RPSBLAST alignment of GI: 254780958 and protein with PDBid: 2rpb

>2rpb_A Hypothetical membrane protein; SPFH domain; NMR {Pyrococcus horikoshii} Length = 113
 Score = 70.4 bits (172), Expect = 5e-13
 Identities = 21/98 (21%), Positives = 47/98 (47%), Gaps = 3/98 (3%)

Query: 131 ILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGRRFAVDIFRSQ 190
           ++  D  +V +   V Y V DP   ++N+ +    + +++++ +R ++G     +   S 
Sbjct: 19  VICKDNVVVTVDAVVYYQVIDPVKAVYNVSDFLMAIVKLAQTNLRAIIGEMELDETL-SG 77

Query: 191 RQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPRE 228
           R  I   +R  + K  D +  G+ I  + I+   PP++
Sbjct: 78  RDIINARLREELDKITDRW--GVKITRVEIQRIDPPKD 113