)

Query: 57  LLLIGSFCAF---QSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE 112
           + L+G   A       ++V   E AV LR G   +     GL     +P ++VEIV + E
Sbjct: 62  IALVGVLAALWLGSGFFVVDAREEAVVLRLGS-YDRTATAGLQWHIPYPFEKVEIVNMTE 120

Query: 113 -RQQKIG--GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFN--LENPGET-- 165
            R  ++G  G + +   +  L+LT D NIV +  SV Y V D R +LFN     PG    
Sbjct: 121 VRSVEVGYRGNAKNRMPDESLMLTEDLNIVDVQLSVQYDVQDARAFLFNNVYTEPGGQGI 180

Query: 166 LKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASP 225
           +K V+ESA+ +VVG+     +    R +IA + + LIQK +D Y  G+ +  ++I +  P
Sbjct: 181 VKSVTESAISQVVGQNKIDFVLNEGRTKIASDTQTLIQKILDLYGMGLRVIKVNINNVQP 240

Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQG 285
           P +V  AF++  +A QD+++   E+  Y+N V+  A G A+ + E +  Y  R++  A+G
Sbjct: 241 PDQVQAAFEDAVKAGQDKEKSRNEAQAYANDVVPRATGMAARLIEEAQGYSQRVVASAEG 300

Query: 286 EADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
           EA RF ++ G+Y  AP ++R R+Y++TM+ IL+   KV++D K  Q+++ YLP ++
Sbjct: 301 EASRFKAVLGEYQKAPVVMRDRLYIDTMQQILQNTTKVLVDGKNGQNLL-YLPFDK 355


>gi|218551444|ref|YP_002385236.1| FtsH protease regulator HflK [Escherichia fergusonii ATCC 35469]
 gi|218358986|emb|CAQ91646.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia fergusonii ATCC 35469]
 gi|323965560|gb|EGB61014.1| HflK protein [Escherichia coli M863]
 gi|323975485|gb|EGB70586.1| HflK protein [Escherichia coli TW10509]
 gi|324112229|gb|EGC06207.1| HflK protein [Escherichia fergusonii B253]
 gi|325499710|gb|EGC97569.1| FtsH protease regulator HflK [Escherichia fergusonii ECD227]
 gi|327250114|gb|EGE61833.1| hflK protein [Escherichia coli STEC_7v]
          Length = 419

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 93/272 (34%), Positives = 156/272 (57%), Gaps = 10/272 (3%)

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSN 127
             Y +   ER V  RFGK  + +  PGL+     ID+V+ V V E  +++          
Sbjct: 96  GFYTIKEAERGVVTRFGK-FSHLVEPGLNWKPTFIDEVKPVNV-EAVRELAA-------- 145

Query: 128 SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIF 187
           SG++LT D+N+V +  +V Y VT+P  YL+++ +P ++L+Q ++SA+R V+G+     I 
Sbjct: 146 SGVMLTSDENVVRVEMNVQYRVTNPEKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRIL 205

Query: 188 RSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFV 247
              R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++
Sbjct: 206 TEGRTVIRSDTQRELEETIRPYDMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYI 265

Query: 248 EESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKR 307
            E+  Y+N V   A G+A  I E + AYK + I EAQGE  RF  +  +Y  AP + R+R
Sbjct: 266 REAEAYTNEVQPRANGQAQRILEEARAYKAQTILEAQGEVARFAKLLPEYKAAPEITRER 325

Query: 308 IYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +Y+ETME +L   +KV+++ K   +  LPL++
Sbjct: 326 LYIETMEKVLGNTRKVLVNDKGGNLMVLPLDQ 357


>gi|332160024|ref|YP_004296601.1| hypothetical protein YE105_C0400 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325664254|gb|ADZ40898.1| hypothetical protein YE105_C0400 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330862093|emb|CBX72259.1| protein hflK [Yersinia enterocolitica W22703]
          Length = 427

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 91/270 (33%), Positives = 151/270 (55%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  R GK  + +  PGL+     ID+V  V V          S    + SG
Sbjct: 102 YTIKEAERGVVTRLGKLSH-IVQPGLNWKPTFIDEVTPVNV---------ESVRELAASG 151

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YLF++ NP ++L+Q ++SA+R V+G+     I   
Sbjct: 152 VMLTSDENVVRIEMNVQYRVTDPAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTE 211

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 212 GRTIVRSDTQRVLEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 271

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  + E + AY  R + EAQGE   F  +  +Y  AP + R+R+Y
Sbjct: 272 AEAYTNEVQPRANGQAQRLLEDARAYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLY 331

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+ + K + +  LPL++
Sbjct: 332 IETMEKVLGHTRKVLANDKGNSLMVLPLDQ 361


>gi|288937527|ref|YP_003441586.1| HflK protein [Klebsiella variicola At-22]
 gi|288892236|gb|ADC60554.1| HflK protein [Klebsiella variicola At-22]
          Length = 420

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 94/271 (34%), Positives = 152/271 (56%), Gaps = 11/271 (4%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V+ V V          S    + SG
Sbjct: 97  YTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDNVQAVNV---------ESVRELAASG 146

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YLF++ +  ++L+Q ++SA+R V+G+     I   
Sbjct: 147 VMLTSDENVVRVEMNVQYRVTDPERYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTE 206

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 207 GRTVIRSDTQRELEETIRPYNMGITLLDVNFQTARPPEEVKAAFDDAIAARENEQQYIRE 266

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK + + EAQGE  RF  +  +Y  AP + R+R+Y
Sbjct: 267 AEAYTNEVQPRANGQAQRILEEARAYKTQTVLEAQGEVARFAKLLPEYKAAPEITRERLY 326

Query: 310 LETMEGILKKAKKVII-DKKQSVMPYLPLNE 339
           +ETME +L   +KV++ D K   +  LPL++
Sbjct: 327 IETMEKVLSHTRKVLVNDSKNGNLMVLPLDQ 357


>gi|315617587|gb|EFU98193.1| hflK protein [Escherichia coli 3431]
          Length = 419

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 93/270 (34%), Positives = 156/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID+V+ V V E  +++          SG
Sbjct: 98  YTIKEAERGVVTRFGK-FSHLVEPGLNWKPTFIDEVKPVNV-EAVRELAA--------SG 147

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VT+P  YL+++ +P ++L+Q ++SA+R V+G+     I   
Sbjct: 148 VMLTSDENVVRVEMNVQYRVTNPEKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRILTE 207

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 208 GRTVIRSDTQRELEETIRPYDMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 267

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK + I EAQGE  RF  +  +Y  AP + R+R+Y
Sbjct: 268 AEAYTNEVQPRANGQAQRILEEARAYKAQTILEAQGEVARFAKLLPEYKAAPEITRERLY 327

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K   +  LPL++
Sbjct: 328 IETMEKVLGNTRKVLVNDKGGNLMVLPLDQ 357


>gi|206578878|ref|YP_002240871.1| HflK protein [Klebsiella pneumoniae 342]
 gi|206567936|gb|ACI09712.1| HflK protein [Klebsiella pneumoniae 342]
          Length = 420

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 94/271 (34%), Positives = 152/271 (56%), Gaps = 11/271 (4%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V+ V V          S    + SG
Sbjct: 97  YTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDNVQAVNV---------ESVRELAASG 146

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YLF++ +  ++L+Q ++SA+R V+G+     I   
Sbjct: 147 VMLTSDENVVRVEMNVQYRVTDPERYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTE 206

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 207 GRTVIRSDTQRELEETIRPYNMGITLLDVNFQTARPPEEVKAAFDDAIAARENEQQYIRE 266

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK + + EAQGE  RF  +  +Y  AP + R+R+Y
Sbjct: 267 AEAYTNEVQPRANGQAQRILEEARAYKTQTVLEAQGEVARFAKLLPEYKAAPEITRERLY 326

Query: 310 LETMEGILKKAKKVII-DKKQSVMPYLPLNE 339
           +ETME +L   +KV++ D K   +  LPL++
Sbjct: 327 IETMEKVLSHTRKVLVNDSKNGNLMVLPLDQ 357


>gi|170766747|ref|ZP_02901200.1| HflK protein [Escherichia albertii TW07627]
 gi|170124185|gb|EDS93116.1| HflK protein [Escherichia albertii TW07627]
          Length = 419

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 93/270 (34%), Positives = 156/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID+V+ V V E  +++          SG
Sbjct: 98  YTIKEAERGVVTRFGK-FSHLVEPGLNWKPTFIDEVKPVNV-EAVRELAA--------SG 147

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VT+P  YL+++ +P ++L+Q ++SA+R V+G+     I   
Sbjct: 148 VMLTSDENVVRVEMNVQYRVTNPEKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRILTE 207

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 208 GRTVIRSDTQRELEETIRPYDMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 267

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK + I EAQGE  RF  +  +Y  AP + R+R+Y
Sbjct: 268 AEAYTNEVQPRANGQAQRILEEARAYKAQTILEAQGEVARFAKLLPEYKAAPEITRERLY 327

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K   +  LPL++
Sbjct: 328 IETMEKVLGNTRKVLVNDKGGNLMVLPLDQ 357


>gi|295798069|emb|CAX68888.1| Band 7 protein, HflK protein [uncultured bacterium]
          Length = 330

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 108/316 (34%), Positives = 172/316 (54%), Gaps = 33/316 (10%)

Query: 44  IPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGK-----PKNDVFLPGLHMM 98
           +PFF        IL L+     F S Y V PDE  V  RFGK     P      PGLH  
Sbjct: 27  LPFF--------ILGLLALIVFFSSFYSVGPDEVGVIRRFGKYIRTEP------PGLHWK 72

Query: 99  F-WPIDQVEIVKVIE-RQQKIGGRSA-----SVGSNSG-----LILTGDQNIVGLHFSVL 146
           +   I+++ I+KV    +++ G R+      S  SNSG     L+LTGD NI+ + + V 
Sbjct: 73  YPLNIEKLNIIKVQRVMKEEFGFRTTRSDVRSEYSNSGYEEEALMLTGDVNILDVTWVVQ 132

Query: 147 YVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTM 206
           + + DP   LFN+ NP   ++ +SE+ MRE +G     +   ++R +I  EV+  +Q+ +
Sbjct: 133 FRIKDPVKLLFNIRNPRAIVRDISEAVMREAIGDYSVTEALTTRRVEINQEVQKKLQEVL 192

Query: 207 DYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEAS 266
           D Y +GI I ++ ++D +PP  V  +F+EV  A+Q+ ++ V ++ +  N+V+  A+GEA 
Sbjct: 193 DSYDAGIQIQSVILQDVNPPEAVKSSFNEVNEAKQEMEKVVNQAWEAYNKVIPRAKGEAE 252

Query: 267 HIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKA-KKVII 325
                S  Y  R +  A+G+A  F++ +  Y  A  +  KR+YLET+E +L +A KK I 
Sbjct: 253 KTIGESEGYAVRRVNSAKGDAANFIATWEAYKTAKDVTEKRLYLETLEDVLPRAGKKYIF 312

Query: 326 DKKQS-VMPYLPLNEA 340
           D++ + V+P L L E 
Sbjct: 313 DEQGAKVLPLLNLYEG 328


>gi|302343824|ref|YP_003808353.1| HflK protein [Desulfarculus baarsii DSM 2075]
 gi|301640437|gb|ADK85759.1| HflK protein [Desulfarculus baarsii DSM 2075]
          Length = 348

 Score =  157 bits (397), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 95/282 (33%), Positives = 157/282 (55%), Gaps = 16/282 (5%)

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKV--IERQQ------KIG 118
           S Y V P+E  V  RFG   N    PGLH      I+QV  VK   +E+ +      ++ 
Sbjct: 55  SYYTVGPEETGVVQRFGA-YNRESEPGLHFKLPLGIEQVTNVKTRRVEKMEFGFKTAQVA 113

Query: 119 GRSASVGSNSG---LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMR 175
            R +   + SG   L+L+GD N++ + + V Y + DP+ YLF+++ P   +  +S+S MR
Sbjct: 114 ARGSFRDAGSGETALMLSGDLNVIDVRWIVQYRIRDPKKYLFSIQEPETAIWDLSQSVMR 173

Query: 176 EVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDE 235
            +VG R+A  +   +R +IA++ +  +Q+ +D+Y +G+ I T+ ++D +PP  V  AF+E
Sbjct: 174 RIVGDRWADAVLTLERAEIAIQAQKELQELLDHYDTGVQIVTVKMQDVNPPDPVRSAFNE 233

Query: 236 VQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYG 295
           V  A Q ++R + E+ +  NR +  A+G+A  I   +  Y    +  A GEA RF S+  
Sbjct: 234 VNEARQQKERMINEAQEAYNREIPKAQGDAKRIVSEAEGYATETVNRANGEAQRFSSVLA 293

Query: 296 QYVNAPTLLRKRIYLETMEGILKKAKKV-IIDKKQSVMPYLP 336
            Y  A  + +KR+YLE + G++  A +V ++D  QSV   LP
Sbjct: 294 SYQKAKDVTKKRLYLEALHGMIAAASRVYVVD--QSVRGLLP 333


>gi|191165677|ref|ZP_03027517.1| HflK protein [Escherichia coli B7A]
 gi|193066027|ref|ZP_03047085.1| HflK protein [Escherichia coli E22]
 gi|193070881|ref|ZP_03051813.1| HflK protein [Escherichia coli E110019]
 gi|194426507|ref|ZP_03059061.1| HflK protein [Escherichia coli B171]
 gi|218697923|ref|YP_002405590.1| FtsH protease regulator HflK [Escherichia coli 55989]
 gi|256019819|ref|ZP_05433684.1| FtsH protease regulator HflK [Shigella sp. D9]
 gi|260847004|ref|YP_003224782.1| modulator for HflB protease [Escherichia coli O103:H2 str. 12009]
 gi|300816526|ref|ZP_07096747.1| HflK protein [Escherichia coli MS 107-1]
 gi|332280958|ref|ZP_08393371.1| modulator for HflB protease specific for phage lambda cII repressor
           [Shigella sp. D9]
 gi|190904372|gb|EDV64081.1| HflK protein [Escherichia coli B7A]
 gi|192926350|gb|EDV80986.1| HflK protein [Escherichia coli E22]
 gi|192955827|gb|EDV86298.1| HflK protein [Escherichia coli E110019]
 gi|194415246|gb|EDX31514.1| HflK protein [Escherichia coli B171]
 gi|218354655|emb|CAV01648.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli 55989]
 gi|257762151|dbj|BAI33648.1| modulator for HflB protease [Escherichia coli O103:H2 str. 12009]
 gi|300530756|gb|EFK51818.1| HflK protein [Escherichia coli MS 107-1]
 gi|323161963|gb|EFZ47835.1| hflK protein [Escherichia coli E128010]
 gi|332103310|gb|EGJ06656.1| modulator for HflB protease specific for phage lambda cII repressor
           [Shigella sp. D9]
          Length = 419

 Score =  157 bits (397), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 92/272 (33%), Positives = 154/272 (56%), Gaps = 10/272 (3%)

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSN 127
             Y +   ER V  RFGK  + +  PGL+     ID+V+ V V          +    + 
Sbjct: 96  GFYTIKEAERGVVTRFGK-FSHLVEPGLNWKPTFIDEVKPVNV---------EAVRELAA 145

Query: 128 SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIF 187
           SG++LT D+N+V +  +V Y VT+P  YL+++ +P ++L+Q ++SA+R V+G+     I 
Sbjct: 146 SGVMLTSDENVVRVEMNVQYRVTNPEKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRIL 205

Query: 188 RSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFV 247
              R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++
Sbjct: 206 TEGRTVIRSDTQRELEETIRPYDMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYI 265

Query: 248 EESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKR 307
            E+  Y+N V   A G+A  I E + AYK + I EAQGE  RF  +  +Y  AP + R+R
Sbjct: 266 REAEAYTNEVQPRANGQAQRILEEARAYKAQTILEAQGEVARFAKLLPEYKAAPEITRER 325

Query: 308 IYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +Y+ETME +L   +KV+++ K   +  LPL++
Sbjct: 326 LYIETMEKVLGNTRKVLVNDKGGNLMVLPLDQ 357


>gi|186476171|ref|YP_001857641.1| HflK protein [Burkholderia phymatum STM815]
 gi|184192630|gb|ACC70595.1| HflK protein [Burkholderia phymatum STM815]
          Length = 465

 Score =  157 bits (397), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 94/294 (31%), Positives = 165/294 (56%), Gaps = 10/294 (3%)

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM-MFWPIDQVEIVKVI 111
           V II+ ++ +      +++V   + A  LRFG+ +      G+H  M +P +  EIV V 
Sbjct: 90  VGIIIGVLVAIYLGSGVFVVQDGQAAAVLRFGELRGTAGQ-GVHWRMPYPFESHEIVNVG 148

Query: 112 E-RQQKIGG----RSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
           + R  +IG     R A+V   S  +LT D +IV + F+V Y +  P  YLF   +   ++
Sbjct: 149 QVRSVEIGRNNVVRLANVKDAS--MLTHDADIVDVRFAVQYQIRKPTDYLFRSADADLSV 206

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
            Q +++A+R++VG R   DI    R+ I +++   IQ ++D Y +G+ +  ++I+   PP
Sbjct: 207 TQAAQAAVRQIVGSRSTNDILYRDREAIRIQLSEAIQHSLDEYHTGLAVTGVTIQGVQPP 266

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            +V  AFD+  +A QD +R   ++  Y++ +L  A+ E   +   +  Y +R++ +A+G+
Sbjct: 267 DQVQAAFDDATKARQDRERTRRDAEAYASDLLPRAKAEGERMIADAKTYSERVVAQAEGD 326

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNE 339
           A+RF  ++ QY  AP ++R R+YLETM+ I     KV +D K  S + YLPL++
Sbjct: 327 AERFKEVFAQYSKAPAVIRDRMYLETMQQIFSNTTKVFVDSKSGSNVLYLPLDK 380


>gi|15804763|ref|NP_290804.1| FtsH protease regulator HflK [Escherichia coli O157:H7 EDL933]
 gi|15834404|ref|NP_313177.1| FtsH protease regulator HflK [Escherichia coli O157:H7 str. Sakai]
 gi|16131996|ref|NP_418595.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli str. K-12 substr. MG1655]
 gi|74314659|ref|YP_313078.1| FtsH protease regulator HflK [Shigella sonnei Ss046]
 gi|89110894|ref|AP_004674.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli str. K-12 substr. W3110]
 gi|110808092|ref|YP_691612.1| FtsH protease regulator HflK [Shigella flexneri 5 str. 8401]
 gi|157155151|ref|YP_001465672.1| FtsH protease regulator HflK [Escherichia coli E24377A]
 gi|157163637|ref|YP_001460955.1| FtsH protease regulator HflK [Escherichia coli HS]
 gi|168751476|ref|ZP_02776498.1| HflK protein [Escherichia coli O157:H7 str. EC4113]
 gi|168754743|ref|ZP_02779750.1| HflK protein [Escherichia coli O157:H7 str. EC4401]
 gi|168760414|ref|ZP_02785421.1| HflK protein [Escherichia coli O157:H7 str. EC4501]
 gi|168766451|ref|ZP_02791458.1| HflK protein [Escherichia coli O157:H7 str. EC4486]
 gi|168774115|ref|ZP_02799122.1| HflK protein [Escherichia coli O157:H7 str. EC4196]
 gi|168780604|ref|ZP_02805611.1| HflK protein [Escherichia coli O157:H7 str. EC4076]
 gi|168784809|ref|ZP_02809816.1| HflK protein [Escherichia coli O157:H7 str. EC869]
 gi|168801827|ref|ZP_02826834.1| HflK protein [Escherichia coli O157:H7 str. EC508]
 gi|170021816|ref|YP_001726770.1| FtsH protease regulator HflK [Escherichia coli ATCC 8739]
 gi|170083620|ref|YP_001732940.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli str. K-12 substr. DH10B]
 gi|187730840|ref|YP_001882865.1| FtsH protease regulator HflK [Shigella boydii CDC 3083-94]
 gi|188494594|ref|ZP_03001864.1| HflK protein [Escherichia coli 53638]
 gi|194434592|ref|ZP_03066849.1| HflK protein [Shigella dysenteriae 1012]
 gi|194439534|ref|ZP_03071608.1| HflK protein [Escherichia coli 101-1]
 gi|195935964|ref|ZP_03081346.1| FtsH protease regulator HflK [Escherichia coli O157:H7 str. EC4024]
 gi|208807663|ref|ZP_03250000.1| HflK protein [Escherichia coli O157:H7 str. EC4206]
 gi|208812925|ref|ZP_03254254.1| HflK protein [Escherichia coli O157:H7 str. EC4045]
 gi|208820002|ref|ZP_03260322.1| HflK protein [Escherichia coli O157:H7 str. EC4042]
 gi|209399796|ref|YP_002273716.1| HflK protein [Escherichia coli O157:H7 str. EC4115]
 gi|209921662|ref|YP_002295746.1| FtsH protease regulator HflK [Escherichia coli SE11]
 gi|217324163|ref|ZP_03440247.1| HflK protein [Escherichia coli O157:H7 str. TW14588]
 gi|218556726|ref|YP_002389640.1| FtsH protease regulator HflK [Escherichia coli IAI1]
 gi|218707785|ref|YP_002415304.1| FtsH protease regulator HflK [Escherichia coli UMN026]
 gi|238903281|ref|YP_002929077.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli BW2952]
 gi|253775201|ref|YP_003038032.1| FtsH protease regulator HflK [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254037188|ref|ZP_04871265.1| HflK protein [Escherichia sp. 1_1_43]
 gi|254164103|ref|YP_003047211.1| FtsH protease regulator HflK [Escherichia coli B str. REL606]
 gi|254796193|ref|YP_003081030.1| FtsH protease regulator HflK [Escherichia coli O157:H7 str.
           TW14359]
 gi|256025109|ref|ZP_05438974.1| FtsH protease regulator HflK [Escherichia sp. 4_1_40B]
 gi|260858327|ref|YP_003232218.1| modulator for HflB protease [Escherichia coli O26:H11 str. 11368]
 gi|260870918|ref|YP_003237320.1| modulator for HflB protease [Escherichia coli O111:H- str. 11128]
 gi|261225294|ref|ZP_05939575.1| FtsH protease regulator HflK [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261255454|ref|ZP_05947987.1| FtsH protease regulator HflK [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291285586|ref|YP_003502404.1| FtsH protease regulator HflK [Escherichia coli O55:H7 str. CB9615]
 gi|293402801|ref|ZP_06646898.1| FtsH protease regulator HflK [Escherichia coli FVEC1412]
 gi|293417677|ref|ZP_06660299.1| FtsH protease regulator HflK [Escherichia coli B185]
 gi|293476485|ref|ZP_06664893.1| FtsH protease regulator HflK [Escherichia coli B088]
 gi|297517576|ref|ZP_06935962.1| FtsH protease regulator HflK [Escherichia coli OP50]
 gi|298378331|ref|ZP_06988215.1| FtsH protease regulator HflK [Escherichia coli FVEC1302]
 gi|300821265|ref|ZP_07101413.1| HflK protein [Escherichia coli MS 119-7]
 gi|300899712|ref|ZP_07117938.1| HflK protein [Escherichia coli MS 198-1]
 gi|300906003|ref|ZP_07123727.1| HflK protein [Escherichia coli MS 84-1]
 gi|300920802|ref|ZP_07137203.1| HflK protein [Escherichia coli MS 115-1]
 gi|300922420|ref|ZP_07138540.1| HflK protein [Escherichia coli MS 182-1]
 gi|300929281|ref|ZP_07144757.1| HflK protein [Escherichia coli MS 187-1]
 gi|300949133|ref|ZP_07163175.1| HflK protein [Escherichia coli MS 116-1]
 gi|300957833|ref|ZP_07170011.1| HflK protein [Escherichia coli MS 175-1]
 gi|301023428|ref|ZP_07187211.1| HflK protein [Escherichia coli MS 69-1]
 gi|301027996|ref|ZP_07191280.1| HflK protein [Escherichia coli MS 196-1]
 gi|301302590|ref|ZP_07208720.1| HflK protein [Escherichia coli MS 124-1]
 gi|301325937|ref|ZP_07219358.1| HflK protein [Escherichia coli MS 78-1]
 gi|301646619|ref|ZP_07246485.1| HflK protein [Escherichia coli MS 146-1]
 gi|307140868|ref|ZP_07500224.1| FtsH protease regulator HflK [Escherichia coli H736]
 gi|307314878|ref|ZP_07594470.1| HflK protein [Escherichia coli W]
 gi|312965847|ref|ZP_07780073.1| hflK protein [Escherichia coli 2362-75]
 gi|312974018|ref|ZP_07788189.1| hflK protein [Escherichia coli 1827-70]
 gi|331644921|ref|ZP_08346038.1| protein HflK [Escherichia coli H736]
 gi|331656002|ref|ZP_08356990.1| protein HflK [Escherichia coli M718]
 gi|331665838|ref|ZP_08366732.1| protein HflK [Escherichia coli TA143]
 gi|331671079|ref|ZP_08371912.1| protein HflK [Escherichia coli TA271]
 gi|331680304|ref|ZP_08380963.1| protein HflK [Escherichia coli H591]
 gi|81170799|sp|P0ABC8|HFLK_ECO57 RecName: Full=Protein HflK
 gi|81170800|sp|P0ABC7|HFLK_ECOLI RecName: Full=Modulator of FtsH protease HflK
 gi|12519159|gb|AAG59370.1|AE005650_9 protease specific for phage lambda cII repressor [Escherichia coli
           O157:H7 str. EDL933]
 gi|436157|gb|AAC43399.1| putative integral membrane protein required for high frequency
           lysogenization by bacteriophage lambda [Escherichia
           coli]
 gi|537015|gb|AAA97070.1| CG Site No. 639; alternate gene name hflA; putative integral
           membrane protease required for high frequency
           lysogenization by bacteriophage lambda [Escherichia coli
           str. K-12 substr. MG1655]
 gi|1790616|gb|AAC77131.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli str. K-12 substr. MG1655]
 gi|13364627|dbj|BAB38573.1| protease specific for phage lambda cII repressor [Escherichia coli
           O157:H7 str. Sakai]
 gi|73858136|gb|AAZ90843.1| protease specific for phage lambda cII repressor [Shigella sonnei
           Ss046]
 gi|85676925|dbj|BAE78175.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli str. K12 substr. W3110]
 gi|110617640|gb|ABF06307.1| protease specific for phage lambda cII repressor [Shigella flexneri
           5 str. 8401]
 gi|157069317|gb|ABV08572.1| HflK protein [Escherichia coli HS]
 gi|157077181|gb|ABV16889.1| HflK protein [Escherichia coli E24377A]
 gi|169756744|gb|ACA79443.1| HflK protein [Escherichia coli ATCC 8739]
 gi|169891455|gb|ACB05162.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli str. K-12 substr. DH10B]
 gi|187427832|gb|ACD07106.1| HflK protein [Shigella boydii CDC 3083-94]
 gi|187770328|gb|EDU34172.1| HflK protein [Escherichia coli O157:H7 str. EC4196]
 gi|188014503|gb|EDU52625.1| HflK protein [Escherichia coli O157:H7 str. EC4113]
 gi|188489793|gb|EDU64896.1| HflK protein [Escherichia coli 53638]
 gi|189001651|gb|EDU70637.1| HflK protein [Escherichia coli O157:H7 str. EC4076]
 gi|189357782|gb|EDU76201.1| HflK protein [Escherichia coli O157:H7 str. EC4401]
 gi|189363990|gb|EDU82409.1| HflK protein [Escherichia coli O157:H7 str. EC4486]
 gi|189368981|gb|EDU87397.1| HflK protein [Escherichia coli O157:H7 str. EC4501]
 gi|189375095|gb|EDU93511.1| HflK protein [Escherichia coli O157:H7 str. EC869]
 gi|189376081|gb|EDU94497.1| HflK protein [Escherichia coli O157:H7 str. EC508]
 gi|194417177|gb|EDX33289.1| HflK protein [Shigella dysenteriae 1012]
 gi|194421533|gb|EDX37546.1| HflK protein [Escherichia coli 101-1]
 gi|208727464|gb|EDZ77065.1| HflK protein [Escherichia coli O157:H7 str. EC4206]
 gi|208734202|gb|EDZ82889.1| HflK protein [Escherichia coli O157:H7 str. EC4045]
 gi|208740125|gb|EDZ87807.1| HflK protein [Escherichia coli O157:H7 str. EC4042]
 gi|209161196|gb|ACI38629.1| HflK protein [Escherichia coli O157:H7 str. EC4115]
 gi|209750258|gb|ACI73436.1| protease specific for phage lambda cII repressor [Escherichia coli]
 gi|209750260|gb|ACI73437.1| protease specific for phage lambda cII repressor [Escherichia coli]
 gi|209750262|gb|ACI73438.1| protease specific for phage lambda cII repressor [Escherichia coli]
 gi|209750264|gb|ACI73439.1| protease specific for phage lambda cII repressor [Escherichia coli]
 gi|209750266|gb|ACI73440.1| protease specific for phage lambda cII repressor [Escherichia coli]
 gi|209914921|dbj|BAG79995.1| hypothetical phage protein [Escherichia coli SE11]
 gi|217320384|gb|EEC28808.1| HflK protein [Escherichia coli O157:H7 str. TW14588]
 gi|218363495|emb|CAR01149.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli IAI1]
 gi|218434882|emb|CAR15820.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli UMN026]
 gi|226840294|gb|EEH72296.1| HflK protein [Escherichia sp. 1_1_43]
 gi|238861786|gb|ACR63784.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli BW2952]
 gi|242379696|emb|CAQ34520.1| regulator of FtsH protease, subunit of HflK-HflC complex; regulator
           of FtsH protease and HflB, integral membrane
           ATP-dependent zinc metallopeptidase [Escherichia coli
           BL21(DE3)]
 gi|253326245|gb|ACT30847.1| HflK protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253976004|gb|ACT41675.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli B str. REL606]
 gi|253980160|gb|ACT45830.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli BL21(DE3)]
 gi|254595593|gb|ACT74954.1| modulator for HflB protease specific for phage lambda cII repressor
           [Escherichia coli O157:H7 str. TW14359]
 gi|257756976|dbj|BAI28478.1| modulator for HflB protease [Escherichia coli O26:H11 str. 11368]
 gi|257767274|dbj|BAI38769.1| modulator for HflB protease [Escherichia coli O111:H- str. 11128]
 gi|284924356|emb|CBG37472.1| HflK protein [Escherichia coli 042]
 gi|290765459|gb|ADD59420.1| FtsH protease regulator HflK [Escherichia coli O55:H7 str. CB9615]
 gi|291320938|gb|EFE60380.1| FtsH protease regulator HflK [Escherichia coli B088]
 gi|291429716|gb|EFF02730.1| FtsH protease regulator HflK [Escherichia coli FVEC1412]
 gi|291430395|gb|EFF03393.1| FtsH protease regulator HflK [Escherichia coli B185]
 gi|298280665|gb|EFI22166.1| FtsH protease regulator HflK [Escherichia coli FVEC1302]
 gi|299878906|gb|EFI87117.1| HflK protein [Escherichia coli MS 196-1]
 gi|300315464|gb|EFJ65248.1| HflK protein [Escherichia coli MS 175-1]
 gi|300356723|gb|EFJ72593.1| HflK protein [Escherichia coli MS 198-1]
 gi|300397015|gb|EFJ80553.1| HflK protein [Escherichia coli MS 69-1]
 gi|300402170|gb|EFJ85708.1| HflK protein [Escherichia coli MS 84-1]
 gi|300412225|gb|EFJ95535.1| HflK protein [Escherichia coli MS 115-1]
 gi|300421239|gb|EFK04550.1| HflK protein [Escherichia coli MS 182-1]
 gi|300451381|gb|EFK15001.1| HflK protein [Escherichia coli MS 116-1]
 gi|300462774|gb|EFK26267.1| HflK protein [Escherichia coli MS 187-1]
 gi|300526154|gb|EFK47223.1| HflK protein [Escherichia coli MS 119-7]
 gi|300842115|gb|EFK69875.1| HflK protein [Escherichia coli MS 124-1]
 gi|300847290|gb|EFK75050.1| HflK protein [Escherichia coli MS 78-1]
 gi|301075166|gb|EFK89972.1| HflK protein [Escherichia coli MS 146-1]
 gi|306905681|gb|EFN36210.1| HflK protein [Escherichia coli W]
 gi|309704679|emb|CBJ04029.1| HflK protein [Escherichia coli ETEC H10407]
 gi|310331552|gb|EFP98808.1| hflK protein [Escherichia coli 1827-70]
 gi|312289090|gb|EFR16984.1| hflK protein [Escherichia coli 2362-75]
 gi|315063488|gb|ADT77815.1| modulator for HflB protease specific for phage lambda CII repressor
           [Escherichia coli W]
 gi|315255518|gb|EFU35486.1| HflK protein [Escherichia coli MS 85-1]
 gi|320173672|gb|EFW48862.1| HflK protein [Shigella dysenteriae CDC 74-1112]
 gi|320180687|gb|EFW55614.1| HflK protein [Shigella boydii ATCC 9905]
 gi|320190694|gb|EFW65344.1| HflK protein [Escherichia coli O157:H7 str. EC1212]
 gi|320200696|gb|EFW75282.1| HflK protein [Escherichia coli EC4100B]
 gi|320638932|gb|EFX08578.1| FtsH protease regulator HflK [Escherichia coli O157:H7 str. G5101]
 gi|320644301|gb|EFX13366.1| FtsH protease regulator HflK [Escherichia coli O157:H- str. 493-89]
 gi|320649619|gb|EFX18143.1| FtsH protease regulator HflK [Escherichia coli O157:H- str. H 2687]
 gi|320655015|gb|EFX22976.1| FtsH protease regulator HflK [Escherichia coli O55:H7 str. 3256-97
           TW 07815]
 gi|320660522|gb|EFX27983.1| FtsH protease regulator HflK [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320665791|gb|EFX32828.1| FtsH protease regulator HflK [Escherichia coli O157:H7 str. LSU-61]
 gi|323156009|gb|EFZ42171.1| hflK protein [Escherichia coli EPECa14]
 gi|323166656|gb|EFZ52414.1| hflK protein [Shigella sonnei 53G]
 gi|323171606|gb|EFZ57252.1| hflK protein [Escherichia coli LT-68]
 gi|323176068|gb|EFZ61660.1| hflK protein [Escherichia coli 1180]
 gi|323182280|gb|EFZ67690.1| hflK protein [Escherichia coli 1357]
 gi|323380433|gb|ADX52701.1| HflK protein [Escherichia coli KO11]
 gi|323935404|gb|EGB31748.1| HflK protein [Escherichia coli E1520]
 gi|323940093|gb|EGB36287.1| HflK protein [Escherichia coli E482]
 gi|323946022|gb|EGB42059.1| HflK protein [Escherichia coli H120]
 gi|323960323|gb|EGB55963.1| HflK protein [Escherichia coli H489]
 gi|323970571|gb|EGB65830.1| HflK protein [Escherichia coli TA007]
 gi|324019352|gb|EGB88571.1| HflK protein [Escherichia coli MS 117-3]
 gi|324118739|gb|EGC12631.1| HflK protein [Escherichia coli E1167]
 gi|326345494|gb|EGD69237.1| HflK protein [Escherichia coli O157:H7 str. 1125]
 gi|326346649|gb|EGD70383.1| HflK protein [Escherichia coli O157:H7 str. 1044]
 gi|331035896|gb|EGI08134.1| protein HflK [Escherichia coli H736]
 gi|331046356|gb|EGI18446.1| protein HflK [Escherichia coli M718]
 gi|331056889|gb|EGI28883.1| protein HflK [Escherichia coli TA143]
 gi|331061668|gb|EGI33594.1| protein HflK [Escherichia coli TA271]
 gi|331071767|gb|EGI43103.1| protein HflK [Escherichia coli H591]
 gi|332083171|gb|EGI88402.1| hflK protein [Shigella boydii 5216-82]
 gi|332083738|gb|EGI88956.1| hflK protein [Shigella dysenteriae 155-74]
 gi|332346251|gb|AEE59585.1| conserved hypothetical protein [Escherichia coli UMNK88]
 gi|332749319|gb|EGJ79740.1| hflK protein [Shigella flexneri 4343-70]
 gi|333009048|gb|EGK28504.1| hflK protein [Shigella flexneri K-218]
 gi|333010322|gb|EGK29755.1| hflK protein [Shigella flexneri VA-6]
 gi|333011156|gb|EGK30570.1| hflK protein [Shigella flexneri K-272]
 gi|333012649|gb|EGK32029.1| hflK protein [Shigella flexneri K-227]
          Length = 419

 Score =  157 bits (397), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 92/272 (33%), Positives = 154/272 (56%), Gaps = 10/272 (3%)

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSN 127
             Y +   ER V  RFGK  + +  PGL+     ID+V+ V V          +    + 
Sbjct: 96  GFYTIKEAERGVVTRFGK-FSHLVEPGLNWKPTFIDEVKPVNV---------EAVRELAA 145

Query: 128 SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIF 187
           SG++LT D+N+V +  +V Y VT+P  YL+++ +P ++L+Q ++SA+R V+G+     I 
Sbjct: 146 SGVMLTSDENVVRVEMNVQYRVTNPEKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRIL 205

Query: 188 RSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFV 247
              R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++
Sbjct: 206 TEGRTVIRSDTQRELEETIRPYDMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYI 265

Query: 248 EESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKR 307
            E+  Y+N V   A G+A  I E + AYK + I EAQGE  RF  +  +Y  AP + R+R
Sbjct: 266 REAEAYTNEVQPRANGQAQRILEEARAYKAQTILEAQGEVARFAKLLPEYKAAPEITRER 325

Query: 308 IYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +Y+ETME +L   +KV+++ K   +  LPL++
Sbjct: 326 LYIETMEKVLGNTRKVLVNDKGGNLMVLPLDQ 357


>gi|120597494|ref|YP_962068.1| HflK protein [Shewanella sp. W3-18-1]
 gi|146294365|ref|YP_001184789.1| HflK protein [Shewanella putrefaciens CN-32]
 gi|120557587|gb|ABM23514.1| HflK protein [Shewanella sp. W3-18-1]
 gi|145566055|gb|ABP76990.1| HflK protein [Shewanella putrefaciens CN-32]
          Length = 380

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 108/345 (31%), Positives = 178/345 (51%), Gaps = 30/345 (8%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGS--------VYI 55
           +K N  W      G+ G  D  PP D++ + R +  +F      K  GS        + I
Sbjct: 8   NKGNDPW------GNKGGNDKGPP-DLDEVFRNLSKRFG----GKGTGSGQSFSSLSLII 56

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQ 115
           IL +  +       Y +   ER V LRFGK   ++  PGLH     ID++  V +     
Sbjct: 57  ILAIALAVWGLSGFYTIKEAERGVALRFGKHIGEIG-PGLHWKATFIDEIYPVDI----- 110

Query: 116 KIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMR 175
               +S      SG +LT D+N+V +   V Y + D   YLF+  +   +L++ ++SA+R
Sbjct: 111 ----QSVRSIPASGSMLTSDENVVKVELDVQYRILDAYSYLFSAVDANASLREATDSALR 166

Query: 176 EVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDE 235
            V+G     DI  + R  I  +    +++ ++ YK G+ +  ++   A PP EV DAFD+
Sbjct: 167 YVIGHNKMDDILTTGRDAIRRDTWKELERILEPYKLGLSVVDVNFLPARPPEEVKDAFDD 226

Query: 236 VQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYG 295
              A++DE RF+ E+  Y+  +   ARGE   + + + AYK+R I EA+G+  RF  +  
Sbjct: 227 AISAQEDEQRFIREAEAYAREIEPKARGEVERMAQQANAYKEREILEARGKVARFELLLP 286

Query: 296 QYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
           +Y  +P + RKR+YL+TM+ ++ +  KV+ID K +  + YLPL++
Sbjct: 287 EYQASPEVTRKRLYLDTMQQVMTETNKVLIDAKNNGNLMYLPLDK 331


>gi|157963352|ref|YP_001503386.1| HflK protein [Shewanella pealeana ATCC 700345]
 gi|157848352|gb|ABV88851.1| HflK protein [Shewanella pealeana ATCC 700345]
          Length = 383

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 106/338 (31%), Positives = 178/338 (52%), Gaps = 16/338 (4%)

Query: 16  SGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSY----GSVYIILLLIGSFCAFQSIYI 71
           +G+ G  D  PP D++ + R +  +F              S+ I+L++          Y 
Sbjct: 16  NGNKGGNDKGPP-DLDEVFRNLSKRFGGKGNGSGGSISAASLIIVLVIAIVVWGLSGFYT 74

Query: 72  VHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLI 131
           V   E+ V LRFG+   +V  PGL      ID+V  V V    Q +    AS     G +
Sbjct: 75  VKEAEKGVALRFGEYIGEVD-PGLQWKATFIDEVTPVNV----QTVRSIPAS-----GSM 124

Query: 132 LTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQR 191
           LT D+N+V +   V Y V++ + YL+++ +   +L++ ++SA+R V+G     DI  + R
Sbjct: 125 LTADENVVLVQLDVQYRVSNAKDYLYSVVDADASLREATDSALRYVIGHNTMDDILTTGR 184

Query: 192 QQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESN 251
            +I  +  + I++ +  YK GI +  ++   A PP EV DAFD+   A++DE RF+ E+ 
Sbjct: 185 DKIRRDTWDEIERIIKPYKLGISVVDVNFLPARPPEEVKDAFDDAIAAQEDEQRFIREAE 244

Query: 252 KYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLE 311
            YS ++    RG    + + +IAYK R+I EA+G+  RF  +  +Y  AP + R+R+Y +
Sbjct: 245 AYSRQLEPKVRGTVQRMDQQAIAYKQRVILEAKGKVARFEQLLPEYQAAPEVTRERMYFD 304

Query: 312 TMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQTKR 348
           TM+ ++    KV+ID K S  + YLPL++     Q+ +
Sbjct: 305 TMQEVMSGTNKVLIDAKNSGNLMYLPLDKLMQNSQSHK 342


>gi|311031363|ref|ZP_07709453.1| Membrane protease subunit, stomatin/prohibitin [Bacillus sp. m3-13]
          Length = 321

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 99/297 (33%), Positives = 161/297 (54%), Gaps = 11/297 (3%)

Query: 50  YGSVYIILL--LIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM-MFWPIDQVE 106
           Y +V++++L  +IGS  A  S Y V   E+AV + FGK +  +  PGLH  M WPI  VE
Sbjct: 7   YTTVFLVILAAVIGS-VALTSWYTVDQSEQAVIMTFGKVEEGISEPGLHFKMPWPIQNVE 65

Query: 107 IVKVIERQQKIG-----GRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
            +       + G     G      +++ +I TGD+ IV     V++ +TDP  YLFN ++
Sbjct: 66  TMSKETFSLQFGYEEKDGEIVEFTNDTKMI-TGDEYIVLADMVVMWKITDPGKYLFNSDD 124

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
           P + L   + +++R ++G     +   S + QI +EV +L+   M+ Y  GI + +++++
Sbjct: 125 PQDVLYNATSASLRSIIGSTQIDEALTSGKAQIEVEVFDLLTSLMETYDIGISVTSVNLQ 184

Query: 222 DASPPR-EVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRII 280
           D   P  EV  AF +V  A + E+    E+ +Y N+ +  A GE   I   +   K   I
Sbjct: 185 DVELPNAEVRKAFTDVTDAREMENTKNNEAKRYQNQRMNEAEGEKDAIISKAEGEKAERI 244

Query: 281 QEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPL 337
           + A+G+  +F S+Y +YVNAP L +KR+ LETME +L  A+  I++   + M Y PL
Sbjct: 245 ERARGDVAKFNSLYNEYVNAPELTKKRLILETMEEVLPYAEIYIMNDDGNTMKYFPL 301


>gi|261342835|ref|ZP_05970693.1| HflK protein [Enterobacter cancerogenus ATCC 35316]
 gi|288314877|gb|EFC53815.1| HflK protein [Enterobacter cancerogenus ATCC 35316]
          Length = 419

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 96/271 (35%), Positives = 151/271 (55%), Gaps = 11/271 (4%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V  V V          S    + SG
Sbjct: 98  YTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDDVTAVNV---------ESVRELAASG 147

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YLF++ +  ++L+Q ++SA+R V+G+     I   
Sbjct: 148 VMLTSDENVVRVEMNVQYRVTDPERYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTE 207

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 208 GRTVIRSDTQRELEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 267

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK + I EAQGE  RF  I  +Y  AP + R+R+Y
Sbjct: 268 AEAYTNEVQPRANGQAQRILEEARAYKTQTILEAQGEVARFAKILPEYKAAPEITRERLY 327

Query: 310 LETMEGILKKAKKVII-DKKQSVMPYLPLNE 339
           +ETME +L   +KV++ D K   +  LPL++
Sbjct: 328 IETMEKVLSHTRKVLVNDSKGGNLMVLPLDQ 358


>gi|170728493|ref|YP_001762519.1| HflK protein [Shewanella woodyi ATCC 51908]
 gi|169813840|gb|ACA88424.1| HflK protein [Shewanella woodyi ATCC 51908]
          Length = 379

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 108/334 (32%), Positives = 171/334 (51%), Gaps = 16/334 (4%)

Query: 19  NGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGS-----VYIILLLIGSFCAFQSIYIVH 73
           N NG+   P D++ + R I  +F       S  S     + I+L +          Y V 
Sbjct: 16  NKNGNDKGPPDLDEVFRNISKRFGGGKGNGSGSSFSSFSLIIVLGIAIVVWGLSGFYTVK 75

Query: 74  PDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLILT 133
             E+ V LRFG+   +V  PGL      ID+V  V V          +      SG +LT
Sbjct: 76  EAEKGVALRFGQYVGEV-EPGLQWKATFIDEVFPVNV---------NTVRSIPASGSMLT 125

Query: 134 GDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQ 193
            D+N+V +   V Y V D   +LF+  +   +L++ ++SA+R VVG     DI  + R Q
Sbjct: 126 ADENVVLVELDVQYRVVDAYRFLFSAVDANASLREATDSALRYVVGHNKMDDILTTGRDQ 185

Query: 194 IALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKY 253
           I  +    +++ ++ YK GI I  ++   A PP EV DAFD+   A++DE RF+ E+  Y
Sbjct: 186 IRRDTWAEVERIIEPYKLGIAIEDVNFLPARPPEEVKDAFDDAISAQEDEQRFIREAEAY 245

Query: 254 SNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETM 313
           +  +   ARG+   + + + AYK+R I EA+G+  RF  +  QY  AP + R+R+YL+ M
Sbjct: 246 ARAIEPKARGQVQRMEQQANAYKEREILEARGKVARFELLLPQYKAAPEVTRERLYLDAM 305

Query: 314 EGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQT 346
           + ++    KV++D K S  M YLPL++   + Q+
Sbjct: 306 QTVMSGTSKVLVDSKSSNNMMYLPLDKLMQKNQS 339


>gi|167854531|ref|ZP_02477312.1| adenylosuccinate synthetase [Haemophilus parasuis 29755]
 gi|167854286|gb|EDS25519.1| adenylosuccinate synthetase [Haemophilus parasuis 29755]
          Length = 404

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 93/283 (32%), Positives = 157/283 (55%), Gaps = 11/283 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y V   ER V  RFGK  +++ LPGL+     ID V  V  IER  ++          +G
Sbjct: 95  YTVQEAERGVVTRFGK-LHEIVLPGLNWKPTFIDNVTPVN-IERVLEL--------RTNG 144

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
            +LT D+N+V +  +V Y + DP  YLF++  P ++LKQ ++SA+R V+G     DI  +
Sbjct: 145 SMLTQDENMVLVEMTVQYRIEDPAKYLFSVTKPDDSLKQATDSALRYVIGHMTMDDILTT 204

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  +  N ++  +  Y  G+LI  ++ + A PP EV  AFD+  +A++DE R + E
Sbjct: 205 GRAIVREKTWNALRDIIKNYDMGLLITDVNFQYARPPEEVKAAFDDAIKAQEDEQRLIRE 264

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+      ARG+A  I E + AYK++++  A+GE  RF  +  +Y  AP + R R+Y
Sbjct: 265 AEAYARGQEPIARGQAQRILEQANAYKEQVVLNARGEVQRFTQLLPEYKAAPEVTRDRLY 324

Query: 310 LETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFSRIQTKREIR 351
           ++TME ++K   K+++D    + +  LP++   ++  T   ++
Sbjct: 325 IQTMEKVMKNTPKLMVDSSNGNNLTVLPIDRLMAKSTTNEAVK 367


>gi|167470110|ref|ZP_02334814.1| HflK protein [Yersinia pestis FV-1]
          Length = 341

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 92/272 (33%), Positives = 154/272 (56%), Gaps = 10/272 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  R GK  + +  PGL+     ID+V  V V E  +++          SG
Sbjct: 18  YTIKEAERGVVTRLGKLSH-IVQPGLNWKPTFIDEVVPVNV-EAVRELAA--------SG 67

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YLF++ NP ++L+Q ++SA+R V+G+     I   
Sbjct: 68  VMLTSDENVVRVEMNVQYRVTDPAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTE 127

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  Y+ GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 128 GRTIVRSDTQRVLEETIRPYQMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 187

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  + E + AY  R + EAQGE   F  +  +Y  AP + R+R+Y
Sbjct: 188 AEAYTNEVQPRANGQAQRLLEDARAYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLY 247

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNEAF 341
           +ETME +L K  KV+ + K + +  LPL++  
Sbjct: 248 IETMEKVLGKTNKVLANDKGNNLMVLPLDQML 279


>gi|295098328|emb|CBK87418.1| protease FtsH subunit HflK [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
          Length = 419

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 96/271 (35%), Positives = 151/271 (55%), Gaps = 11/271 (4%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V  V V          S    + SG
Sbjct: 98  YTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDDVTAVNV---------ESVRELAASG 147

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YLF++ +  ++L+Q ++SA+R V+G+     I   
Sbjct: 148 VMLTSDENVVRVEMNVQYRVTDPERYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTE 207

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 208 GRTVIRSDTQRELEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 267

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK + I EAQGE  RF  I  +Y  AP + R+R+Y
Sbjct: 268 AEAYTNEVQPRANGQAQRILEEARAYKTQTILEAQGEVARFAKILPEYKAAPEITRERLY 327

Query: 310 LETMEGILKKAKKVII-DKKQSVMPYLPLNE 339
           +ETME +L   +KV++ D K   +  LPL++
Sbjct: 328 IETMEKVLSHTRKVLVNDNKGGNLMVLPLDQ 358


>gi|296100941|ref|YP_003611087.1| hypothetical protein ECL_00572 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295055400|gb|ADF60138.1| hypothetical protein ECL_00572 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 419

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 96/271 (35%), Positives = 151/271 (55%), Gaps = 11/271 (4%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V  V V          S    + SG
Sbjct: 98  YTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDDVTAVNV---------ESVRELAASG 147

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YLF++ +  ++L+Q ++SA+R V+G+     I   
Sbjct: 148 VMLTSDENVVRVEMNVQYRVTDPERYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTE 207

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 208 GRTVIRSDTQRELEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 267

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK + I EAQGE  RF  I  +Y  AP + R+R+Y
Sbjct: 268 AEAYANEVQPRANGQAQRILEEARAYKTQTILEAQGEVARFAKILPEYKAAPEITRERLY 327

Query: 310 LETMEGILKKAKKVII-DKKQSVMPYLPLNE 339
           +ETME +L   +KV++ D K   +  LPL++
Sbjct: 328 IETMEKVLSHTRKVLVNDSKGGNLMVLPLDQ 358


>gi|260912982|ref|ZP_05919467.1| FtsH protease regulator HflK [Pasteurella dagmatis ATCC 43325]
 gi|260632972|gb|EEX51138.1| FtsH protease regulator HflK [Pasteurella dagmatis ATCC 43325]
          Length = 416

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 94/291 (32%), Positives = 161/291 (55%), Gaps = 12/291 (4%)

Query: 51  GSVYIILLLIGSFC-AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVK 109
           G +  I++ IG+        Y +   ER V +RFG+  + +  PGL+     ID+V  V 
Sbjct: 87  GKLLPIVISIGAIVWGVSGFYTIKEAERGVVMRFGE-LHSIVQPGLNWRPNFIDRVVPVN 145

Query: 110 VIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
           V E+ +++           G +LT D+N+V +  +V Y V DP  YLF++ N  ++L Q 
Sbjct: 146 V-EQVKEL--------KTQGSMLTQDENMVKVEMTVQYRVHDPAKYLFSVTNADDSLNQA 196

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           ++SA+R V+G     DI  + R  +       +   ++ Y  G+ +  ++ + A PP EV
Sbjct: 197 TDSALRYVIGHMSMDDILTTGRSVVRENTWKTLNSIIESYDMGLEVVDVNFQSARPPEEV 256

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
            DAFD+  +A++DE R++ E+  Y+      ARG+A  I E + AYKDR++ +A+GE +R
Sbjct: 257 KDAFDDAIKAQEDEQRYIREAEAYAREREPIARGDAQRILEEATAYKDRVVLDAKGEVER 316

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNE 339
           F  +  ++  AP LLR+R+Y++TME ++    KV++D    + +  LPL +
Sbjct: 317 FQRLLPEFKLAPELLRERLYIQTMEKVMANTPKVMLDGNNGNNLTVLPLEQ 367


>gi|238757521|ref|ZP_04618706.1| hypothetical protein yaldo0001_30150 [Yersinia aldovae ATCC 35236]
 gi|238704283|gb|EEP96815.1| hypothetical protein yaldo0001_30150 [Yersinia aldovae ATCC 35236]
          Length = 424

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 91/270 (33%), Positives = 150/270 (55%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  R GK  + +  PGL+     ID+V  V V          S    + SG
Sbjct: 99  YTIKEAERGVVTRLGKLSH-IVQPGLNWKPTFIDEVTPVNV---------ESVRELAASG 148

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YLF++ NP ++L+Q ++SA+R V+G+     I   
Sbjct: 149 VMLTSDENVVRIEMNVQYRVTDPAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTE 208

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 209 GRTIVRSDTQRVLEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 268

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  + E + AY  R + EAQGE   F  +  +Y  AP + R+R+Y
Sbjct: 269 AEAYTNEVQPRANGQAQRLLEDARAYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLY 328

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+   K + +  LPL++
Sbjct: 329 IETMEKVLGHTRKVLASDKGNSLMVLPLDQ 358


>gi|332288713|ref|YP_004419565.1| FtsH protease regulator HflK [Gallibacterium anatis UMN179]
 gi|330431609|gb|AEC16668.1| FtsH protease regulator HflK [Gallibacterium anatis UMN179]
          Length = 414

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 95/293 (32%), Positives = 156/293 (53%), Gaps = 12/293 (4%)

Query: 48  KSYGSVYIILLLIGSFC-AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVE 106
           K +G + I  LL+          Y +   ER V LRFGK +  +  PGL+     ID V 
Sbjct: 79  KGFGKLAIFALLVAVIVWVVSGFYTIKEAERGVVLRFGKLEK-IVQPGLNWKPTFIDSVI 137

Query: 107 IVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
            V V ER  ++           G +LT D+N+V +  +V Y + DP  YLFN+ +P ++L
Sbjct: 138 PVNV-ERISEL--------KTQGSMLTQDENMVTVEMTVQYRIQDPARYLFNVVDPQDSL 188

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
            Q ++SA+R V+G     +I  + R  +       +   +  Y  G+ +  ++ + A PP
Sbjct: 189 SQATDSALRYVIGHMTMDNILTTGRSVVRERTWKSLNDIIKPYNMGLEVIDVNFQSARPP 248

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            EV DAFD+  +A++DE R + E+  Y+      ARG A  I E + AYK++++ +A+GE
Sbjct: 249 EEVKDAFDDAIKAQEDEQRLIREAEAYAREREPIARGNAQRIVEQATAYKEQVVLDAKGE 308

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           A+RF  +  ++   P LL+ R+YLE+ME ++    KV++D   ++   LPL +
Sbjct: 309 AERFAKLLPEFKANPELLKDRLYLESMEKVMAGTPKVLLDNSNNLT-VLPLEQ 360


>gi|212709955|ref|ZP_03318083.1| hypothetical protein PROVALCAL_01006 [Providencia alcalifaciens DSM
           30120]
 gi|212687364|gb|EEB46892.1| hypothetical protein PROVALCAL_01006 [Providencia alcalifaciens DSM
           30120]
          Length = 403

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 93/271 (34%), Positives = 154/271 (56%), Gaps = 12/271 (4%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV-IERQQKIGGRSASVGSNS 128
           Y +   +R V LRFG+  + +  PGL+     IDQV  V V   R+Q          + +
Sbjct: 91  YTIKESDRGVVLRFGE-YSGIVGPGLNWKPTFIDQVVPVNVETVREQ----------ATN 139

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           G++LT D+N++ +  +V Y VTDP  YLF++ NP  +L+Q  +SA+R V+G+     +  
Sbjct: 140 GMMLTSDENVIRVEMNVQYRVTDPAQYLFSVTNPDNSLRQALDSAVRGVIGQSAMEQVLT 199

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
           + R  I    +  ++ T+  YK GI +  ++ + A PP +V  AFD+V  A ++E + + 
Sbjct: 200 TNRAFIRDVTQKELEATIAPYKMGITLLDVNFQAARPPEDVKAAFDDVISAREEEQKTIR 259

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           E++ Y N VL  A+G A  + E + AYK  ++ +A+GE   F  +  +Y  AP + R+R+
Sbjct: 260 EAHAYRNEVLPLAKGNAQRMIEEAEAYKASVVFKAEGEVASFAKMLPEYRAAPEITRERL 319

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           Y+ETME +L   +KVI + K + M  LPL++
Sbjct: 320 YIETMERVLGNTRKVIANDKSNSMLVLPLDQ 350


>gi|82779444|ref|YP_405793.1| FtsH protease regulator HflK [Shigella dysenteriae Sd197]
 gi|309787678|ref|ZP_07682289.1| hflK protein [Shigella dysenteriae 1617]
 gi|81243592|gb|ABB64302.1| protease specific for phage lambda cII repressor [Shigella
           dysenteriae Sd197]
 gi|308924428|gb|EFP69924.1| hflK protein [Shigella dysenteriae 1617]
          Length = 419

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 92/272 (33%), Positives = 153/272 (56%), Gaps = 10/272 (3%)

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSN 127
             Y +   ER V  RFGK  + +  PGL+     ID+V+ V V          +    + 
Sbjct: 96  GFYTIKEAERGVVTRFGK-FSHLVEPGLNWKPTFIDEVKPVNV---------EAVRELAA 145

Query: 128 SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIF 187
           SG++LT D+N+V +  +V Y VT+P  YL+ + +P ++L+Q ++SA+R V+G+     I 
Sbjct: 146 SGVMLTSDENVVRVEMNVQYRVTNPEKYLYRVTSPDDSLRQATDSALRGVIGKYTMDRIL 205

Query: 188 RSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFV 247
              R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++
Sbjct: 206 TEGRTVIRSDTQRELEETIRPYDMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYI 265

Query: 248 EESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKR 307
            E+  Y+N V   A G+A  I E + AYK + I EAQGE  RF  +  +Y  AP + R+R
Sbjct: 266 REAEAYTNEVQPRANGQAQRILEEARAYKAQTILEAQGEVARFAKLLPEYKAAPEITRER 325

Query: 308 IYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +Y+ETME +L   +KV+++ K   +  LPL++
Sbjct: 326 LYIETMEKVLGNTRKVLVNDKGGNLMVLPLDQ 357


>gi|330445004|ref|ZP_08308658.1| putative membrane protease subunit [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328493122|dbj|GAA03155.1| putative membrane protease subunit [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 388

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 97/282 (34%), Positives = 151/282 (53%), Gaps = 13/282 (4%)

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASV 124
            F   Y +   E+ V LRFGK + +V  PGL+     ID+V  V V    Q I    AS 
Sbjct: 75  GFSGFYTIGEAEQGVVLRFGKVEKEV-QPGLNWKPTFIDEVIPVNV----QAIRSLRAS- 128

Query: 125 GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAV 184
               GL+LT D+N++ +   V Y V +   YLF++ N  ++L+Q ++SA+R V+G     
Sbjct: 129 ----GLMLTKDENVLKVEMDVQYRVDNAEKYLFSVTNADDSLRQATDSALRAVIGDSTMD 184

Query: 185 DIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDED 244
               + RQ I    +  I K +  Y  GI +  ++ + A PP  V DAFD+   A +DE+
Sbjct: 185 QALTTGRQTIRANTQTAIDKIIAKYDMGIRVVDVNFQSARPPEAVKDAFDDAIAAREDEE 244

Query: 245 RFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLL 304
           RFV E+  YSN +L  A G A  ++  +  Y +R++  A G+  +F  +  QY+ A  + 
Sbjct: 245 RFVREAEAYSNDILPKATGRAERLKNEAEGYSERVVNGALGDVAQFDKLLPQYLAAKDVT 304

Query: 305 RKRIYLETMEGILKKAKKVIIDKK---QSVMPYLPLNEAFSR 343
           R+R+YL+TME +     KV+ID K    + M Y+PL++  S+
Sbjct: 305 RERLYLDTMERVYSNTSKVLIDTKSGDSNNMMYIPLDKLMSQ 346


>gi|254442116|ref|ZP_05055592.1| HflK protein [Verrucomicrobiae bacterium DG1235]
 gi|198256424|gb|EDY80732.1| HflK protein [Verrucomicrobiae bacterium DG1235]
          Length = 319

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 102/309 (33%), Positives = 174/309 (56%), Gaps = 20/309 (6%)

Query: 46  FFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHM-MFWPIDQ 104
           F   +G V ++LL+   +  F S+Y V  + + V LRFGK   D   PGLH  M + IDQ
Sbjct: 12  FGGLFGIVIVVLLI---WAGFSSVYTVPAESQGVVLRFGK-YTDTVDPGLHFKMPFGIDQ 67

Query: 105 VEIVKVIER-QQKIGGRSASVGSNSGL------------ILTGDQNIVGLHFSVLYVVTD 151
           V +V+V  + +Q+ G  +      S              ++TGD N   + + V Y + D
Sbjct: 68  VSVVQVQRQLKQEFGFATQGATDRSQYSSSRREQSLERSMVTGDLNAATVEWIVQYRIQD 127

Query: 152 PRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKS 211
           P+ +LF + +P +TL+ +SES MR VVG R   ++    RQ+IA+E   ++Q  +D Y+ 
Sbjct: 128 PKQFLFEVRDPKDTLRDISESVMRTVVGDRTVDEVITVGRQEIAIEALRMMQTLVDRYEL 187

Query: 212 GILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRES 271
           G+ I+ + +++ +PP +V  +F+EV +A+Q+ +  +  +N   N+V+  A G A+   + 
Sbjct: 188 GLSIDLVQLQNVNPPDDVRPSFNEVNQAQQERENLINVANGEYNKVIPRAGGLANQAIQE 247

Query: 272 SIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKK-AKKVIIDK-KQ 329
           +  Y  + + EAQG+  RF ++  +YV AP + ++RIYLETM+ ++    KK+++D    
Sbjct: 248 AEGYALKRVNEAQGDVARFEAMLTEYVKAPEVTKRRIYLETMQEVVSGIEKKIVLDSDAS 307

Query: 330 SVMPYLPLN 338
           SV+P L L 
Sbjct: 308 SVLPLLQLT 316


>gi|238787541|ref|ZP_04631339.1| hypothetical protein yfred0001_20600 [Yersinia frederiksenii ATCC
           33641]
 gi|238724328|gb|EEQ15970.1| hypothetical protein yfred0001_20600 [Yersinia frederiksenii ATCC
           33641]
          Length = 424

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 91/270 (33%), Positives = 150/270 (55%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  R GK  + +  PGL+     ID V  V V          S    + SG
Sbjct: 99  YTIKEAERGVVTRLGKLSH-IVQPGLNWKPTFIDAVTPVNV---------ESVRELAASG 148

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YLF++ NP ++L+Q ++SA+R V+G+     I   
Sbjct: 149 VMLTSDENVVRIEMNVQYRVTDPAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTE 208

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 209 GRTIVRSDTQRVLEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 268

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  + E + AY  R + EAQGE   F  +  +Y  AP + R+R+Y
Sbjct: 269 AEAYTNEVQPRANGQAQRLLEDARAYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLY 328

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+ + K + +  LPL++
Sbjct: 329 IETMEKVLGHTRKVLANDKGNSLMVLPLDQ 358


>gi|330003346|ref|ZP_08304589.1| HflK protein [Klebsiella sp. MS 92-3]
 gi|328537008|gb|EGF63298.1| HflK protein [Klebsiella sp. MS 92-3]
          Length = 420

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 95/271 (35%), Positives = 151/271 (55%), Gaps = 11/271 (4%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V+ V V          S    + SG
Sbjct: 97  YTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDNVQAVNV---------ESVRELAASG 146

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V    +V Y VTDP  YLF++ +  ++L+Q ++SA+R V+G+     I   
Sbjct: 147 VMLTSDENVVRGEMNVQYRVTDPERYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTE 206

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 207 GRTVIRSDTQRELEETIRPYNMGITLLDVNFQTARPPEEVKAAFDDAIAARENEQQYIRE 266

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK + + EAQGE  RF  I  +Y  AP + R+R+Y
Sbjct: 267 AEAYTNEVQPRANGQAQRILEEARAYKTQTVLEAQGEVARFAKILPEYKAAPEITRERLY 326

Query: 310 LETMEGILKKAKKVII-DKKQSVMPYLPLNE 339
           +ETME +L   +KV++ D K   +  LPL++
Sbjct: 327 IETMEKVLSHTRKVLVNDSKNGNLMVLPLDQ 357


>gi|51594779|ref|YP_068970.1| FtsH protease regulator HflK [Yersinia pseudotuberculosis IP 32953]
 gi|153950662|ref|YP_001402605.1| FtsH protease regulator HflK [Yersinia pseudotuberculosis IP 31758]
 gi|170026011|ref|YP_001722516.1| FtsH protease regulator HflK [Yersinia pseudotuberculosis YPIII]
 gi|186893787|ref|YP_001870899.1| FtsH protease regulator HflK [Yersinia pseudotuberculosis PB1/+]
 gi|51588061|emb|CAH19667.1| putative membrane protein [Yersinia pseudotuberculosis IP 32953]
 gi|152962157|gb|ABS49618.1| HflK protein [Yersinia pseudotuberculosis IP 31758]
 gi|169752545|gb|ACA70063.1| HflK protein [Yersinia pseudotuberculosis YPIII]
 gi|186696813|gb|ACC87442.1| HflK protein [Yersinia pseudotuberculosis PB1/+]
          Length = 420

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 92/270 (34%), Positives = 154/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  R GK  + +  PGL+     ID+V  V V E  +++          SG
Sbjct: 97  YTIKEAERGVVTRLGKLSH-IVQPGLNWKPTFIDEVVPVNV-EAVRELAA--------SG 146

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YLF++ NP ++L+Q ++SA+R V+G+     I   
Sbjct: 147 VMLTSDENVVRVEMNVQYRVTDPAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTE 206

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  Y+ GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 207 GRTIVRSDTQRVLEETIRPYQMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 266

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  + E + AY  R + EAQGE   F  +  +Y  AP + R+R+Y
Sbjct: 267 AEAYTNEVQPRANGQAQRLLEDARAYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLY 326

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L K  KV+ + K + +  LPL++
Sbjct: 327 IETMEKVLGKTNKVLANDKGNNLMVLPLDQ 356


>gi|22124547|ref|NP_667970.1| FtsH protease regulator HflK [Yersinia pestis KIM 10]
 gi|45440385|ref|NP_991924.1| FtsH protease regulator HflK [Yersinia pestis biovar Microtus str.
           91001]
 gi|108809899|ref|YP_653815.1| FtsH protease regulator HflK [Yersinia pestis Antiqua]
 gi|108813456|ref|YP_649223.1| FtsH protease regulator HflK [Yersinia pestis Nepal516]
 gi|145600846|ref|YP_001164922.1| FtsH protease regulator HflK [Yersinia pestis Pestoides F]
 gi|150260581|ref|ZP_01917309.1| putative membrane protein [Yersinia pestis CA88-4125]
 gi|162418653|ref|YP_001605277.1| FtsH protease regulator HflK [Yersinia pestis Angola]
 gi|165926749|ref|ZP_02222581.1| HflK protein [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165936475|ref|ZP_02225043.1| HflK protein [Yersinia pestis biovar Orientalis str. IP275]
 gi|166011858|ref|ZP_02232756.1| HflK protein [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166214050|ref|ZP_02240085.1| HflK protein [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167400593|ref|ZP_02306102.1| HflK protein [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167419276|ref|ZP_02311029.1| HflK protein [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167423456|ref|ZP_02315209.1| HflK protein [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|218927578|ref|YP_002345453.1| FtsH protease regulator HflK [Yersinia pestis CO92]
 gi|229836635|ref|ZP_04456801.1| modulator for HflB protease specific for phage lambda cII repressor
           [Yersinia pestis Pestoides A]
 gi|229840247|ref|ZP_04460406.1| modulator for HflB protease specific for phage lambda cII repressor
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229842325|ref|ZP_04462480.1| modulator for HflB protease specific for phage lambda cII repressor
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229903936|ref|ZP_04519049.1| modulator for HflB protease specific for phage lambda cII repressor
           [Yersinia pestis Nepal516]
 gi|270489077|ref|ZP_06206151.1| HflK protein [Yersinia pestis KIM D27]
 gi|294502484|ref|YP_003566546.1| hypothetical protein YPZ3_0374 [Yersinia pestis Z176003]
 gi|21957346|gb|AAM84221.1|AE013666_1 putative protease specific for phage lambda cII repressor [Yersinia
           pestis KIM 10]
 gi|45435241|gb|AAS60801.1| putative membrane protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|108777104|gb|ABG19623.1| membrane protein [Yersinia pestis Nepal516]
 gi|108781812|gb|ABG15870.1| putative membrane protein [Yersinia pestis Antiqua]
 gi|115346189|emb|CAL19057.1| putative membrane protein [Yersinia pestis CO92]
 gi|145212542|gb|ABP41949.1| membrane protein [Yersinia pestis Pestoides F]
 gi|149289989|gb|EDM40066.1| putative membrane protein [Yersinia pestis CA88-4125]
 gi|162351468|gb|ABX85416.1| HflK protein [Yersinia pestis Angola]
 gi|165915591|gb|EDR34200.1| HflK protein [Yersinia pestis biovar Orientalis str. IP275]
 gi|165921372|gb|EDR38596.1| HflK protein [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165989217|gb|EDR41518.1| HflK protein [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166204845|gb|EDR49325.1| HflK protein [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166963270|gb|EDR59291.1| HflK protein [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167049961|gb|EDR61369.1| HflK protein [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167057626|gb|EDR67372.1| HflK protein [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|229679706|gb|EEO75809.1| modulator for HflB protease specific for phage lambda cII repressor
           [Yersinia pestis Nepal516]
 gi|229690635|gb|EEO82689.1| modulator for HflB protease specific for phage lambda cII repressor
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229696613|gb|EEO86660.1| modulator for HflB protease specific for phage lambda cII repressor
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229706319|gb|EEO92327.1| modulator for HflB protease specific for phage lambda cII repressor
           [Yersinia pestis Pestoides A]
 gi|262360514|gb|ACY57235.1| hypothetical protein YPD4_0326 [Yersinia pestis D106004]
 gi|262364462|gb|ACY61019.1| hypothetical protein YPD8_0329 [Yersinia pestis D182038]
 gi|270337581|gb|EFA48358.1| HflK protein [Yersinia pestis KIM D27]
 gi|294352943|gb|ADE63284.1| hypothetical protein YPZ3_0374 [Yersinia pestis Z176003]
 gi|320013759|gb|ADV97330.1| modulator for HflB protease specific for phage lambda cII repressor
           [Yersinia pestis biovar Medievalis str. Harbin 35]
          Length = 419

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 92/270 (34%), Positives = 154/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  R GK  + +  PGL+     ID+V  V V E  +++          SG
Sbjct: 96  YTIKEAERGVVTRLGKLSH-IVQPGLNWKPTFIDEVVPVNV-EAVRELAA--------SG 145

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YLF++ NP ++L+Q ++SA+R V+G+     I   
Sbjct: 146 VMLTSDENVVRVEMNVQYRVTDPAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTE 205

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  Y+ GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 206 GRTIVRSDTQRVLEETIRPYQMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 265

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  + E + AY  R + EAQGE   F  +  +Y  AP + R+R+Y
Sbjct: 266 AEAYTNEVQPRANGQAQRLLEDARAYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLY 325

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L K  KV+ + K + +  LPL++
Sbjct: 326 IETMEKVLGKTNKVLANDKGNNLMVLPLDQ 355


>gi|319427720|gb|ADV55794.1| HflK protein [Shewanella putrefaciens 200]
          Length = 380

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 108/345 (31%), Positives = 177/345 (51%), Gaps = 30/345 (8%)

Query: 4   DKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGS--------VYI 55
           +K N  W      G+ G  D  PP D++ + R +  +F      K  GS        + I
Sbjct: 8   NKGNDPW------GNKGGNDKGPP-DLDEVFRNLSKRFG----GKGTGSGQSFSSLSLII 56

Query: 56  ILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQ 115
           IL +  +       Y +   ER V LRFGK   ++  PGLH     ID++  V +     
Sbjct: 57  ILAIALAVWGLSGFYTIKEAERGVALRFGKHIGEIG-PGLHWKATFIDEIYPVDI----- 110

Query: 116 KIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMR 175
               +S      SG +LT D+N+V +   V Y + D   YLF+  +   +L++ ++SA+R
Sbjct: 111 ----QSVRSIPASGSMLTSDENVVKVELDVQYRILDAYSYLFSAVDANASLREATDSALR 166

Query: 176 EVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDE 235
            V+G     DI  + R  I  +    +++ ++ YK G+ +  ++   A PP EV DAFD+
Sbjct: 167 YVIGHNKMDDILTTGRDAIRRDTWKELERILEPYKLGLSVVDVNFLPARPPEEVKDAFDD 226

Query: 236 VQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYG 295
              A++DE RF+ E+  Y+  +   ARGE   + + + AYK+R I EA+G+  RF  +  
Sbjct: 227 AISAQEDEQRFIREAEAYAREIEPKARGEVERMAQQANAYKEREILEARGKVARFELLLP 286

Query: 296 QYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE 339
           +Y  +P + RKR+YL+TM+ ++    KV+ID K +  + YLPL++
Sbjct: 287 EYQASPEVTRKRLYLDTMQQVMTDTNKVLIDAKNNGNLMYLPLDK 331


>gi|94497742|ref|ZP_01304309.1| HflK protein [Sphingomonas sp. SKA58]
 gi|94422791|gb|EAT07825.1| HflK protein [Sphingomonas sp. SKA58]
          Length = 368

 Score =  156 bits (395), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 105/296 (35%), Positives = 153/296 (51%), Gaps = 32/296 (10%)

Query: 52  SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKV 110
           ++ IIL+L   +    S++ + P ER V    GK  +    PG+ +    P + V  V V
Sbjct: 90  AIGIILVL---WLLLTSVHRIGPQERGVVTFVGK-YSRTLSPGISLTLPAPFEAVTTVDV 145

Query: 111 IE-RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQV 169
            E R   IG  SA    +  L+LTGDQNI+ L +SV + + +P LYLF L +P +T+++V
Sbjct: 146 EEIRTIDIGSLSAE---SENLVLTGDQNIIDLAYSVRWNIRNPELYLFQLSDPDDTVREV 202

Query: 170 SESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREV 229
           +ESAMR V+      D   + R  I  +V   +Q+ +D YKSGI I  ++I+ A PP  V
Sbjct: 203 AESAMRAVLASVSLDDALGAGRTTIEQQVEQRMQEILDGYKSGIRIQGVAIKQADPPTAV 262

Query: 230 ADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADR 289
            DAF EV  A+Q    ++ E+                       A   ++  +AQGEA  
Sbjct: 263 NDAFKEVSAAQQTAQTYLNEAR----------------------AAAQQVTAKAQGEAAA 300

Query: 290 FLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQ 345
           F  +Y QY  AP + R+R+Y ETME +L    K I++   +V PYLPL E   R Q
Sbjct: 301 FDKVYEQYRLAPEVTRRRMYYETMESVLSDVDKTIVEGS-NVTPYLPLPEIKRRAQ 355


>gi|163749349|ref|ZP_02156598.1| hflK protein [Shewanella benthica KT99]
 gi|161331068|gb|EDQ01994.1| hflK protein [Shewanella benthica KT99]
          Length = 380

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 101/340 (29%), Positives = 177/340 (52%), Gaps = 18/340 (5%)

Query: 19  NGNGDGLPPFDVEAIIRYIKDKFDLI------PFFKSYGSVYIILLLIGSFCAFQSIYIV 72
           N +G+   P D++ + R +  +F         P F S+  + ++ + +         Y V
Sbjct: 17  NKSGNDKGPPDLDEVFRNLSKRFGGGKGNGKGPVFSSFALILVLGIAV-VVWGLSGFYTV 75

Query: 73  HPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLIL 132
              E+ V LRFG+   +V  PGL      ID+V  V V          +      SG +L
Sbjct: 76  KEAEKGVALRFGQYIGEVD-PGLQWKATFIDEVIPVNV---------HTVRSIPASGSML 125

Query: 133 TGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQ 192
           T D+N+V +   V Y VT+   +LF+  +   +L++ ++SA+R V+G     DI  + R 
Sbjct: 126 TTDENVVLVELDVQYRVTNAYNFLFSAVDANASLREATDSALRYVIGHNSMDDILTTGRD 185

Query: 193 QIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNK 252
           +I ++  + +++ ++ YK GI I  ++   A PP EV  +FD+   A++DE RF+ E+  
Sbjct: 186 KIRVDTWSEVERIIEPYKLGITIVDVNFLPARPPEEVKASFDDAISAQEDEQRFIREAEA 245

Query: 253 YSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLET 312
           Y+  +   ARG+   + + + AYK+R + EA+G+  RF  +  +Y  AP + R+R+YL+ 
Sbjct: 246 YARAIEPKARGQVKRMEQQARAYKEREVLEARGKVARFNLLLPEYKAAPHVTRERLYLDA 305

Query: 313 MEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQTKREIR 351
           M+ +L    KV++D K S  M YLPL++   + Q+  + R
Sbjct: 306 MQIVLSGTSKVLVDTKNSNNMMYLPLDKLMQKSQSNTQPR 345


>gi|317049754|ref|YP_004117402.1| HflK protein [Pantoea sp. At-9b]
 gi|316951371|gb|ADU70846.1| HflK protein [Pantoea sp. At-9b]
          Length = 412

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 93/270 (34%), Positives = 152/270 (56%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID V+ V V E  +++          SG
Sbjct: 92  YTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDHVQAVNV-EAVRELAA--------SG 141

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YLF + +  ++L+Q ++SA+R V+GR     I   
Sbjct: 142 VMLTSDENVVRVEMNVQYRVTDPERYLFAVTSADDSLRQATDSALRGVIGRSTMDRILTE 201

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  E +  I +T+  Y  GI +  ++ + A PP EV  +FD+   A ++ +++V E
Sbjct: 202 GRTVVRSETQREIDETIRPYNMGITLLDVNFQAARPPEEVKASFDDAIAARENREQYVRE 261

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E S AYK R + EAQGE  RF  +  +Y  AP + ++R+Y
Sbjct: 262 AEAYANEVQPRANGQAQRILEESRAYKARTVLEAQGEVARFALMLPEYKAAPQITKERLY 321

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +E+ME +L   +KV++  + + +  LPL++
Sbjct: 322 IESMERVLSHTRKVLVSDRSNNLMVLPLDQ 351


>gi|311281274|ref|YP_003943505.1| HflK protein [Enterobacter cloacae SCF1]
 gi|308750469|gb|ADO50221.1| HflK protein [Enterobacter cloacae SCF1]
          Length = 421

 Score =  156 bits (394), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 96/271 (35%), Positives = 155/271 (57%), Gaps = 11/271 (4%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID+V  V V E  +++          SG
Sbjct: 98  YTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDEVTPVNV-EAVRELAA--------SG 147

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP+ YLF++ +  ++L+Q ++SA+R V+G+     I   
Sbjct: 148 VMLTSDENVVRVEMNVQYRVTDPQRYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTE 207

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 208 GRTVIRSDTQRELEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 267

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK + I EAQGE  RF  I  +Y  AP + R+R+Y
Sbjct: 268 AEAYTNEVQPRANGQAQRILEEARAYKTQTILEAQGEVARFAKILPEYKAAPEITRERLY 327

Query: 310 LETMEGILKKAKKVII-DKKQSVMPYLPLNE 339
           +ETME +L   +KV++ D K   +  LPL++
Sbjct: 328 IETMEKVLSHTRKVLVNDNKGGNLMVLPLDQ 358


>gi|283786853|ref|YP_003366718.1| HflK protein [Citrobacter rodentium ICC168]
 gi|282950307|emb|CBG89954.1| HflK protein [Citrobacter rodentium ICC168]
          Length = 418

 Score =  155 bits (393), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 92/270 (34%), Positives = 155/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID+V  V V E  +++          SG
Sbjct: 98  YTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDEVTPVNV-EAVRELAA--------SG 147

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N++ +  +V Y +TDP+ YLF++ +  ++L+Q ++SA+R V+G+     I   
Sbjct: 148 VMLTSDENVMRVEMNVQYRITDPQKYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTE 207

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP EV  +FD+   A ++E +++ E
Sbjct: 208 GRTVIRSDTQRELEETIRPYNMGITLLDVNFQAARPPEEVKASFDDAIAARENEQQYIRE 267

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK + I EAQGE  RF  I  +Y  AP + R+R+Y
Sbjct: 268 AEAYTNEVQPRANGQAQRILEEARAYKTQTILEAQGEVARFAKILPEYKAAPEITRERLY 327

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K   +  LPL++
Sbjct: 328 IETMEKVLSHTRKVLVNDKGGNLMVLPLDQ 357


>gi|109900279|ref|YP_663534.1| HflK protein [Pseudoalteromonas atlantica T6c]
 gi|109702560|gb|ABG42480.1| protease FtsH subunit HflK [Pseudoalteromonas atlantica T6c]
          Length = 382

 Score =  155 bits (393), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 100/275 (36%), Positives = 150/275 (54%), Gaps = 11/275 (4%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V LRFG+  + V  PGL      +D V  V V         ++     +SG
Sbjct: 75  YTIREAERGVVLRFGEFSHFV-EPGLRWKPTFVDSVLPVDV---------QTVRSLPSSG 124

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
            +LT D+N+V +   V Y + +P  Y F++ +P  +L Q  +SA+R VVG     DI  S
Sbjct: 125 SMLTEDENVVRVEMEVQYRILEPYKYSFSVTSPETSLSQAFDSAIRYVVGHSKMDDILTS 184

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R+     VR+ +Q  ++ Y  GI I  ++ +DA PP EV  AFD+   A++DE RF+ E
Sbjct: 185 GREVARQNVRDELQAILEPYDMGISIVDMNFKDARPPEEVKAAFDDAIAAQEDEQRFINE 244

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  YS  +   ARG+ + + E + AYK++ I +AQGE  RF  +  QY  AP + R RIY
Sbjct: 245 AEAYSREIEPRARGQVNRMAEEAQAYKEQSILQAQGEVARFEELLPQYKAAPEVTRSRIY 304

Query: 310 LETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSR 343
           LET+E +     K+++D K S  M YLPL++   +
Sbjct: 305 LETLEEVYANTSKIMVDTKGSGNMLYLPLDKILEK 339


>gi|332185446|ref|ZP_08387194.1| hflK protein [Sphingomonas sp. S17]
 gi|332014424|gb|EGI56481.1| hflK protein [Sphingomonas sp. S17]
          Length = 337

 Score =  155 bits (393), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 95/281 (33%), Positives = 149/281 (53%), Gaps = 29/281 (10%)

Query: 58  LLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIERQQK 116
           +L+G +  + SI+ + P +R V   FG+    +  PG+ +    PI  V ++ V    QK
Sbjct: 56  ILVGIWVLYTSIHPIGPQQRGVVTYFGR-YTGILEPGIQLTAPAPIASVRVLDV----QK 110

Query: 117 IGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMRE 176
           I   +   GS   L+LTGDQNI+ L +SV + + +PR + F L  P ET++  +ESAMR 
Sbjct: 111 IRTENFPEGSGENLVLTGDQNIIDLTYSVRWDIANPRDFAFRLAQPQETVRAAAESAMRA 170

Query: 177 VVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEV 236
           V+          S R  I   V++L Q  ++ Y SG+ I  ++I+ A+PP ++ D F++V
Sbjct: 171 VIADTTLDQALGSGRTGIEQRVQDLTQSILNEYYSGVRIQGVAIKQATPPAQIVDDFNKV 230

Query: 237 QRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQ 296
             A+Q+    V ++  Y+ +V                      I  AQGEA +F  +Y Q
Sbjct: 231 TAAQQEAVANVNQARSYAQQV----------------------IARAQGEAAQFDKVYEQ 268

Query: 297 YVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPL 337
           Y  AP + R+R+Y ETME +L K+ K I++    V+PYLPL
Sbjct: 269 YRLAPEVTRRRMYYETMEAVLAKSDKTIVETP-GVVPYLPL 308


>gi|301155776|emb|CBW15244.1| modulator for HflB protease specific for phage lambda cII repressor
           [Haemophilus parainfluenzae T3T1]
          Length = 413

 Score =  155 bits (393), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 98/303 (32%), Positives = 160/303 (52%), Gaps = 15/303 (4%)

Query: 44  IPFFKSYGSVYIILLLIGSFC-AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPI 102
           IP F + G +  I  +IG         Y +   ER V LRFG+  + V  PGL+     I
Sbjct: 77  IPSF-NLGKILPIAAVIGGIIWGASGFYTIKEAERGVTLRFGEFHSTV-QPGLNWKPTFI 134

Query: 103 DQVEIVKVIE-RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161
           D+V  V V + R+ K            G +LT D+N+V +  +V Y V +P  YLF++ N
Sbjct: 135 DKVVPVNVEQVRELKT----------QGAMLTKDENMVKVEMTVQYRVQNPEKYLFSVSN 184

Query: 162 PGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIE 221
              +L Q ++SA+R V+G     DI  + R  +       +   +  Y  G+ +  ++ +
Sbjct: 185 ADNSLGQATDSALRYVIGHMTMNDILTTGRAVVRENTWKALNDIIKPYDMGLEVIDVNFQ 244

Query: 222 DASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQ 281
            A PP EV DAFD+  +A++DE R++ E+  Y+      ARG+A  I E + AYKDR++ 
Sbjct: 245 SARPPEEVKDAFDDAIKAQEDEQRYIREAEAYAREKEPIARGDAQRIIEEATAYKDRVVL 304

Query: 282 EAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEA 340
           +AQGE +R   +  ++  AP LL++R+Y++TME ++    KV++D    + +  LPL + 
Sbjct: 305 DAQGEVERLQRLLPEFKAAPDLLKERLYIQTMEKVMANTPKVMLDANNGNNLTVLPLEQL 364

Query: 341 FSR 343
             +
Sbjct: 365 MGK 367


>gi|312796100|ref|YP_004029022.1| Protease activity modulator HflK [Burkholderia rhizoxinica HKI 454]
 gi|312167875|emb|CBW74878.1| Protease activity modulator HflK [Burkholderia rhizoxinica HKI 454]
          Length = 450

 Score =  155 bits (393), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 96/285 (33%), Positives = 170/285 (59%), Gaps = 14/285 (4%)

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLHMMF---WPIDQVEIVKVIE-RQQKIGG---- 119
            +YIV   +  V L+FGK K   +  G  + +   +P    EIV + + R  +IG     
Sbjct: 111 GVYIVQEGQAGVVLQFGKYK---YTTGAGIQWRLPYPFQSNEIVNMSQVRSVEIGRDNMI 167

Query: 120 RSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVG 179
           RS ++   S  +LT D+NI+ + F+V Y V DP  +LF+  +   T+ Q +E+A+RE+VG
Sbjct: 168 RSTNLKDMS--MLTKDENIIDVRFAVQYRVKDPAAFLFHNVDAEGTVTQAAETAVREIVG 225

Query: 180 RRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRA 239
           +     +    R+Q+AL++   IQ+ +D YK+GI++++++++   PP++V  AFD+  +A
Sbjct: 226 KNTMDYVLYEGREQVALQLSQQIQRILDQYKTGIIVSSVTMQSVQPPQQVQSAFDDAVKA 285

Query: 240 EQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVN 299
            QD +R   E+  Y+N V+  A+G A+ +   +  Y+ R++ +A+G+A RF  +  +Y  
Sbjct: 286 GQDRERAKNEALAYANNVVPLAQGTAARMVADAHGYRARVVAQAEGDAARFKQVQAEYAK 345

Query: 300 APTLLRKRIYLETMEGILKKAKKVIIDKKQSV-MPYLPLNEAFSR 343
           AP + R+R+YL+TM+ +   A KVI+D K S  + YLPL++  ++
Sbjct: 346 APAVTRERMYLDTMQQVYSNATKVIVDSKASSNLLYLPLDKVLAQ 390


>gi|146310022|ref|YP_001175096.1| FtsH protease regulator HflK [Enterobacter sp. 638]
 gi|145316898|gb|ABP59045.1| protease FtsH subunit HflK [Enterobacter sp. 638]
          Length = 421

 Score =  155 bits (393), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 93/271 (34%), Positives = 152/271 (56%), Gaps = 11/271 (4%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     +D V  V V          S    + SG
Sbjct: 99  YTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFVDNVTAVNV---------ESVRELAASG 148

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP+ YLF++ +  ++L+Q ++SA+R V+G+     I   
Sbjct: 149 VMLTSDENVVRVEMNVQYRVTDPKNYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTE 208

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 209 GRTVIRSDTQRELEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAISARENEQQYIRE 268

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  I E + AYK + + EAQGE  RF  +  +Y  AP + R+R+Y
Sbjct: 269 AEAYTNEVQPRANGQAQRILEEARAYKTQTVLEAQGEVARFAKLLPEYKAAPEITRERLY 328

Query: 310 LETMEGILKKAKKVII-DKKQSVMPYLPLNE 339
           +ETME +L   +KV++ D K   +  LPL++
Sbjct: 329 IETMEKVLSHTRKVLVNDSKGGNLMVLPLDQ 359


>gi|261345213|ref|ZP_05972857.1| HflK protein [Providencia rustigianii DSM 4541]
 gi|282566907|gb|EFB72442.1| HflK protein [Providencia rustigianii DSM 4541]
          Length = 402

 Score =  155 bits (392), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 92/271 (33%), Positives = 153/271 (56%), Gaps = 12/271 (4%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV-IERQQKIGGRSASVGSNS 128
           Y +   +R V LRFG+  N +  PGL+     ID V  V V   R+Q          + +
Sbjct: 91  YTIKESDRGVVLRFGE-YNGIVGPGLNWKPTFIDNVVPVNVETVREQ----------ATN 139

Query: 129 GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFR 188
           G++LT D+N++ +  +V Y VTDP  YLF++ NP  +L+Q  +SA+R V+G+     +  
Sbjct: 140 GMMLTSDENVIRVEMNVQYRVTDPAQYLFSVTNPDNSLRQALDSAVRGVIGQSAMEQVLT 199

Query: 189 SQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVE 248
           + R  I    +  ++ T+  YK GI +  ++ + A PP +V  AFD+V  A ++E + + 
Sbjct: 200 TNRAFIRDVTQKELEATIAPYKMGITLLDVNFQAARPPEDVKAAFDDVISAREEEQKTIR 259

Query: 249 ESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRI 308
           +++ Y N VL  A+G A  + E + AYK  ++ +A+GE   F  +  +Y  AP + R+R+
Sbjct: 260 QAHAYRNEVLPLAKGNAQKMIEEAEAYKASVVFKAEGEVASFAKMLPEYRAAPEITRERL 319

Query: 309 YLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           Y+ETME +L   +KVI + K + M  LPL++
Sbjct: 320 YIETMERVLANTRKVIANDKSNSMLVLPLDQ 350


>gi|331005112|ref|ZP_08328515.1| HflK protein [gamma proteobacterium IMCC1989]
 gi|330421081|gb|EGG95344.1| HflK protein [gamma proteobacterium IMCC1989]
          Length = 385

 Score =  155 bits (392), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 92/289 (31%), Positives = 166/289 (57%), Gaps = 15/289 (5%)

Query: 52  SVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVI 111
            + I+ L+ G F     IY +   ++AV LR GK  + +   GLH     ID+V    V 
Sbjct: 64  GLVIVALVYGVF----GIYQLDEQKQAVVLRLGK-FHSIVGAGLHWNPPLIDEVIEHNVT 118

Query: 112 ERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSE 171
             +Q + G         GL+LT D++IV +  ++ Y + D + ++ N+ +P  +L+  S+
Sbjct: 119 GERQYVAG---------GLMLTEDESIVEVPVTIQYNIADIKAFVLNVNSPVVSLEHASD 169

Query: 172 SAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVAD 231
           SA+R VVG      +    R +IA E+R  +Q+ ++ Y +GI I  +++++  PP  V D
Sbjct: 170 SALRHVVGSTELNQVLSEGRGKIATEMRQRLQEYLESYGTGINIVGVNLQEGKPPAAVKD 229

Query: 232 AFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFL 291
           AFD+V +A++D++R   ++  Y+N ++  ARG A    E + AY+D++I  A+GE++RF 
Sbjct: 230 AFDDVVKAKEDQERLKNQAQSYANGIVPEARGLAQRTIEEANAYRDQVIARAEGESERFN 289

Query: 292 SIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID-KKQSVMPYLPLNE 339
            +   Y  AP + R+R+Y++ +E ++  + KV++D +  + M YLPL++
Sbjct: 290 QLLTAYSQAPKVTRERLYIDAIESVMANSSKVLVDVEGGNNMMYLPLDK 338


>gi|148284995|ref|YP_001249085.1| putative membrane bound protease protein [Orientia tsutsugamushi
           str. Boryong]
 gi|146740434|emb|CAM80930.1| putative membrane bound protease protein [Orientia tsutsugamushi
           str. Boryong]
          Length = 349

 Score =  155 bits (392), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 101/328 (30%), Positives = 177/328 (53%), Gaps = 31/328 (9%)

Query: 38  KDKFDL-IPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLH 96
           K+ F L + F  S  ++ I++  I        +Y V+  E A+ +RFG+     + PGL+
Sbjct: 18  KNNFFLPVNFSFSIKTMLILIFTIAVIWLLSGVYKVNEGEEAIVIRFGEYVRKAY-PGLN 76

Query: 97  MMF-WPIDQVEIVKV-IERQQKIGGRSA----SVGSNSG--------------------- 129
                P+++V I +V + RQ ++G  S        +N+G                     
Sbjct: 77  YHLPHPLEKVIIERVKMSRQTEVGYSSGQSRREANTNNGSYMVYSYRLNNRTINNQHLGE 136

Query: 130 --LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIF 187
              +LTGD+NIV L+ +V + + D   ++FN+  P ET+K V+ESA+REV+       I 
Sbjct: 137 SSTMLTGDENIVELNCNVRWHIKDLYSFVFNVAFPEETVKIVAESAIREVISETPIASIL 196

Query: 188 RSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFV 247
            +Q+Q+IA ++  LIQ+ ++ Y  GI I  + +  A PP EV DA+ +VQ +  D++R +
Sbjct: 197 SNQKQEIADKIEKLIQQILNQYSIGIEIEKVQLLKAEPPSEVIDAYRDVQTSRADKEREI 256

Query: 248 EESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKR 307
            ++  Y N  +  ARG+A+ + E +  YK   + +A GEA +F +I  +Y     + ++R
Sbjct: 257 NQAQAYRNDKIPEARGKAAKLIEEAKGYKQATVSKALGEAQKFNAILVEYKLNKEITKER 316

Query: 308 IYLETMEGILKKAKKVIIDKKQSVMPYL 335
           +YL T+E IL+ +KK+II  +  ++P++
Sbjct: 317 LYLNTIETILQGSKKIIISDESKLLPHM 344


>gi|154249389|ref|YP_001410214.1| HflK protein [Fervidobacterium nodosum Rt17-B1]
 gi|154153325|gb|ABS60557.1| HflK protein [Fervidobacterium nodosum Rt17-B1]
          Length = 306

 Score =  155 bits (392), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 93/280 (33%), Positives = 160/280 (57%), Gaps = 12/280 (4%)

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE-RQQKIGGRSASVGS 126
           ++ V+P E A+   FGK    V  PG+H+    P     IV V   R+++IG R+  VG 
Sbjct: 23  VFQVNPSEVALIKTFGKFTGTVG-PGIHIHAPIPFQSHVIVDVQTIRKEEIGFRT--VGD 79

Query: 127 NS-------GLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVG 179
                     L+LT D NIV +   V Y V+DP  + F +++P   +K  +ESA+R+ + 
Sbjct: 80  RKYESRDVEALMLTADGNIVSVEAVVSYKVSDPVKFAFRIKDPSNLVKFTTESALRDRIS 139

Query: 180 RRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRA 239
           +R   DI   +R+++A EV  ++Q  +D Y++G+ I  + +++  PP EV  AFD+V  A
Sbjct: 140 KRNVDDILTQEREKVADEVLEIVQNLLDKYQAGVKIVNVLLQEVVPPAEVVSAFDDVNNA 199

Query: 240 EQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVN 299
           +QD++R++ E+NKY+N ++    GEA  I   + +Y  + + +AQGE  R+L++  +Y  
Sbjct: 200 KQDKERYINEANKYANNLIPKVEGEALKIVLEAESYAQQQVLKAQGETQRYLALLEEYRK 259

Query: 300 APTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           AP +   R+ L T++ +L KAKK+++      +  L L++
Sbjct: 260 APMITETRLRLSTLQEVLPKAKKIMVMDNSQKITVLSLDQ 299


>gi|212633666|ref|YP_002310191.1| HflK protein [Shewanella piezotolerans WP3]
 gi|212555150|gb|ACJ27604.1| HflK [Shewanella piezotolerans WP3]
          Length = 379

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 106/328 (32%), Positives = 172/328 (52%), Gaps = 16/328 (4%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFK----SYGSVYIILLLIGSFCAFQSIYIV 72
           G  G  D  PP D++ + R +  +F           S  S+ I+L +          Y V
Sbjct: 15  GKKGGNDKGPP-DLDEVFRNLSKRFGGKGNGSGNGISSMSLVIVLAIAVVVWGLSGFYTV 73

Query: 73  HPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSGLIL 132
              E+ VELRFG    +V  PGL      ID+V  V V    Q +    AS     G +L
Sbjct: 74  KEAEKGVELRFGGYIGEVD-PGLQWKATFIDEVTPVNV----QTVRSIPAS-----GSML 123

Query: 133 TGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQ 192
           T D+N+V +   V + V + + YL+++ +   +L++ ++SA+R V+G     DI  + R 
Sbjct: 124 TADENVVLVQLDVQFRVNNAKNYLYSVVDADASLREATDSALRYVIGHNTMDDILTTGRD 183

Query: 193 QIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNK 252
           +I  +  N I++ ++ Y+ GI+I  ++   A PP EV DAFD+   A++DE RF+ E+  
Sbjct: 184 KIRRDTWNEIERIIEPYQLGIVIVDVNFLPARPPEEVKDAFDDAIAAQEDEQRFIREAEA 243

Query: 253 YSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLET 312
           YS ++    RG    + + + AYK R+  EAQG+  RF  +  +Y  AP + R+R+Y +T
Sbjct: 244 YSRQLEPKVRGTVQRMDQQAKAYKQRVTLEAQGKVARFEQLLPEYQAAPDVTRERMYFDT 303

Query: 313 MEGILKKAKKVIIDKKQS-VMPYLPLNE 339
           M+ ++    KV+ID K S  + YLPL++
Sbjct: 304 MQEVMSGTSKVLIDAKNSGNLMYLPLDK 331


>gi|82546585|ref|YP_410532.1| FtsH protease regulator HflK [Shigella boydii Sb227]
 gi|81247996|gb|ABB68704.1| protease specific for phage lambda cII repressor [Shigella boydii
           Sb227]
 gi|320187052|gb|EFW61763.1| HflK protein [Shigella flexneri CDC 796-83]
 gi|332087109|gb|EGI92243.1| hflK protein [Shigella boydii 3594-74]
          Length = 419

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 92/272 (33%), Positives = 153/272 (56%), Gaps = 10/272 (3%)

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSN 127
             Y +   ER V  RFGK  + +  PGL+     ID+V+ V V          +    + 
Sbjct: 96  GFYTIKEAERGVVTRFGK-FSHLVEPGLNWKPTFIDEVKPVNV---------EAVRELAA 145

Query: 128 SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIF 187
           SG++LT D+N+V +  +V Y VT P  YL+++ +P ++L+Q ++SA+R V+G+     I 
Sbjct: 146 SGVMLTSDENVVRVEMNVQYRVTYPEKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRIL 205

Query: 188 RSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFV 247
              R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++
Sbjct: 206 TEGRTVIRSDTQRELEETIRPYDMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYI 265

Query: 248 EESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKR 307
            E+  Y+N V   A G+A  I E + AYK + I EAQGE  RF  +  +Y  AP + R+R
Sbjct: 266 REAEAYTNEVQPRANGQAQRILEEARAYKAQTILEAQGEVARFAKLLPEYKAAPEITRER 325

Query: 308 IYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +Y+ETME +L   +KV+++ K   +  LPL++
Sbjct: 326 LYIETMEKVLGNTRKVLVNDKGGNLMVLPLDQ 357


>gi|108758403|ref|YP_631374.1| HflK protein [Myxococcus xanthus DK 1622]
 gi|108462283|gb|ABF87468.1| HflK protein [Myxococcus xanthus DK 1622]
          Length = 356

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 104/286 (36%), Positives = 161/286 (56%), Gaps = 26/286 (9%)

Query: 72  VHPDERAVELRFGKPKNDVFLPGLH--MMFWPIDQVEIVKV-IERQQK--IGGRSASVGS 126
           V PDE  V LR G+    V  PG H  M FW +D+  IVKV ++RQ K   G R+ +  S
Sbjct: 56  VEPDEVGVILRLGRFVGTVE-PGPHFRMPFW-VDR--IVKVPVQRQLKAEFGFRTEASRS 111

Query: 127 NSG--------------LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
             G              L+LTGD N+  + + V Y + DP  YLF ++N    L+ +SE+
Sbjct: 112 RMGSAYAAESSDTKRESLMLTGDLNVAVVEWIVQYKIKDPYKYLFKVKNVESMLRDISEA 171

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           +MR VVG     ++  + RQ +A + + L+Q   D Y++G+ I  + ++D +PP  V  +
Sbjct: 172 SMRAVVGDHSVNEVLTTGRQAVATQAKLLLQDLADRYETGVDIQQVVLQDVNPPDPVKPS 231

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           F+EV +A Q+++R + E+    NRV+  A+GEA     S+  Y    +  A+GEADRF  
Sbjct: 232 FNEVNQAIQEKERVINEAYAELNRVIPRAKGEAEEALRSAEGYAIERVNRAKGEADRFAR 291

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKA-KKVIIDKKQSVMPYLPL 337
           +Y +Y  AP + R+R+YLET+  +L+ A +KV++D  +SV    PL
Sbjct: 292 VYEEYRKAPDVTRRRMYLETVSQVLRSAGQKVVLD--ESVKGLTPL 335


>gi|167625538|ref|YP_001675832.1| HflK protein [Shewanella halifaxensis HAW-EB4]
 gi|167355560|gb|ABZ78173.1| HflK protein [Shewanella halifaxensis HAW-EB4]
          Length = 381

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 95/285 (33%), Positives = 153/285 (53%), Gaps = 11/285 (3%)

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASV 124
                Y +   E+ VELRFG    +V  PGL      ID+V  V V    Q +    AS 
Sbjct: 66  GLSGFYTIKEAEKGVELRFGAYIGEVD-PGLQWKATFIDEVTPVNV----QTVRSIPAS- 119

Query: 125 GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAV 184
               G +LT D+N+V +   V Y V +   YL+++ +   +L++ ++SA+R V+G     
Sbjct: 120 ----GSMLTADENVVLVQLDVQYRVNNAENYLYSVVDADASLREATDSALRYVIGHNTMD 175

Query: 185 DIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDED 244
           DI  + R +I  +  + I++ +  YK GI++  ++   A PP EV DAFD+   A++DE 
Sbjct: 176 DILTTGRDKIRRDTWDEIERIIKPYKLGIMVVDVNFLPARPPEEVKDAFDDAIAAQEDEQ 235

Query: 245 RFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLL 304
           RF+ E+  YS ++    RG    + + +IAYK ++  EAQG+  RF  +  +Y  AP + 
Sbjct: 236 RFIREAEAYSRQLEPKVRGTVQRMDQQAIAYKQKVTLEAQGKVARFNQLLPEYQAAPEVT 295

Query: 305 RKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQTKR 348
           R+R+Y +TM+ I+    KV+ID K S  + YLPL++     Q  +
Sbjct: 296 RERMYFDTMQEIMSGTSKVLIDAKNSGNLMYLPLDKLMQNSQAHK 340


>gi|198283669|ref|YP_002219990.1| HflK protein [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218667451|ref|YP_002426300.1| hflK protein [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198248190|gb|ACH83783.1| HflK protein [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218519664|gb|ACK80250.1| hflK protein [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 397

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 102/325 (31%), Positives = 177/325 (54%), Gaps = 31/325 (9%)

Query: 26  PPFDVEAIIRYIKD---------------KFD-----LIPFFKSYGSVYIILLLIGSFCA 65
           P FD++ I R +K                K D     L+PF      V  +L+L   F  
Sbjct: 27  PVFDIQKITRELKKLGGIFGSGGGRSGGPKMDYKWLHLLPFL-----VIAVLIL---FWF 78

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHM-MFWPIDQVEIVKVIERQQKIGGRSASV 124
              IY+V P E  V LRFG+ +  +  PGLH  + +P ++V ++KV + ++ + G S + 
Sbjct: 79  ASGIYVVGPGEEGVVLRFGR-EVGISQPGLHYRLPFPFERVYLLKVAQSRRLVLGYSGAA 137

Query: 125 GS-NSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFA 183
            + N G++LT D+++V + F+V Y + +   YLF   NP + +   +ESAMREVVGR   
Sbjct: 138 DTRNPGMMLTVDESVVDVRFAVQYRIANAGDYLFATANPDQLISFCAESAMREVVGRSKI 197

Query: 184 VDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDE 243
             +  S +  I  +V+ + Q  +  Y +G+ ++++ + + +PP+ V  AF +V +A +D 
Sbjct: 198 DSLLTSGKGDIQQQVQQITQNLLSRYHAGVSVDSVQLLEVTPPKVVQPAFADVVKAREDM 257

Query: 244 DRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTL 303
           +R  +E+  Y+N V+  A GEA+ +  ++  YK +++  A+G++ RF  I   Y   P +
Sbjct: 258 ERTRDEAQAYANAVVPKATGEAAAMVTNAEGYKQQMVDRAKGDSARFTDILQAYQKNPKV 317

Query: 304 LRKRIYLETMEGILKKAKKVIIDKK 328
           + +R+YL TM+ IL    KVI++ K
Sbjct: 318 VSERMYLRTMQDILSHTPKVIVESK 342


>gi|268592878|ref|ZP_06127099.1| HflK protein [Providencia rettgeri DSM 1131]
 gi|291311668|gb|EFE52121.1| HflK protein [Providencia rettgeri DSM 1131]
          Length = 401

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 94/286 (32%), Positives = 158/286 (55%), Gaps = 12/286 (4%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV-IER 113
           + L  I    A    Y +   +R V LRFG+  + +  PGL+     ID+V  V V   R
Sbjct: 75  LALAAIVVVWAGSGFYTIKESDRGVVLRFGE-YSGIVGPGLNWKPTFIDRVIPVNVETVR 133

Query: 114 QQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESA 173
           +Q          + +G++LT D+N++ +  +V Y VTDP  YLF++ NP  +L+Q  +SA
Sbjct: 134 EQ----------ATNGMMLTSDENVIRVEMNVQYRVTDPAQYLFSVTNPDNSLRQALDSA 183

Query: 174 MREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAF 233
           +R V+G+     +  + R  I    +  ++ T+  YK GI +  ++ + A PP +V  AF
Sbjct: 184 VRGVIGQSAMEQVLTTNRAFIRDVTQKELEATIAPYKMGITLLDVNFQAARPPEDVKAAF 243

Query: 234 DEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSI 293
           D+V  A ++E + + E++ Y N VL  A+G A  + E + AYK  ++ +A+GE   F  +
Sbjct: 244 DDVISAREEEQKTIREAHAYRNEVLPLAKGNAQRLIEEAEAYKASVVFKAEGEVASFAKM 303

Query: 294 YGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
             +Y  AP + R+R+Y++TME +L   +KVI + K + M  LPL++
Sbjct: 304 LPEYRAAPEITRERLYIDTMERVLSNTRKVIANDKSNSMLVLPLDQ 349


>gi|152978742|ref|YP_001344371.1| HflK protein [Actinobacillus succinogenes 130Z]
 gi|150840465|gb|ABR74436.1| HflK protein [Actinobacillus succinogenes 130Z]
          Length = 399

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 96/308 (31%), Positives = 162/308 (52%), Gaps = 26/308 (8%)

Query: 48  KSYGSVYIILLLIG-SFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVE 106
           ++YG +  I + +G +      +Y V   ER V  RFG+  + +  PGL+     ID+V 
Sbjct: 68  RNYGKLLPIAVAVGLTVWGLSGLYTVKEAERGVVTRFGQ-LHSIVQPGLNWKPTFIDKVI 126

Query: 107 IVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETL 166
            V V ER +++           G +LT D+N+V +  +V Y V DP  Y F++ +   +L
Sbjct: 127 PVNV-ERVREL--------KTQGSMLTQDENMVKVELTVQYRVVDPAKYKFSVTDADNSL 177

Query: 167 KQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPP 226
            Q ++SA+R VVG     DI  + R  +  +    +   +  Y  G+ +  ++ + A PP
Sbjct: 178 GQATDSALRYVVGHMTMDDILTTGRAVVREDTWKALNAIIKPYDMGLEVIDVNFQSARPP 237

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
            EV DAFD+  +A++DE R++ E+  Y+      ARG A  I E + AYKD+I+ +AQGE
Sbjct: 238 EEVKDAFDDAIKAQEDEQRYIREAEAYAREREPIARGNAQKIIEEATAYKDQIVLDAQGE 297

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIID---------------KKQSV 331
            +RF  +  ++  +P + ++R+Y++TME ++ K  KV++D                +Q+ 
Sbjct: 298 VERFQRLLPEFKASPAVTKERLYIQTMENLMAKTPKVMMDGGNNLAVLPMDQLLRGRQAT 357

Query: 332 MPYLPLNE 339
              LPLNE
Sbjct: 358 QSALPLNE 365


>gi|256821745|ref|YP_003145708.1| HflK protein [Kangiella koreensis DSM 16069]
 gi|256795284|gb|ACV25940.1| HflK protein [Kangiella koreensis DSM 16069]
          Length = 355

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 97/301 (32%), Positives = 163/301 (54%), Gaps = 14/301 (4%)

Query: 49  SYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGK-PKNDVFLPGLHMMFWPIDQVEI 107
           S  S  I  L++ +   F+S Y V   + A+ L  GK  + D    GLH  F PI QV +
Sbjct: 56  SNASFIIGFLILVAIYLFKSAYTVDEKQNAIVLTLGKHTRTDT--AGLHFAFPPIQQVYL 113

Query: 108 VKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167
           + V          S       G++LT D N+  +   V Y V DP  Y FN+ +P ETLK
Sbjct: 114 IDV---------ESIKDVEVEGIMLTKDDNVATVKVKVQYRVKDPLNYKFNVVDPVETLK 164

Query: 168 QVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTIS-IEDASPP 226
             +E+A+R+V+G     D    +++ +   V N ++  ++ Y +GI I  ++ I +   P
Sbjct: 165 HATEAALRQVIGHTRLQDARTDKKEDVRKNVENELKSILEPYDAGIEIFRLNLIGNVDVP 224

Query: 227 REVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGE 286
             V  AFD+  +AE+D+  ++E+   Y ++ +  A G+A  + + + +Y+ RII++A GE
Sbjct: 225 PSVKPAFDDAIKAEEDQRAYIEQGEAYRSKQVPLAEGQAQQLIQQANSYRARIIEKAAGE 284

Query: 287 ADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAFSRIQ 345
             RF  +  +Y+ AP + R+R+YLET+E +L K+ K+++D + S  M Y+PL+    R +
Sbjct: 285 VARFEKLLPEYMAAPGVTRQRLYLETIESVLSKSSKIMLDVEGSNNMTYIPLDSILKRNK 344

Query: 346 T 346
           T
Sbjct: 345 T 345


>gi|259907180|ref|YP_002647536.1| FtsH protease regulator HflK [Erwinia pyrifoliae Ep1/96]
 gi|224962802|emb|CAX54259.1| Protease specific for phage lambda cII repressor [Erwinia
           pyrifoliae Ep1/96]
 gi|283476988|emb|CAY72880.1| protease specific for phage lambda cII repressor [Erwinia
           pyrifoliae DSM 12163]
 gi|310765329|gb|ADP10279.1| FtsH protease regulator HflK [Erwinia sp. Ejp617]
          Length = 417

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 93/270 (34%), Positives = 154/270 (57%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  RFGK  + +  PGL+     ID+V  V V E  +++        S SG
Sbjct: 95  YTIKEAERGVVTRFGKFSH-LVEPGLNWKPTFIDRVRAVNV-EAVREL--------SASG 144

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
            +LT D+N+V +  +V Y VT+P  Y+F + +  ++L+Q ++SA+R V+GR     I   
Sbjct: 145 TMLTSDENVVRVEMNVQYRVTNPERYMFAVTSADDSLRQATDSALRGVIGRSTMDRILTE 204

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + +  +++T+  Y  GI +  ++ + A PP +V  +FD+   A ++ ++ V E
Sbjct: 205 GRTVVRSDTQRELEETIRPYDMGITLLDVNFQTARPPEDVKASFDDAIAARENREQSVRE 264

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N  L  ARG+A  I E + AYK R+  EAQGE D F  I  +Y  AP + R+R+Y
Sbjct: 265 AEAYANDKLPRARGDAQGILEQARAYKARVTLEAQGEVDSFARILPEYKAAPQITRERLY 324

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+++ K + +  LPL++
Sbjct: 325 IETMERVLGHTRKVLVNDKGNNLMVLPLDQ 354


>gi|238755904|ref|ZP_04617232.1| hypothetical protein yruck0001_26210 [Yersinia ruckeri ATCC 29473]
 gi|238705863|gb|EEP98252.1| hypothetical protein yruck0001_26210 [Yersinia ruckeri ATCC 29473]
          Length = 419

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 91/270 (33%), Positives = 151/270 (55%), Gaps = 10/270 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V  R GK  + +  PGL+     ID+V  V V          S    + SG
Sbjct: 97  YTIKEAERGVVTRLGKLSH-IVQPGLNWKPTFIDEVIPVNV---------ESVRELAASG 146

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y VTDP  YLF++ +P ++L+Q ++SA+R V+G+     I   
Sbjct: 147 VMLTSDENVVRVEMNVQYRVTDPAAYLFSVTDPDDSLRQATDSAVRGVIGKYTMDKILTE 206

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + + ++++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++ E
Sbjct: 207 GRTIVRSDTQRVLEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIRE 266

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  Y+N V   A G+A  + E S AY  R + EAQGE   F  +  +Y +AP + R+R+Y
Sbjct: 267 AEAYANEVQPRANGQAQRLLEDSRAYAARKVLEAQGEVAGFAKLLPEYKSAPEITRERLY 326

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +ETME +L   +KV+   K + +  LPL++
Sbjct: 327 IETMEKVLGHTRKVLASDKGNNLMVLPLDQ 356


>gi|134295836|ref|YP_001119571.1| HflK protein [Burkholderia vietnamiensis G4]
 gi|134138993|gb|ABO54736.1| protease FtsH subunit HflK [Burkholderia vietnamiensis G4]
          Length = 453

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 92/292 (31%), Positives = 162/292 (55%), Gaps = 6/292 (2%)

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVI 111
           V I++ ++ +  A   +++V   +  V L+ GK    V   G+H    +P    EIV   
Sbjct: 91  VGIVIGVLIAVYAGSGLFVVQDGQTGVVLQLGKLAGTVG-EGVHWRAPYPFSSHEIVDTT 149

Query: 112 E-RQQKIGGRSASVGSN--SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
           + R  +IG  +    +N     +LT D +IV + F V Y V     YLF   +P  ++ Q
Sbjct: 150 QVRSIEIGRNNVVRLANVKEAAMLTRDADIVDVRFVVQYRVRSATDYLFRSVDPERSVSQ 209

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
            +++A+R +VG R A DI    R  +  ++   IQ+ +D Y+SG+ +  ++++  + P +
Sbjct: 210 AAQAAVRAIVGTRSAADILNQDRDALRSQLSAAIQRDLDRYQSGLEVTAVTMQSVAAPEQ 269

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
              A+ EV +A  + +     +  Y+N +L  A+G+A+ + + + AY DR++ +A+G+AD
Sbjct: 270 TQAAYAEVAKARDEREAAKRAAQAYTNDLLPKAQGDAAKLVDDAKAYADRVVTQAEGDAD 329

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVII-DKKQSVMPYLPLNE 339
           RF  +Y QY  AP ++R+R+YLETM+ I  KA KV + +K  S + YLPL++
Sbjct: 330 RFKQVYAQYSKAPAVIRERMYLETMQEIYSKATKVFVGNKAGSSVVYLPLDK 381


>gi|15617159|ref|NP_240372.1| HflK protein [Buchnera aphidicola str. APS (Acyrthosiphon pisum)]
 gi|11386821|sp|P57631|HFLK_BUCAI RecName: Full=Protein HflK
 gi|25403653|pir||B84996 hflK protein [imported] - Buchnera sp. (strain APS)
 gi|10039224|dbj|BAB13258.1| hflK protein [Buchnera aphidicola str. APS (Acyrthosiphon pisum)]
          Length = 406

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 93/276 (33%), Positives = 152/276 (55%), Gaps = 10/276 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V   FGK  + +  PGL+      ++V+ V V          +    + SG
Sbjct: 85  YTITEAERGVVTSFGKFSH-LVQPGLNWRPVFFNEVKPVNV---------ETVRELATSG 134

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y +T+P  YLF++  P ++L+Q ++SA+R V+G      +   
Sbjct: 135 IMLTADENVVRVEMNVQYKITNPADYLFSVCYPDDSLRQATDSALRGVIGHSTMDRVLTE 194

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + +  I+ T+  YK GI I  ++ + A PP EV  AFD+   A ++ +++V E
Sbjct: 195 GRTLVRSDTQKEIENTIKPYKMGITILDVNFQTARPPEEVKAAFDDAIAARENREQYVRE 254

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  YSN V   A G+A  I E + +Y  RII +AQGE  RF  I  +Y  A  +  KR+Y
Sbjct: 255 AEAYSNEVKPKANGKAQRILEEAKSYSSRIILQAQGEVARFSKILPEYRIAKKITLKRLY 314

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQ 345
           +E+ME +L+K KK+ ID   + M +  L+  FS+I+
Sbjct: 315 IESMERLLRKNKKIFIDTNNNPMFFFSLDNFFSKIK 350


>gi|260450999|gb|ACX41421.1| HflK protein [Escherichia coli DH1]
 gi|315138728|dbj|BAJ45887.1| FtsH protease regulator HflK [Escherichia coli DH1]
          Length = 419

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 92/272 (33%), Positives = 155/272 (56%), Gaps = 10/272 (3%)

Query: 68  SIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSN 127
             Y +   ER V  RFGK  + +  PGL+     ID+V+ V V E  +++          
Sbjct: 96  GFYTIKEAERGVVTRFGK-FSHLVEPGLNWKPTFIDEVKPVNV-EAVRELAA-------- 145

Query: 128 SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIF 187
           SG++LT D+N+V +  +V Y VT+P  YL+++ +P ++L+Q ++SA+R V+G+     I 
Sbjct: 146 SGVMLTSDENVVRVEMNVQYRVTNPEKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRIL 205

Query: 188 RSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFV 247
              R  I  + +  +++T+  Y  GI +  ++ + A PP EV  AFD+   A ++E +++
Sbjct: 206 TEGRTVIRSDTQRELEETIRPYDMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYI 265

Query: 248 EESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKR 307
            E+  Y+N V   A G+A  I E + AYK + I EAQGE  RF  +  +Y  AP + R+ 
Sbjct: 266 REAEAYTNEVQPRANGQAQRILEEARAYKAQTILEAQGEVARFAKLLPEYKAAPEITREC 325

Query: 308 IYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           +Y+ETME +L   +KV+++ K   +  LPL++
Sbjct: 326 LYIETMEKVLGNTRKVLVNDKGGNLMVLPLDQ 357


>gi|219681910|ref|YP_002468296.1| HflK protein [Buchnera aphidicola str. 5A (Acyrthosiphon pisum)]
 gi|219682465|ref|YP_002468849.1| HflK protein [Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisum)]
 gi|257471616|ref|ZP_05635615.1| HflK protein [Buchnera aphidicola str. LSR1 (Acyrthosiphon pisum)]
 gi|219622198|gb|ACL30354.1| HflK protein [Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisum)]
 gi|219624753|gb|ACL30908.1| HflK protein [Buchnera aphidicola str. 5A (Acyrthosiphon pisum)]
 gi|311086288|gb|ADP66370.1| HflK protein [Buchnera aphidicola str. LL01 (Acyrthosiphon pisum)]
 gi|311086864|gb|ADP66945.1| HflK protein [Buchnera aphidicola str. TLW03 (Acyrthosiphon pisum)]
 gi|311087452|gb|ADP67532.1| HflK protein [Buchnera aphidicola str. JF99 (Acyrthosiphon pisum)]
          Length = 406

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 93/276 (33%), Positives = 152/276 (55%), Gaps = 10/276 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V   FGK  + +  PGL+      ++V+ V V          +    + SG
Sbjct: 85  YTITEAERGVVTSFGKFSH-LVQPGLNWRPVFFNEVKPVNV---------ETVRELATSG 134

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y +T+P  YLF++  P ++L+Q ++SA+R V+G      +   
Sbjct: 135 IMLTSDENVVRVEMNVQYKITNPADYLFSVCYPDDSLRQATDSALRGVIGHSTMDRVLTE 194

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + +  I+ T+  YK GI I  ++ + A PP EV  AFD+   A ++ +++V E
Sbjct: 195 GRTLVRSDTQKEIENTIKPYKMGITILDVNFQTARPPEEVKAAFDDAIAARENREQYVRE 254

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  YSN V   A G+A  I E + +Y  RII +AQGE  RF  I  +Y  A  +  KR+Y
Sbjct: 255 AEAYSNEVKPKANGKAQRILEEAKSYSSRIILQAQGEVARFSKILPEYRIAKKITLKRLY 314

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQ 345
           +E+ME +L+K KK+ ID   + M +  L+  FS+I+
Sbjct: 315 IESMERLLRKNKKIFIDTNNNPMFFFSLDNFFSKIK 350


>gi|311087939|gb|ADP68018.1| HflK protein [Buchnera aphidicola str. JF98 (Acyrthosiphon pisum)]
          Length = 394

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 93/276 (33%), Positives = 152/276 (55%), Gaps = 10/276 (3%)

Query: 70  YIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG 129
           Y +   ER V   FGK  + +  PGL+      ++V+ V V          +    + SG
Sbjct: 73  YTITEAERGVVTSFGKFSH-LVQPGLNWRPVFFNEVKPVNV---------ETVRELATSG 122

Query: 130 LILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRS 189
           ++LT D+N+V +  +V Y +T+P  YLF++  P ++L+Q ++SA+R V+G      +   
Sbjct: 123 IMLTSDENVVRVEMNVQYKITNPADYLFSVCYPDDSLRQATDSALRGVIGHSTMDRVLTE 182

Query: 190 QRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEE 249
            R  +  + +  I+ T+  YK GI I  ++ + A PP EV  AFD+   A ++ +++V E
Sbjct: 183 GRTLVRSDTQKEIENTIKPYKMGITILDVNFQTARPPEEVKAAFDDAIAARENREQYVRE 242

Query: 250 SNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIY 309
           +  YSN V   A G+A  I E + +Y  RII +AQGE  RF  I  +Y  A  +  KR+Y
Sbjct: 243 AEAYSNEVKPKANGKAQRILEEAKSYSSRIILQAQGEVARFSKILPEYRIAKKITLKRLY 302

Query: 310 LETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQ 345
           +E+ME +L+K KK+ ID   + M +  L+  FS+I+
Sbjct: 303 IESMERLLRKNKKIFIDTNNNPMFFFSLDNFFSKIK 338


>gi|90581375|ref|ZP_01237171.1| putative Membrane protease subunits [Vibrio angustum S14]
 gi|90437485|gb|EAS62680.1| putative Membrane protease subunits [Vibrio angustum S14]
          Length = 388

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 96/282 (34%), Positives = 150/282 (53%), Gaps = 13/282 (4%)

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASV 124
            F   Y +   E+ V LRFGK  + V  PGL+     ID+V  V +    Q I    AS 
Sbjct: 75  GFSGFYTIGEAEQGVVLRFGK-FDQVVKPGLNWKPTFIDEVIPVNI----QAIRSLRAS- 128

Query: 125 GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAV 184
               GL+LT D+N++ +   V Y V +   YLF++ N  ++L+Q ++SA+R V+G     
Sbjct: 129 ----GLMLTKDENVLKVEMDVQYRVDNAEKYLFSVTNADDSLRQATDSALRAVIGDSTMD 184

Query: 185 DIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDED 244
               + RQ I    +  I K +  Y  GI +  ++ + A PP  V DAFD+   A +DE+
Sbjct: 185 QALTTGRQAIRANTQAAIDKIIAKYDMGIRVVDVNFQSARPPEAVKDAFDDAIAAREDEE 244

Query: 245 RFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLL 304
           R+V E+  YSN +L  A G A  ++  +  Y +R++  A G+  +F  +  QY+ A  + 
Sbjct: 245 RYVREAEAYSNDILPKATGRAERLKNEAEGYSERVVNGALGDVAQFDKLLPQYLAAKEVT 304

Query: 305 RKRIYLETMEGILKKAKKVIIDKK---QSVMPYLPLNEAFSR 343
           R+R+YL+TME +     KV+ID K    + M YLPL++  S+
Sbjct: 305 RERLYLDTMEKVYSNTSKVLIDTKSGGSNNMMYLPLDKLMSQ 346


>gi|145628448|ref|ZP_01784248.1| HflK [Haemophilus influenzae 22.1-21]
 gi|144978918|gb|EDJ88604.1| HflK [Haemophilus influenzae 22.1-21]
          Length = 406

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 97/301 (32%), Positives = 163/301 (54%), Gaps = 14/301 (4%)

Query: 45  PFFKSYGSVYIILLLIGSFC-AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPID 103
           PF   +G V  + + IG+        Y +   ER V LRFG+  + +  PGL+     +D
Sbjct: 77  PFH--FGKVIPLAVAIGAIIWGVSGFYTIKEAERGVVLRFGE-LHSIVQPGLNWKPTFVD 133

Query: 104 QVEIVKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPG 163
           +V  V V E+ +++           G +LT D+N+V +  +V Y V DP  YLF++ N  
Sbjct: 134 KVLPVNV-EQVKEL--------RTQGAMLTQDENMVKVEMTVQYRVQDPAKYLFSVTNAD 184

Query: 164 ETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDA 223
           ++L Q ++SA+R V+G     DI  + R  +       + + +  Y  G+ +  ++ + A
Sbjct: 185 DSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIKSYDMGLEVIDVNFQSA 244

Query: 224 SPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEA 283
            PP EV DAFD+  +A++DE RF+ E+  Y+      ARG+A  I E + AYKDRI+ +A
Sbjct: 245 RPPEEVKDAFDDAIKAQEDEQRFIREAEAYAREEEPIARGDAQRILEEATAYKDRIVLDA 304

Query: 284 QGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNEAFS 342
           +GE +R   +  ++  AP LLR+R+Y++TME ++    KV++D    + +  LPL +   
Sbjct: 305 KGEVERLQRLLPEFKAAPDLLRERLYIQTMEKVMANTPKVMLDGNNGNNLTVLPLEQIMG 364

Query: 343 R 343
           +
Sbjct: 365 K 365


>gi|254177982|ref|ZP_04884637.1| HflK protein [Burkholderia mallei ATCC 10399]
 gi|160699021|gb|EDP88991.1| HflK protein [Burkholderia mallei ATCC 10399]
          Length = 434

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 169/293 (57%), Gaps = 17/293 (5%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE- 112
           +I + +GS      I+IV   +  V LR G+ K  V   G+H    +P +  EIV   + 
Sbjct: 80  LIAIYLGS-----GIFIVQDGQTGVVLRLGQYKGSVG-DGVHWRLPYPFESHEIVDTAQV 133

Query: 113 RQQKIGG----RSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
           R  +IG     R A+V   S  +LT D +IV + F+V Y V  P  YLF+  +P  ++ Q
Sbjct: 134 RSIEIGRNNVVRLANVKDAS--MLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPERSVSQ 191

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
            +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  SPP +
Sbjct: 192 AAQAAVREIVGARRADEVLAQDRDALCDALSKAIQRDLDRYRTGLVVTGVTVQSVSPPEQ 251

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+G+A+
Sbjct: 252 VQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAEGDAE 311

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
           RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K   SV+ YLPL++
Sbjct: 312 RFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVL-YLPLDK 363


>gi|32490934|ref|NP_871188.1| hypothetical protein WGLp185 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|25166140|dbj|BAC24331.1| hflK [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 406

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 102/333 (30%), Positives = 175/333 (52%), Gaps = 24/333 (7%)

Query: 4   DKNNSDWRPTR-----LSGSNGNGDGLPPFDVEAIIRYIKDKFD------LIPFFKSYGS 52
           + NN  W+  +         N   + LPP D++ + + +  KF+      +      Y  
Sbjct: 13  NHNNDPWKKDQKINKFQDKKNSKYESLPP-DLDDVFKKLSKKFNEFKNKNITHKKNKYSK 71

Query: 53  VYIILLLIGSFCAFQS--IYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV 110
           +YI  ++I     + +   Y +   ER V LR GK  N++  PGL+   W  + +++V  
Sbjct: 72  LYISFIIILLISIWITSGFYTIKEAERGVILRLGKF-NNIVKPGLN---WKPNFIDVV-- 125

Query: 111 IERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVS 170
                 +   S    + SG++LT D+N+V +  +V Y V +P+ YLF++ N  ++L+Q +
Sbjct: 126 ----YPVNIESVRELAASGIMLTSDENVVRVEMNVQYKVINPKNYLFSVTNADDSLRQAT 181

Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVA 230
           +SA+R V+G+     I    R  +  + + ++++T+  Y  GI +  ++ + A PP EV 
Sbjct: 182 DSALRGVIGKYTMDRILTEGRTLVRSDTQKVLEETIQPYNMGIELLDVNFQTARPPEEVK 241

Query: 231 DAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRF 290
            AFD+   A ++E +++ E+  Y+N V   A G+A  I E   AYK R I EAQGE  RF
Sbjct: 242 AAFDDAIAARENEQQYIREAEAYANEVQPQANGKAQRILEEGRAYKSRTILEAQGEVQRF 301

Query: 291 LSIYGQYVNAPTLLRKRIYLETMEGILKKAKKV 323
             +  +Y  AP + R+R+Y++TME IL K KK+
Sbjct: 302 SKVLPEYKIAPEITRERLYIDTMERILSKNKKI 334


>gi|170694786|ref|ZP_02885937.1| HflK protein [Burkholderia graminis C4D1M]
 gi|170140417|gb|EDT08594.1| HflK protein [Burkholderia graminis C4D1M]
          Length = 470

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 94/292 (32%), Positives = 164/292 (56%), Gaps = 11/292 (3%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE- 112
           +I +LI  +     +++V   +  V ++FGK +      G+H    +P +  E+V + + 
Sbjct: 93  VIGVLIAIYLG-SGVFVVQDGQAGVVMQFGKYRY-TAAHGVHWRLPYPFETHELVNIGQV 150

Query: 113 RQQKIGG----RSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
           RQ +IG     R A+V   S  +LT D +IV L F+V Y +  P  YLF   +P +++ Q
Sbjct: 151 RQVEIGRNNVVRLANVKDAS--MLTHDADIVDLRFAVQYQIRKPTDYLFRSVDPDQSVMQ 208

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
            +++A+R +VG R   DI    R+ I  ++   IQK++D Y+SG+ +  ++I+    P +
Sbjct: 209 AAQAAVRGIVGARSTQDILGQDREAIRQQLIAAIQKSLDQYQSGLAVTGVTIQAVQAPDQ 268

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V  AFD+  R  Q+ +R   ++  Y+  +L  A+ + +   + +  Y D+ + +AQG+AD
Sbjct: 269 VQAAFDDAARVRQENERAKRDAQAYAAELLPRAQADVARQIDDAKKYSDKTVAQAQGDAD 328

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQ-SVMPYLPLNE 339
           RF  +Y QY  AP ++R+R+YLETM+ I     KV +D K  + + YLPL++
Sbjct: 329 RFKEVYAQYSKAPAVIRQRMYLETMQQIYSNTTKVFVDNKSGNNVLYLPLDK 380


>gi|189184224|ref|YP_001938009.1| HflK protein [Orientia tsutsugamushi str. Ikeda]
 gi|189180995|dbj|BAG40775.1| HflK protein [Orientia tsutsugamushi str. Ikeda]
          Length = 351

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 102/328 (31%), Positives = 177/328 (53%), Gaps = 31/328 (9%)

Query: 38  KDKFDL-IPFFKSYGSVYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLH 96
           K+ F L + F  S  ++ I++  I        +Y V+  E A+ +RFG+     + PGL+
Sbjct: 20  KNNFFLPVNFSFSIKTMLILIFTIVVIWLLSGVYKVNEGEEAIVIRFGEYVRKAY-PGLN 78

Query: 97  MMF-WPIDQVEIVKV-IERQQKIG-----GRSASVGSN---------------------- 127
                P+++V I +V + RQ ++G      R  +  SN                      
Sbjct: 79  YHLPHPLERVIIERVKMSRQTEVGYSSGQSRRETNTSNGNYMVYSYRLNNRTINNQHLGE 138

Query: 128 SGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIF 187
           S  +LTGD+NIV L+ +V + + D   ++FN+  P ET+K V+ESA+REV+       I 
Sbjct: 139 SSTMLTGDENIVELNCNVRWHIKDLYSFVFNVAFPEETVKIVAESAIREVISETPIASIL 198

Query: 188 RSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFV 247
            +Q+Q+IA ++  LIQ+ ++ Y  GI I  + +  A PP EV DA+ +VQ +  D++R +
Sbjct: 199 SNQKQEIADKIEKLIQQILNQYSIGIEIEKVQLLKAEPPSEVIDAYRDVQTSRADKEREI 258

Query: 248 EESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKR 307
            ++  Y N  +  ARG+A+ + E +  YK   + +A GEA +F +I  +Y     + ++R
Sbjct: 259 NQAQAYRNDKIPEARGKAAKLIEEAKGYKQATVSKALGEAKKFNAILVEYKLNKEITKER 318

Query: 308 IYLETMEGILKKAKKVIIDKKQSVMPYL 335
           +YL T+E IL+ +KK+II  +  ++P++
Sbjct: 319 LYLNTIETILQGSKKIIISDESKLLPHM 346


>gi|196233405|ref|ZP_03132249.1| HflK protein [Chthoniobacter flavus Ellin428]
 gi|196222545|gb|EDY17071.1| HflK protein [Chthoniobacter flavus Ellin428]
          Length = 332

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 103/318 (32%), Positives = 180/318 (56%), Gaps = 19/318 (5%)

Query: 36  YIKDKFDLIPFFKSYGSVYIILLLIGSFCAFQSIYIVHP-DERAVELRFGKPKNDVFLPG 94
           Y   +F++  F  ++  V+ ++L++    A  S Y   P D   V  RFGK + ++  PG
Sbjct: 10  YNVSRFEMPQF--NFRWVWRVILIVIVIWALLSCYSSVPADSVGVLQRFGKFQ-EIVQPG 66

Query: 95  L-HMMFWPIDQVEIVKVIERQQKIGGRSASVGSNSG-----------LILTGDQNIVGLH 142
           L   +   ID++ +V+V +RQ K+     + G+ +             ++TGD N+  + 
Sbjct: 67  LVFKLPLGIDKITLVEV-QRQNKVEFGFGTEGATNPDQESRDSEAEQTMVTGDLNMALVE 125

Query: 143 FSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQIALEVRNLI 202
           + V Y + DP+ YLF++ +PG+TL+  SESAMREVVG R   ++    RQ+I  E    +
Sbjct: 126 WVVQYRIEDPKEYLFHVYSPGQTLRDASESAMREVVGDRTVDEVLTIGRQEIENETLARL 185

Query: 203 QKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSAR 262
           ++   +Y  GI +  + + D  PPR V  +F+EV +A+Q++++ +  +N   N+ +  AR
Sbjct: 186 KELSKHYGLGISVMQVQLRDVHPPRNVQASFNEVNQAQQEKEQMINVANGEYNKAVPRAR 245

Query: 263 GEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETMEGILKK-AK 321
           GEA     ++  Y    + +AQG+ADRF ++  +Y+ AP + R+R++LETM  I+ +  +
Sbjct: 246 GEADQKIRAAEGYALGRVNQAQGDADRFDALLAEYLKAPEVTRERMFLETMTEIMPQFER 305

Query: 322 KVIIDKKQS-VMPYLPLN 338
           KVIID+  S ++P L L+
Sbjct: 306 KVIIDENASQLLPLLNLD 323


>gi|183600315|ref|ZP_02961808.1| hypothetical protein PROSTU_03877 [Providencia stuartii ATCC 25827]
 gi|188020105|gb|EDU58145.1| hypothetical protein PROSTU_03877 [Providencia stuartii ATCC 25827]
          Length = 404

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 91/276 (32%), Positives = 156/276 (56%), Gaps = 12/276 (4%)

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKV-IERQQKIGGRSAS 123
           A    Y +   +R V LRFG+  + +  PGL+     ID+V  V V   R+Q        
Sbjct: 87  AGSGFYTIKESDRGVILRFGE-YSGIVGPGLNWKPTFIDKVIPVNVETVREQ-------- 137

Query: 124 VGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFA 183
             + +G++LT D+N++ +  +V Y VT+P+ YLF++ NP  +L+Q  +SA+R V+G+   
Sbjct: 138 --ATNGMMLTSDENVIRVEMNVQYRVTNPKEYLFSVTNPDNSLRQALDSAVRGVIGQSAM 195

Query: 184 VDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDE 243
             +  + R  I    +  ++ T++ YK GI +  ++ + A PP +V  AFD+V  A ++E
Sbjct: 196 EQVLTTNRAFIRDVTQRDLEATIEPYKMGITVLDVNFQAARPPEDVKAAFDDVIAAREEE 255

Query: 244 DRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTL 303
            + + E++ Y N VL  A+G A  + E + AYK  ++ +A+GE   F  +  +Y  AP +
Sbjct: 256 QKTIREAHAYRNEVLPMAKGNAQKLIEEAEAYKASVVFKAEGEVASFAKMLPEYRAAPEI 315

Query: 304 LRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
            R+R+Y++TME +L   +KVI + K + M  LPL +
Sbjct: 316 TRERLYIDTMERVLSNTRKVIANDKSNSMLVLPLEQ 351


>gi|52425674|ref|YP_088811.1| HflC protein [Mannheimia succiniciproducens MBEL55E]
 gi|52307726|gb|AAU38226.1| HflC protein [Mannheimia succiniciproducens MBEL55E]
          Length = 410

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 88/285 (30%), Positives = 155/285 (54%), Gaps = 10/285 (3%)

Query: 63  FCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSA 122
                 +Y V   ER V  RFG+  + +  PGL+     ID+V  V V E+ +++     
Sbjct: 91  LWGLSGLYTVKEAERGVVTRFGQ-LHSIVQPGLNWKPNFIDEVIPVNV-EQVKEL----- 143

Query: 123 SVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRF 182
                 G +LT D+N+V +  +V Y V DP  YLF++ N  ++L Q ++SA+R V+G   
Sbjct: 144 ---RTQGAMLTQDENMVKVEMTVQYRVQDPAKYLFSVTNADDSLNQATDSALRYVIGHMT 200

Query: 183 AVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQD 242
             DI  + R  +  +    +   +  Y  G+ +  ++ + A PP EV DAFD+  +A++D
Sbjct: 201 MDDILTTGRAVVREQTWKTLNNVIKPYDMGVEVIDVNFQSARPPEEVKDAFDDAIKAQED 260

Query: 243 EDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPT 302
           E R++ E+  Y+      ARG+A  I E + AYKD+++  A+GE +R   +  ++  +P 
Sbjct: 261 EQRYIREAEAYAREQEPIARGDAQRIVEGATAYKDKVVLNAKGEVERLQRLLPEFKASPD 320

Query: 303 LLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTK 347
           LLR+R+Y+++ME I+ K  K+++D   + +  LP+++      T+
Sbjct: 321 LLRERLYIQSMEQIMSKTPKIMLDGNGNNLNVLPVDQILRNKNTQ 365


>gi|116747634|ref|YP_844321.1| HflK protein [Syntrophobacter fumaroxidans MPOB]
 gi|116696698|gb|ABK15886.1| HflK protein [Syntrophobacter fumaroxidans MPOB]
          Length = 350

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 103/327 (31%), Positives = 174/327 (53%), Gaps = 22/327 (6%)

Query: 29  DVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGS-FCAFQSIYIVHPDERAVELRFGKPK 87
           D E I+  +K+++ L P   + G V++I+L+       + S YIV P E AV  RFG   
Sbjct: 18  DFEEILARLKNRYKLPPI--TGGPVFLIVLVAAMILIGYNSFYIVQPQETAVIQRFGAYS 75

Query: 88  NDVFLPGLHMMF-WPIDQVEIV---KVIERQQKIGGRSASVGSNS----------GLILT 133
           +     GLH    + ID V  V   +V+  Q + G R+   G  S           ++L+
Sbjct: 76  HTA-EAGLHAKLPFGIDTVRKVPTGRVL--QHEYGYRTVKPGVRSTFKEKEYEEEAVMLS 132

Query: 134 GDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQRQQ 193
           GD N+V L + V Y + +P  +LF + +   TL  +SES +R +VG R++ D+    R  
Sbjct: 133 GDLNVVNLQWMVQYKIQNPADFLFRVHDVEGTLDDISESVVRRIVGNRYSDDVLTVGRAS 192

Query: 194 IALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDRFVEESNKY 253
           IA   +  IQ  +D Y++G+ I T+ +++A+PP  V  AF+EV  A+Q+ +R + E+ + 
Sbjct: 193 IADMAKVEIQAILDTYQTGVKIVTVQLQNANPPDMVKAAFNEVNEAQQERERMINEAQQA 252

Query: 254 SNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLRKRIYLETM 313
            N+ +  A GEA      +  Y    +  +QGE  RF +I  +Y  AP + R+R+YL+ M
Sbjct: 253 YNQKIPKAMGEARQAISQAEGYALERVNRSQGEVQRFQNILAEYEKAPDVTRRRMYLDAM 312

Query: 314 EGILKKAKKV-IIDKKQ-SVMPYLPLN 338
             ++ + + + +ID+ Q +++P   LN
Sbjct: 313 GELMGRVEHLYVIDENQRNLLPLFDLN 339


>gi|89075983|ref|ZP_01162355.1| putative Membrane protease subunits [Photobacterium sp. SKA34]
 gi|89048332|gb|EAR53911.1| putative Membrane protease subunits [Photobacterium sp. SKA34]
          Length = 388

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 97/282 (34%), Positives = 152/282 (53%), Gaps = 13/282 (4%)

Query: 65  AFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASV 124
            F   Y +   E+ V LRFGK  + V  PGL+     ID+V  V +    Q I  RS   
Sbjct: 75  GFSGFYTIGEAEQGVVLRFGK-FDQVVKPGLNWKPTFIDEVIPVNI----QAI--RSLR- 126

Query: 125 GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAV 184
             +SGL+LT D+N++ +   V Y V +   YLF++ N  ++L+Q ++SA+R V+G     
Sbjct: 127 --SSGLMLTKDENVLKVEMDVQYRVDNAEKYLFSVTNADDSLRQATDSALRAVIGDSTMD 184

Query: 185 DIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDED 244
               + RQ I    +  I K +  Y  GI +  ++ + A PP  V DAFD+   A +DE+
Sbjct: 185 QALTTGRQTIRANTQAAIDKIIAKYDMGIRVVDVNFQSARPPEAVKDAFDDAIAAREDEE 244

Query: 245 RFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLL 304
           R+V E+  YSN +L  A G A  ++  +  Y +R++  A G+  +F  +  QY+ A  + 
Sbjct: 245 RYVREAEAYSNDILPKATGRAERLKNEAEGYSERVVNGALGDVAQFDKLLPQYLVAKEVT 304

Query: 305 RKRIYLETMEGILKKAKKVIIDKK---QSVMPYLPLNEAFSR 343
           R+R+YL+TME +     KV+ID K    + M YLPL++  S+
Sbjct: 305 RERLYLDTMEKVYSNTSKVLIDTKSGGSNNMMYLPLDKLMSQ 346


>gi|119476783|ref|ZP_01617093.1| Membrane protease subunit [marine gamma proteobacterium HTCC2143]
 gi|119450039|gb|EAW31275.1| Membrane protease subunit [marine gamma proteobacterium HTCC2143]
          Length = 351

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 104/336 (30%), Positives = 182/336 (54%), Gaps = 19/336 (5%)

Query: 17  GSNGNGDGLPPFDVEAIIRYIKDKFDL-IPFFKSYGSVYIILLLIGSFCAFQSIYIVHPD 75
           G+   G    P D++ II+   D+F   +P   + G + I+ +++     + + Y V  D
Sbjct: 8   GTPWGGKQPSPPDIDQIIKQGLDRFKSGLPGGGASGPLSIVAIVLLIVSIWSAYYTVPSD 67

Query: 76  ERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIER-QQKIGGRSASV--------- 124
             AV  RFG    +V  PGLH      IDQ  IV V  + +Q+ G  +            
Sbjct: 68  SVAVVQRFGMYLKEV-PPGLHFKLPLSIDQATIVPVKRQLKQEFGFSTPGARDQYQTPRS 126

Query: 125 --GSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRF 182
             G     ++TGD N   + + V Y ++DP  +LF +  P ETL+ VSES MREVVG R 
Sbjct: 127 RDGGRETQMVTGDLNAALVEWVVQYRISDPSKFLFAVREPAETLRYVSESVMREVVGDRT 186

Query: 183 AVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQD 242
             ++    RQ+I  E    +Q+    Y+ GI I+ + +++ +PP+ V ++F+EV +A+Q+
Sbjct: 187 VDEVITIGRQEIETEALLKMQELSTKYEMGISIDQVQLKNINPPKPVQESFNEVNQAQQE 246

Query: 243 EDRFVEESNKYSNRVLGSARGEASH-IRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAP 301
           +++ + E+ +  N+V+  A GE    IRE+   Y+ + I EA+G+  RF +++ +Y  AP
Sbjct: 247 KEKLINEARRDYNKVIPLAEGEKDQRIREAD-GYRLKRINEAEGDVARFNALFTEYSKAP 305

Query: 302 TLLRKRIYLETMEGILKK--AKKVIIDKKQSVMPYL 335
            + R+R+Y+ETM+ ++ +  +K ++ D+   ++P L
Sbjct: 306 EVTRRRMYIETMQEVMPQIESKILVDDEMGGLLPLL 341


>gi|323496874|ref|ZP_08101906.1| HflK protein [Vibrio sinaloensis DSM 21326]
 gi|323318060|gb|EGA71039.1| HflK protein [Vibrio sinaloensis DSM 21326]
          Length = 396

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 104/289 (35%), Positives = 159/289 (55%), Gaps = 13/289 (4%)

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVG 125
           F   Y +   ER V LR GK  + V  PGL+     ID+ E V V    Q I  RS    
Sbjct: 85  FAGFYTIGEAERGVVLRLGK-YDRVVDPGLNWRPRFIDEYEAVNV----QAI--RSLR-- 135

Query: 126 SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVD 185
            +SGL+LT D+N+V +   V Y V DP  YLF + N  ++L+Q ++SA+R V+G      
Sbjct: 136 -SSGLMLTKDENVVTVSMDVQYRVADPYKYLFRVTNADDSLRQATDSALRAVIGDSLMDS 194

Query: 186 IFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDR 245
           I  S RQQI    +  +   +D Y  G++I  ++ + A PP +V DAFD+   A +DE+R
Sbjct: 195 ILTSGRQQIRQSTQETLNAIVDSYDMGVVIVDVNFQSARPPEQVKDAFDDAIAAREDEER 254

Query: 246 FVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLR 305
           F  E+  Y N +L  A G A  +++ ++ Y +R++ EA G+  +F  +  +Y  AP + R
Sbjct: 255 FEREAEAYRNDILPKATGRAERLKKEALGYSERVVNEALGQVAQFEKLLPEYQAAPEVTR 314

Query: 306 KRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE--AFSRIQTKREIR 351
            R+YL+TME +     KV+ID + S  + YLP+++     + QTKR  +
Sbjct: 315 NRLYLDTMEQVYSSTSKVLIDSESSGNLLYLPIDKLAGEGQTQTKRNTK 363


>gi|261254055|ref|ZP_05946628.1| HflK protein [Vibrio orientalis CIP 102891]
 gi|260937446|gb|EEX93435.1| HflK protein [Vibrio orientalis CIP 102891]
          Length = 396

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 105/289 (36%), Positives = 160/289 (55%), Gaps = 13/289 (4%)

Query: 66  FQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGRSASVG 125
           F   Y +   ER V LR GK  + V  PGL+     ID+ E V V    Q I  RS    
Sbjct: 85  FAGFYTIGEAERGVVLRLGK-YDRVVDPGLNWRPRFIDEYEAVNV----QAI--RSLR-- 135

Query: 126 SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVD 185
            +SGL+LT D+N+V +   V Y V DP  YLF + N  ++L+Q ++SA+R VVG      
Sbjct: 136 -SSGLMLTKDENVVTVAMDVQYRVADPYKYLFRVTNADDSLRQATDSALRAVVGDSLMDS 194

Query: 186 IFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQDEDR 245
           I  S RQQI    +  +   +D Y  G++I  ++ + A PP +V DAFD+   A +DE+R
Sbjct: 195 ILTSGRQQIRQSTQETLNAIIDSYDMGVVIVDVNFQSARPPEQVKDAFDDAIAAREDEER 254

Query: 246 FVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNAPTLLR 305
           F  E+  Y N +L  A G A  +++ ++ Y +R++ EA G+  +F  +  +Y  AP + R
Sbjct: 255 FEREAEAYRNDILPKATGRAERLKKEALGYSERVVNEALGQVAQFEKLLPEYQAAPEVTR 314

Query: 306 KRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNE--AFSRIQTKREIR 351
            R+YL+TME +     KV+ID + S  + YLP+++     + QTKR+ +
Sbjct: 315 NRLYLDTMEEVYSNTSKVLIDSESSGNLLYLPIDKLAGEGQSQTKRKTK 363


>gi|167581713|ref|ZP_02374587.1| ftsH protease activity modulator HflK [Burkholderia thailandensis
           TXDOH]
          Length = 391

 Score =  153 bits (387), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 95/293 (32%), Positives = 169/293 (57%), Gaps = 17/293 (5%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE- 112
           +I + +GS      I+IV   +  V LRFG+ K  V   G+H    +P +  EIV   + 
Sbjct: 83  LIAIYLGS-----GIFIVQDGQTGVVLRFGEYKGSVG-DGVHWRLPYPFESHEIVDTAQV 136

Query: 113 RQQKIGG----RSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
           R  +IG     R A+V   S  +LT D +IV + F+V Y +  P  YLF   +P  ++ Q
Sbjct: 137 RSIEIGRNNVVRLANVKDAS--MLTRDADIVDVRFAVQYRIGSPTDYLFRAVDPERSVSQ 194

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
            +++A+RE+VG + A D+    R  +   +   IQ+ +D Y++G+++  ++++  +PP +
Sbjct: 195 AAQAAVREIVGAKRADDVLAQDRDALRDALAKTIQRDLDRYRTGLVVTGVTVQSVAPPEQ 254

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+G+A+
Sbjct: 255 VQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAEGDAE 314

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
           RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K   SV+ YLPL++
Sbjct: 315 RFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVL-YLPLDK 366


>gi|260774638|ref|ZP_05883545.1| HflK protein [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609428|gb|EEX35573.1| HflK protein [Vibrio coralliilyticus ATCC BAA-450]
          Length = 398

 Score =  153 bits (387), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 106/303 (34%), Positives = 166/303 (54%), Gaps = 17/303 (5%)

Query: 53  VYIILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIE 112
           + +I + I  F  F   Y +   ER V LR GK  + V  PGL+     ID+V  V V  
Sbjct: 76  IAVIAIAIWFFAGF---YTIGEAERGVVLRLGK-YDRVVDPGLNWRPRFIDEVTPVNV-- 129

Query: 113 RQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSES 172
             Q I  RS     +SGL+LT D+N+V +   V Y V DP  YLF + N  ++L+Q ++S
Sbjct: 130 --QAI--RSLR---SSGLMLTKDENVVTIAMDVQYRVADPYKYLFRVTNADDSLRQATDS 182

Query: 173 AMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADA 232
           A+R V+G      I  + RQQI    +  + + +D Y  G++I  ++ + A PP +V DA
Sbjct: 183 ALRAVIGDSLMDSILTTGRQQIRQSTQETLNEIVDSYDMGVVIVDVNFQSARPPEQVKDA 242

Query: 233 FDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLS 292
           FD+   A +DE+RF  E+  Y N +L  A G A  +++ ++ Y +R++ EA G+  +F  
Sbjct: 243 FDDAIAAREDEERFEREAEAYRNDILPKATGRAERLKKEALGYSERVVNEALGQVAQFEK 302

Query: 293 IYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKKQS-VMPYLPLNEAF---SRIQTKR 348
           +  +Y  AP + R R+YL+TME +     KV+ID + S  + YLP+++      + QTKR
Sbjct: 303 LLPEYQAAPEVTRNRLYLDTMERVYSSTSKVLIDSESSGNLLYLPIDKLAGQEGKTQTKR 362

Query: 349 EIR 351
             +
Sbjct: 363 STK 365


>gi|160902768|ref|YP_001568349.1| HflK protein [Petrotoga mobilis SJ95]
 gi|160360412|gb|ABX32026.1| HflK protein [Petrotoga mobilis SJ95]
          Length = 331

 Score =  153 bits (387), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 92/281 (32%), Positives = 155/281 (55%), Gaps = 11/281 (3%)

Query: 69  IYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKV-IERQQKIGGRSASVG- 125
           +Y V P E A+   FG+ K+    PGLH+   +PI    IV V    + ++G R+ S G 
Sbjct: 45  VYQVGPSEVALVKTFGEYKSTAG-PGLHIHLPYPIQSHVIVDVRTINKVELGFRTTSTGR 103

Query: 126 -------SNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVV 178
                  ++   ++TGDQNI+ +   V Y V DP  Y FN+    + +K  SES +RE V
Sbjct: 104 TPTYSTYTDEAEMITGDQNIISIEAVVQYRVNDPVAYAFNVIQGYDLVKSTSESVLRERV 163

Query: 179 GRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQR 238
                 ++  ++R QIA+E    +Q  +D Y SGILI  + ++  +PP  V  AFD+V  
Sbjct: 164 ALSDLENVLTTERDQIAMETAERVQSILDSYNSGILIQNVYLQAVTPPEPVVPAFDDVNN 223

Query: 239 AEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYV 298
           A QD+   + E+ +Y N ++  A GEA  I   + AY    + +A GEA+RF ++  +Y 
Sbjct: 224 ARQDQQTAINEAQRYGNDIIPRAEGEAQRILNDAQAYAYEQVAKATGEAERFKALLEEYQ 283

Query: 299 NAPTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNE 339
           N+  + RKR+ L++++ ++K +K  ++ ++ + + +L L+E
Sbjct: 284 NSEDITRKRLILDSVQQMIKNSKIQVVSEEGNTLNFLDLSE 324


>gi|226197217|ref|ZP_03792794.1| HflC protein [Burkholderia pseudomallei Pakistan 9]
 gi|225930596|gb|EEH26606.1| HflC protein [Burkholderia pseudomallei Pakistan 9]
          Length = 760

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 169/293 (57%), Gaps = 17/293 (5%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE- 112
           +I + +GS      I+IV   +  V LR G+ K  V   G+H    +P +  EIV   + 
Sbjct: 95  LIAIYLGS-----GIFIVQDGQTGVVLRLGQYKGSVG-DGVHWRLPYPFESHEIVDTAQV 148

Query: 113 RQQKIGG----RSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
           R  +IG     R A+V   S  +LT D +IV + F+V Y V  P  YLF+  +P  ++ Q
Sbjct: 149 RSIEIGRNNVVRLANVKDAS--MLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPERSVSQ 206

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
            +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  SPP +
Sbjct: 207 AAQAAVREIVGARRADEVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVSPPEQ 266

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+G+A+
Sbjct: 267 VQAAVDDIAKARQDSEAAKSAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAEGDAE 326

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
           RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K   SV+ YLPL++
Sbjct: 327 RFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVL-YLPLDK 378


>gi|76810887|ref|YP_333743.1| ftsH protease activity modulator HflK [Burkholderia pseudomallei
           1710b]
 gi|254189051|ref|ZP_04895562.1| HflK protein [Burkholderia pseudomallei Pasteur 52237]
 gi|76580340|gb|ABA49815.1| ftsH protease activity modulator HflK [Burkholderia pseudomallei
           1710b]
 gi|157936730|gb|EDO92400.1| HflK protein [Burkholderia pseudomallei Pasteur 52237]
          Length = 442

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 169/293 (57%), Gaps = 17/293 (5%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE- 112
           +I + +GS      I+IV   +  V LR G+ K  V   G+H    +P +  EIV   + 
Sbjct: 83  LIAIYLGS-----GIFIVQDGQTGVVLRLGQYKGSVG-DGVHWRLPYPFESHEIVDTAQV 136

Query: 113 RQQKIGG----RSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
           R  +IG     R A+V   S  +LT D +IV + F+V Y V  P  YLF+  +P  ++ Q
Sbjct: 137 RSIEIGRNNVVRLANVKDAS--MLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPERSVSQ 194

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
            +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  SPP +
Sbjct: 195 AAQAAVREIVGARRADEVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVSPPEQ 254

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+G+A+
Sbjct: 255 VQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAEGDAE 314

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
           RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K   SV+ YLPL++
Sbjct: 315 RFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVL-YLPLDK 366


>gi|167002235|ref|ZP_02268025.1| HflK protein [Burkholderia mallei PRL-20]
 gi|243062052|gb|EES44238.1| HflK protein [Burkholderia mallei PRL-20]
          Length = 453

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 169/293 (57%), Gaps = 17/293 (5%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE- 112
           +I + +GS      I+IV   +  V LR G+ K  V   G+H    +P +  EIV   + 
Sbjct: 83  LIAIYLGS-----GIFIVQDGQTGVVLRLGQYKGSVG-DGVHWRLPYPFESHEIVDTAQV 136

Query: 113 RQQKIGG----RSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
           R  +IG     R A+V   S  +LT D +IV + F+V Y V  P  YLF+  +P  ++ Q
Sbjct: 137 RSIEIGRNNVVRLANVKDAS--MLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPERSVSQ 194

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
            +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  SPP +
Sbjct: 195 AAQAAVREIVGARRADEVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVSPPEQ 254

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+G+A+
Sbjct: 255 VQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAEGDAE 314

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
           RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K   SV+ YLPL++
Sbjct: 315 RFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVL-YLPLDK 366


>gi|167738273|ref|ZP_02411047.1| HflK protein [Burkholderia pseudomallei 14]
          Length = 378

 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 169/293 (57%), Gaps = 17/293 (5%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE- 112
           +I + +GS      I+IV   +  V LR G+ K  V   G+H    +P +  EIV   + 
Sbjct: 83  LIAIYLGS-----GIFIVQDGQTGVVLRLGQYKGSVG-DGVHWRLPYPFESHEIVDTAQV 136

Query: 113 RQQKIGG----RSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
           R  +IG     R A+V   S  +LT D +IV + F+V Y V  P  YLF+  +P  ++ Q
Sbjct: 137 RSIEIGRNNVVRLANVKDAS--MLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPERSVSQ 194

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
            +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  SPP +
Sbjct: 195 AAQAAVREIVGARRADEVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVSPPEQ 254

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+G+A+
Sbjct: 255 VQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAEGDAE 314

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
           RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K   SV+ YLPL++
Sbjct: 315 RFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVL-YLPLDK 366


>gi|167845413|ref|ZP_02470921.1| ftsH protease activity modulator HflK [Burkholderia pseudomallei
           B7210]
          Length = 384

 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 169/293 (57%), Gaps = 17/293 (5%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE- 112
           +I + +GS      I+IV   +  V LR G+ K  V   G+H    +P +  EIV   + 
Sbjct: 83  LIAIYLGS-----GIFIVQDGQTGVVLRLGQYKGSVG-DGVHWRLPYPFESHEIVDTAQV 136

Query: 113 RQQKIGG----RSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
           R  +IG     R A+V   S  +LT D +IV + F+V Y V  P  YLF+  +P  ++ Q
Sbjct: 137 RSIEIGRNNVVRLANVKDAS--MLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPERSVSQ 194

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
            +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  SPP +
Sbjct: 195 AAQAAVREIVGARRADEVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVSPPEQ 254

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+G+A+
Sbjct: 255 VQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAEGDAE 314

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
           RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K   SV+ YLPL++
Sbjct: 315 RFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVL-YLPLDK 366


>gi|53723530|ref|YP_102998.1| ftsH protease activity modulator HflK [Burkholderia mallei ATCC
           23344]
 gi|121600959|ref|YP_993146.1| HflK protein [Burkholderia mallei SAVP1]
 gi|126450029|ref|YP_001080653.1| HflK protein [Burkholderia mallei NCTC 10247]
 gi|52426953|gb|AAU47546.1| ftsH protease activity modulator HflK [Burkholderia mallei ATCC
           23344]
 gi|121229769|gb|ABM52287.1| HflK protein [Burkholderia mallei SAVP1]
 gi|126242899|gb|ABO05992.1| HflK protein [Burkholderia mallei NCTC 10247]
          Length = 437

 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 169/293 (57%), Gaps = 17/293 (5%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE- 112
           +I + +GS      I+IV   +  V LR G+ K  V   G+H    +P +  EIV   + 
Sbjct: 83  LIAIYLGS-----GIFIVQDGQTGVVLRLGQYKGSVG-DGVHWRLPYPFESHEIVDTAQV 136

Query: 113 RQQKIGG----RSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
           R  +IG     R A+V   S  +LT D +IV + F+V Y V  P  YLF+  +P  ++ Q
Sbjct: 137 RSIEIGRNNVVRLANVKDAS--MLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPERSVSQ 194

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
            +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  SPP +
Sbjct: 195 AAQAAVREIVGARRADEVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVSPPEQ 254

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+G+A+
Sbjct: 255 VQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAEGDAE 314

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
           RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K   SV+ YLPL++
Sbjct: 315 RFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVL-YLPLDK 366


>gi|167719276|ref|ZP_02402512.1| HflK protein [Burkholderia pseudomallei DM98]
          Length = 386

 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 169/293 (57%), Gaps = 17/293 (5%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE- 112
           +I + +GS      I+IV   +  V LR G+ K  V   G+H    +P +  EIV   + 
Sbjct: 83  LIAIYLGS-----GIFIVQDGQTGVVLRLGQYKGSVG-DGVHWRLPYPFESHEIVDTAQV 136

Query: 113 RQQKIGG----RSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
           R  +IG     R A+V   S  +LT D +IV + F+V Y V  P  YLF+  +P  ++ Q
Sbjct: 137 RSIEIGRNNVVRLANVKDAS--MLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPERSVSQ 194

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
            +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  SPP +
Sbjct: 195 AAQAAVREIVGARRADEVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVSPPEQ 254

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+G+A+
Sbjct: 255 VQAAVDDIAKARQDSEAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAEGDAE 314

Query: 289 RFLSIYGQYVNAPTLLRKRIYLETMEGILKKAKKVIIDKK--QSVMPYLPLNE 339
           RF  +Y QY  AP ++R+R+YLETM+ I     KV +  K   SV+ YLPL++
Sbjct: 315 RFKQVYAQYSKAPAVIRERMYLETMQEIYSNTTKVYVGNKAGNSVL-YLPLDK 366


>gi|167823874|ref|ZP_02455345.1| ftsH protease activity modulator HflK [Burkholderia pseudomallei 9]
          Length = 377

 Score =  152 bits (385), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 169/293 (57%), Gaps = 17/293 (5%)

Query: 55  IILLLIGSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMF-WPIDQVEIVKVIE- 112
           +I + +GS      I+IV   +  V LR G+ K  V   G+H    +P +  EIV   + 
Sbjct: 83  LIAIYLGS-----GIFIVQDGQTGVVLRLGQYKGSVG-DGVHWRLPYPFESHEIVDTAQV 136

Query: 113 RQQKIGG----RSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQ 168
           R  +IG     R A+V   S  +LT D +IV + F+V Y V  P  YLF+  +P  ++ Q
Sbjct: 137 RSIEIGRNNVVRLANVKDAS--MLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPERSVSQ 194

Query: 169 VSESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
            +++A+RE+VG R A ++    R  +   +   IQ+ +D Y++G+++  ++++  SPP +
Sbjct: 195 AAQAAVREIVGARRADEVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVSPPEQ 254

Query: 229 VADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEAD 288
           V  A D++ +A QD +     +  Y++ +L  A+G+A+ + + + +Y +R++ +A+G+A+
Sbjct: 255 VQAAVDDIAKARQDSEAAKSAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAEGDAE 314

Query: 289 RFL