RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780958|ref|YP_003065371.1| HflK protein [Candidatus Liberibacter asiaticus str. psy62] (355 letters) >d1wina_ d.43.2.1 (A:) Flotillin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 143 Score = 51.2 bits (122), Expect = 1e-07 Identities = 18/121 (14%), Positives = 42/121 (34%), Gaps = 12/121 (9%) Query: 131 ILTGDQNIVGLHFSVLYVVTDPRLYLFN---------LENPGETLKQVSESAMREVVGRR 181 + T + + + + + L +++ + Q E +R ++G Sbjct: 24 VETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTL 83 Query: 182 FAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAEQ 241 I++ R Q A VR + + GI I + +I+D + + + Q + Sbjct: 84 TVEQIYQ-DRDQFAKLVREVAAPDVGRM--GIEILSFTIKDVYDKVDYLSSLGKTQTSGP 140 Query: 242 D 242 Sbjct: 141 S 141 >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Score = 33.4 bits (74), Expect = 0.029 Identities = 9/54 (16%), Positives = 18/54 (33%) Query: 108 VKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLEN 161 + ++E IGGR + G + G++ + + L N Sbjct: 27 LLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRN 80 >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Score = 29.5 bits (64), Expect = 0.39 Identities = 9/40 (22%), Positives = 20/40 (50%) Query: 108 VKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLY 147 V ++E + ++GGR A+ + + G + GL + + Sbjct: 31 VTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMA 70 >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Score = 28.9 bits (63), Expect = 0.63 Identities = 6/49 (12%), Positives = 16/49 (32%) Query: 108 VKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYL 156 ++E ++GG + L+ G + + + + L Sbjct: 26 AVLLESSARLGGAVGTHALAGYLVEQGPNSFLDREPATRALAAALNLEG 74 >d1r7ma2 d.95.2.1 (A:121-225) DNA endonuclease I-SceI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 105 Score = 28.2 bits (63), Expect = 1.1 Identities = 11/47 (23%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Query: 29 DVEAIIRYIKDKFDLIPFFKSYGSVYIILLLIGSFCAFQSI---YIV 72 +VE +++ +++KF L + K + II + S+ F ++ Y++ Sbjct: 51 EVEYLVKGLRNKFQLNCYVKINKNKPIIYIDSMSYLIFYNLIKPYLI 97 >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Score = 27.9 bits (60), Expect = 1.5 Identities = 10/39 (25%), Positives = 15/39 (38%) Query: 108 VKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVL 146 V V E + K GG+ SV + + G + V Sbjct: 27 VTVFEAEGKAGGKLRSVSQDGLIWDEGANTMTESEGDVT 65 >d1j5xa_ c.80.1.1 (A:) Hypothetical protein TM0813 {Thermotoga maritima [TaxId: 2336]} Length = 329 Score = 27.3 bits (59), Expect = 2.2 Identities = 7/43 (16%), Positives = 16/43 (37%) Query: 226 PREVADAFDEVQRAEQDEDRFVEESNKYSNRVLGSARGEASHI 268 E+ F+ + + F E ++ VL G + ++ Sbjct: 11 KNELKKFFENFVLNLEKTEIFSEIQKNLTDEVLFVGCGSSYNL 53 >d1l2pa_ f.23.21.1 (A:) F1F0 ATP synthase subunit B, membrane domain {Escherichia coli [TaxId: 562]} Length = 61 Score = 26.9 bits (60), Expect = 2.5 Identities = 11/31 (35%), Positives = 18/31 (58%) Query: 258 LGSARGEASHIRESSIAYKDRIIQEAQGEAD 288 L A+ EA I E + + +I+ EA+ EA+ Sbjct: 4 LKKAKAEAQVIIEQANKRRSQILDEAKAEAE 34 >d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Score = 26.7 bits (57), Expect = 3.0 Identities = 11/71 (15%), Positives = 22/71 (30%) Query: 108 VKVIERQQKIGGRSASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLK 167 V ++R GG S+S+ L + L L G+ +K Sbjct: 32 VLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPETMGRGRDWNVDLIPKFLMANGQLVK 91 Query: 168 QVSESAMREVV 178 + + + + Sbjct: 92 MLLYTEVTRYL 102 >d1g9ka2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]} Length = 242 Score = 26.4 bits (57), Expect = 3.5 Identities = 6/33 (18%), Positives = 11/33 (33%) Query: 1 MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAI 33 MSY + + +G D+ A+ Sbjct: 205 MSYWSEKNTGQVFTKTGEGAYASAPLLDDIAAV 237 >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Score = 26.2 bits (56), Expect = 4.2 Identities = 6/22 (27%), Positives = 14/22 (63%) Query: 108 VKVIERQQKIGGRSASVGSNSG 129 V V+E + ++GGR+ ++ + Sbjct: 25 VVVLEARDRVGGRTYTLRNQKV 46 >d1t95a1 a.5.8.1 (A:87-161) Hypothetical protein AF0491, middle domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 75 Score = 25.4 bits (56), Expect = 8.2 Identities = 8/33 (24%), Positives = 16/33 (48%), Gaps = 4/33 (12%) Query: 171 ESAMREVVGRRFAVDIFRSQRQQIALEVRNLIQ 203 E A+ E + +DIF+S Q ++ ++ Sbjct: 46 ERALEEA---KVHIDIFKSVEAQ-VKDIVKALK 74 >d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Length = 87 Score = 25.1 bits (54), Expect = 9.9 Identities = 4/16 (25%), Positives = 9/16 (56%) Query: 28 FDVEAIIRYIKDKFDL 43 + AI Y+ ++ D+ Sbjct: 72 SQMPAIAIYLGERLDI 87 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.320 0.138 0.394 Gapped Lambda K H 0.267 0.0397 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,335,040 Number of extensions: 63582 Number of successful extensions: 190 Number of sequences better than 10.0: 1 Number of HSP's gapped: 190 Number of HSP's successfully gapped: 17 Length of query: 355 Length of database: 2,407,596 Length adjustment: 86 Effective length of query: 269 Effective length of database: 1,226,816 Effective search space: 330013504 Effective search space used: 330013504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.1 bits)