RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780959|ref|YP_003065372.1| putative hydrolase serine protease transmembrane protein [Candidatus Liberibacter asiaticus str. psy62] (302 letters) >gnl|CDD|48217 cd03405, Band_7_HflC, Band_7_HflC: The band 7 domain of flotillin (reggie) like proteins. This group includes proteins similar to prokaryotic HlfC (High frequency of lysogenization C). Although many members of the band 7 family are lipid raft associated, prokaryote plasma membranes lack cholesterol and are unlikely to have lipid raft domains. Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Escherichia coli HflC is an integral membrane protein which may localize to the plasma membrane. HflC associates with another band 7 family member (HflK) to form an HflKC complex. HflKC interacts with FtsH in a large complex termed the FtsH holo-enzyme. FtsH is an AAA ATP-dependent protease which exerts progressive proteolysis against membrane-embedded and soluble substrate proteins. HflKC can modulate the activity of FtsH. HflKC plays a role in the decision between lysogenic and lytic cycle growth during lambda phage infection.. Length = 242 Score = 234 bits (599), Expect = 2e-62 Identities = 101/246 (41%), Positives = 153/246 (62%), Gaps = 4/246 (1%) Query: 24 FFIVDARQQAIVTRFGKIHATYREPGIYFKMPFSFMNVDRVKYLQKQIMRLNLDNIRVQV 83 FIVD +QA+V RFG++ EPG++FK+PF + +VK K+I+ L+ D RV Sbjct: 1 LFIVDEGEQAVVLRFGEVVRVVTEPGLHFKLPF----IQQVKKFDKRILTLDSDPQRVLT 56 Query: 84 SDGKFYEVDAMMTYRIIDPSLFCQSVSCDRIAAESRLRTRLDASIRRVYGLRRFDDALSK 143 D K VDA +RI DP F Q+V + AAE+RL +++++R +G R + +S Sbjct: 57 KDKKRLIVDAYAKWRITDPLRFYQAVGGEERAAETRLDQIVNSALRAEFGKRTLIELVSG 116 Query: 144 QREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQEVSQQTYDRMKAERLAEAEFIRAR 203 +R ++M E+ + +A++LGI + DVR+ R DL +EVS+ Y RM+AER A RA Sbjct: 117 ERGELMEEIRRAVAEEAKELGIEVVDVRIKRIDLPEEVSESVYRRMRAERERIAAEFRAE 176 Query: 204 GREEGQKRMSIADRKATQILSEARRDSEINYGKGEAERGRILSNVFQKDPEFFEFYRSMR 263 G EE ++ + ADR+ T IL+EA R+++ G+G+AE RI + + KDPEF+ FYRS+ Sbjct: 177 GEEEAERIRADADRERTVILAEAYREAQEIRGEGDAEAARIYAEAYGKDPEFYAFYRSLE 236 Query: 264 AYTDSL 269 AY +S Sbjct: 237 AYRNSF 242 >gnl|CDD|30678 COG0330, HflC, Membrane protease subunits, stomatin/prohibitin homologs [Posttranslational modification, protein turnover, chaperones]. Length = 291 Score = 170 bits (431), Expect = 5e-43 Identities = 74/280 (26%), Positives = 137/280 (48%), Gaps = 8/280 (2%) Query: 7 ISFFLFIFLLLGLSFSSFFIVDARQQAIVTRFGKIHATYREPGIYFKMPFSFMNVDRVKY 66 I + + +L+ L FSS F+V ++ +V RFG+ T EPG++FK+PF + V Sbjct: 4 ILIIILLVILIVLLFSSIFVVKEGERGVVLRFGRYTRTLGEPGLHFKIPFPEAIEEVVVR 63 Query: 67 LQKQIMRLNL-DNIRVQVSDGKFYEVDAMMTYRIIDPSLFCQSVSCDRIAAESRLRTRLD 125 + + L++ V D VDA++ YR+ DP +V AE+ LR + Sbjct: 64 VDLRERTLDVGPPQEVITKDNVIVSVDAVVQYRVTDPQKAVYNVE----NAEAALRQLVQ 119 Query: 126 ASIRRVYGLRRFDDALSKQREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQEVSQQT 185 +++R V G D+ L+++R ++ ++ E L A+ GI + DV + D +EV Sbjct: 120 SALRSVIGRMTLDELLTERRAEINAKIREILDEAADPWGIKVVDVEIKDIDPPEEVQAAM 179 Query: 186 YDRMKAERLAEAEFIRARGREEGQKRMSIADRKATQILSEARRDSEINYGKGEAERGRIL 245 +M AER AE + A G + + + +A IL+EA ++E+ + EA+ +I+ Sbjct: 180 EKQMAAERDKRAEILEAEGEAQAAILRAEGEAEAAIILAEAEAEAEV-IARAEADAAKII 238 Query: 246 SNVFQKDP--EFFEFYRSMRAYTDSLASSDTFLVLSPDSD 283 + ++ P R + + + ++ +V+ P+S Sbjct: 239 AAALREAPAAPQALAQRYLEELLEIALAGNSKVVVVPNSA 278 >gnl|CDD|144658 pfam01145, Band_7, SPFH domain / Band 7 family. This family has been called SPFH, Band 7 or PHB domain. Length = 177 Score = 96.7 bits (241), Expect = 6e-21 Identities = 53/182 (29%), Positives = 89/182 (48%), Gaps = 9/182 (4%) Query: 25 FIVDARQQAIVTRFGKIHATYREPGIYFKMPFSFMNVDRVKYLQKQIMRLNL-DNIRVQV 83 IV + +VTRFGK+ PG++FK+PF ++ + + ++ L + + V Sbjct: 1 KIVPPGEVGVVTRFGKVSRV-LGPGLHFKLPF----IETIYVVDTRLQTLEVTVQLEVLT 55 Query: 84 SDGKFYEVDAMMTYRIIDPSLFCQSVSCDRIAAESRLRTRLDASIRRVYGLRRFDDALSK 143 DG VD + YR+ DP+ + + LR + +++R V D+ LS Sbjct: 56 KDGVPVTVDVTVQYRVEDPAKLVANYG-GEDDLQELLRPLVRSALREVIARYTLDELLSN 114 Query: 144 QREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQEVSQQTYDRMKAE-RLAEAEFIRA 202 RE++ EV E L+ + +K GI IEDV++ D E+++ ++ AE EAE RA Sbjct: 115 -REEIAQEVKEALQEELDKYGIEIEDVQITDIDPPPEIAEAIEEKQAAEQEAEEAEIERA 173 Query: 203 RG 204 Sbjct: 174 EA 175 >gnl|CDD|48216 cd03404, Band_7_HflK, Band_7_HflK: The band 7 domain of flotillin (reggie) like proteins. This group includes proteins similar to prokaryotic HlfK (High frequency of lysogenization K). Although many members of the band 7 family are lipid raft associated, prokaryote plasma membranes lack cholesterol and are unlikely to have lipid raft domains. Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Escherichia coli HflK is an integral membrane protein which may localize to the plasma membrane. HflK associates with another band 7 family member (HflC) to form an HflKC complex. HflKC interacts with FtsH in a large complex termed the FtsH holo-enzyme. FtsH is an AAA ATP-dependent protease which exerts progressive proteolysis against membrane-embedded and soluble substrate proteins. HflKC can modulate the activity of FtsH. HflKC plays a role in the decision between lysogenic and lytic cycle growth during lambda phage infection.. Length = 266 Score = 96.0 bits (239), Expect = 1e-20 Identities = 70/265 (26%), Positives = 118/265 (44%), Gaps = 34/265 (12%) Query: 10 FLFIFLLLGLSFSSFFIVDARQQAIVTRFGKIHATYREPGIYFKMPFSFMNVDRVKYLQK 69 + L++ S F+IV ++ +V RFGK T EPG+++K+P+ V+ V Q Sbjct: 1 LIAALLVILWLLSGFYIVQPGERGVVLRFGKYSRT-VEPGLHWKLPYPIEVVEVVPVFQL 59 Query: 70 QIMRLNLDNIRVQ---------VSDGKFYEVDAMMTYRIIDPSLFCQSVSCDRIAAESRL 120 + + + + V+ D +V+ + YRI DP + +V E L Sbjct: 60 RSVGIPVRVGSVRSVPGESLMLTGDENIVDVEFAVQYRISDPYDYLFNVR----DPEGTL 115 Query: 121 RTRLDASIRRVYGLRRFDDALSKQREKMMMEVCEDL--RYDAEKLGISIEDVRVLRTDLT 178 R ++++R V G DD L++ RE++ +V E L DA K GI I V + D Sbjct: 116 RQAAESAMREVVGRSTLDDVLTEGREEIAQDVRELLQAILDAYKAGIEIVGVNLQDADPP 175 Query: 179 QEV---------SQQTYDRMKAERLAEAEFIRARGREEGQKRMSIADRKATQILSEARRD 229 +EV ++Q +R+ E A A + + R E + + A EA ++ Sbjct: 176 EEVQDAFDDVNKARQDRERLINEAEAYANEVVPKARGEAARIIQEA---------EAYKE 226 Query: 230 SEINYGKGEAERGRILSNVFQKDPE 254 I +GEA R L ++K P+ Sbjct: 227 EVIAEAQGEAARFESLLAEYKKAPD 251 >gnl|CDD|48215 cd03403, Band_7_stomatin_like, Band_7_stomatin_like: A subgroup of the band 7 domain of flotillin (reggie) like proteins similar to stomatin and podicin (two lipid raft-associated integral membrane proteins). Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Stomatin is widely expressed and, highly expressed in red blood cells. It localizes predominantly to the plasma membrane and to intracellular vesicles of the endocytic pathway, where it is present in higher order homo-oligomeric complexes (of between 9 and 12 monomers). Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons and, is implicated in trafficking of Glut1 glucose transporters. Prohibitin is a mitochondrial inner-membrane protein hypothesized to act as a chaperone for the stabilization of mitochondrial proteins. Podicin localizes to the plasma membrane of podocyte foot processes and, is found in higher order oligomers. Podocin plays a role in regulating glomerular permeability. Mutations in the podicin gene give rise to autosomal recessive steroid resistant nephritic syndrome. This group also contains proteins similar to three Caenorhabditis elegans proteins: UNC-1, UNC-24 and, MEC-2. Mutations in the unc-1 and unc-24 genes result in abnormal motion and altered patterns of sensitivity to volatile anesthetics. MEC-2 and UNC-24 proteins interact with MEC-4 which is part of the degenerin channel complex required for response to gentle body touch.. Length = 215 Score = 78.6 bits (194), Expect = 2e-15 Identities = 60/208 (28%), Positives = 98/208 (47%), Gaps = 22/208 (10%) Query: 27 VDARQQAIVTRFGKIHATYREPGIYFKMPFSFMNVDRVKYLQK-QIMRLNLDNIRVQVSD 85 V ++ +V R GK H T PG++F +PF +DR+ Y + L++ V D Sbjct: 1 VPQYERGVVERLGKYHRT-LGPGLHFIIPF----IDRIAYKVDLREQVLDVPPQEVITKD 55 Query: 86 GKFYEVDAMMTYRIIDPSLFCQSVSCDRIAAESRLRTRLDASIRRVYGLRRFDDALSKQR 145 VDA++ YR++DP V R A +T ++R V G D+ LS +R Sbjct: 56 NVTVRVDAVLYYRVVDPVKAVYGVEDYRYAISQLAQT----TLRSVIGKMELDELLS-ER 110 Query: 146 EKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQEVSQQTYDRMKAERLAEAEFIRARGR 205 E++ E+ E L + G+ +E V + L QE+ + + +AER A+ I A G Sbjct: 111 EEINAELVEILDEATDPWGVKVERVEIKDIILPQEIQEAMAKQAEAEREKRAKIIEAEG- 169 Query: 206 EEGQKRMSIADRKATQILSEARRDSEIN 233 +R+A +L+EA + + IN Sbjct: 170 ----------ERQAAILLAEAAKQAAIN 187 >gnl|CDD|37831 KOG2620, KOG2620, KOG2620, Prohibitins and stomatins of the PID superfamily [Energy production and conversion]. Length = 301 Score = 65.0 bits (158), Expect = 3e-11 Identities = 47/218 (21%), Positives = 89/218 (40%), Gaps = 13/218 (5%) Query: 26 IVDARQQAIVTRFGKIHATYREPGIYFKMPFSFMNVDRVKYLQKQIMRLNLD-NIRVQVS 84 V ++ A+V RFGK H EPG++F P +D++ Y+ LD Sbjct: 11 FVPQQEAAVVERFGKFHRIL-EPGLHFLPPV----IDKIAYVHSLKEIAILDPKQEAITK 65 Query: 85 DGKFYEVDAMMTYRIIDPSLFCQS--VSCDRIAAESRLRTRLDASIRRVYGLRRFDDALS 142 D F ++D ++ YR++DP S V A + +T + + + ++ D + Sbjct: 66 DNVFVQIDGVLYYRVVDPYADDASYGVENPEYAIQQLAQTTMRSEVGKLTL-----DKVF 120 Query: 143 KQREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQEVSQQTYDRMKAERLAEAEFIRA 202 ++R + + E + E G + + V + + +AER+ A + + Sbjct: 121 EERNSLNKSIVEAINKAMEAWGYECLRYEIRDIEPPPSVKRAMNMQNEAERMKRAAILES 180 Query: 203 RGREEGQKRMSIADRKATQILSEARRDSEINYGKGEAE 240 G Q + ++++ + SE N GEAE Sbjct: 181 EGERIAQINRAEGEKESKILASEGIARQRQNIADGEAE 218 >gnl|CDD|48210 cd02106, Band_7, The band 7 domain of flotillin (reggie) like proteins. This group contains proteins similar to stomatin, prohibitin, flotillin, HlfK/C and podicin. Many of these band 7 domain-containing proteins are lipid raft-associated. Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Microdomains formed from flotillin proteins may in addition be dynamic units with their own regulatory functions. Flotillins have been implicated in signal transduction, vesicle trafficking, cytoskeleton rearrangement and are known to interact with a variety of proteins. Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons and participates in trafficking of Glut1 glucose transporters. Prohibitin may act as a chaperone for the stabilization of mitochondrial proteins. Prokaryotic HflK/C plays a role in the decision between lysogenic and lytic cycle growth during lambda phage infection. Flotillins have been implicated in the progression of prion disease, in the pathogenesis of neurodegenerative diseases such as Parkinson's and Alzheimer's disease and, in cancer invasion and metastasis. Mutations in the podicin gene give rise to autosomal recessive steroid resistant nephritic syndrome. Length = 121 Score = 61.6 bits (149), Expect = 3e-10 Identities = 36/121 (29%), Positives = 58/121 (47%), Gaps = 3/121 (2%) Query: 69 KQIMRLNLDNIRVQVSDGKFYEVDAMMTYRIIDPSLFCQSVSCDRIAAESRLRTRLDASI 128 + L++ V D VDA++ YR++DP +V E LR +++ Sbjct: 4 LRRQTLDVPPQEVLTKDNVPVRVDAVVQYRVVDPVKALYNV--RDPEDEEALRQLAQSAL 61 Query: 129 RRVYGLRRFDDALSKQREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQEVSQQTYDR 188 R V G D+ L + R+++ EV E L+ D +K GI + DVR+ D +EV + DR Sbjct: 62 RSVIGKMTLDE-LLEDRDEIAAEVREALQEDLDKYGIEVVDVRIKDIDPPEEVQEAMEDR 120 Query: 189 M 189 Sbjct: 121 Q 121 >gnl|CDD|37832 KOG2621, KOG2621, KOG2621, Prohibitins and stomatins of the PID superfamily [Energy production and conversion]. Length = 288 Score = 57.2 bits (138), Expect = 6e-09 Identities = 60/229 (26%), Positives = 102/229 (44%), Gaps = 27/229 (11%) Query: 7 ISFFLFIFLLLGLSFSSFF---IVDARQQAIVTRFGKI-HATYREPGIYFKMPF--SFMN 60 + F+ +L+ S +F IV ++A++ R G++ R PG++F +P +F Sbjct: 35 LVILSFLLVLMTFPISIWFCLKIVQEYERAVIFRLGRLRTGGARGPGLFFLLPCIDTFRK 94 Query: 61 VDRVKYLQKQIMRLNLDNIRVQ---VSDGKFYEVDAMMTYRIIDPSLFCQSVSCDRIAAE 117 VD +R N+ Q D VDA++ YRI DP + +V D A Sbjct: 95 VD---------LRTQSFNVPPQEILTKDSVTISVDAVVYYRISDPIIAVNNVG-DADNAT 144 Query: 118 SRLRTRLDASIRRVYGLRRFDDALSKQREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDL 177 L ++R G + + LS RE + E + L E G+ +E V + L Sbjct: 145 RLLAQ---TTLRNYLGTKTLSEILS-SREVIAQEAQKALDEATEPWGVKVERVEIKDVRL 200 Query: 178 TQEVSQQTYDRMKAERLAEAEFIRARGREEGQKRMSIADRKATQILSEA 226 ++ + +A R A A+ I A EG+K+ S A ++A ++SE+ Sbjct: 201 PAQLQRAMAAEAEATREARAKVIAA----EGEKKASEALKEAADVISES 245 >gnl|CDD|48214 cd03402, Band_7_2, A subgroup of the band 7 domain of flotillin (reggie) like proteins. This subgroup contains proteins similar to stomatin, prohibitin, flotillin, HlfK/C and podicin. Many of these band 7 domain-containing proteins are lipid raft-associated. Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Microdomains formed from flotillin proteins may in addition be dynamic units with their own regulatory functions. Flotillins have been implicated in signal transduction, vesicle trafficking, cytoskeleton rearrangement and are known to interact with a variety of proteins. Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons and participates in trafficking of Glut1 glucose transporters. Prohibitin may act as a chaperone for the stabilization of mitochondrial proteins. Prokaryotic HflK/C plays a role in the decision between lysogenic and lytic cycle growth during lambda phage infection. Flotillins have been implicated in the progression of prion disease, in the pathogenesis of neurodegenerative diseases such as Parkinson's and Alzheimer's disease and, in cancer invasion and metastasis. Mutations in the podicin gene give rise to autosomal recessive steroid resistant nephritic syndrome.. Length = 219 Score = 54.1 bits (130), Expect = 4e-08 Identities = 34/181 (18%), Positives = 81/181 (44%), Gaps = 15/181 (8%) Query: 23 SFFIVDARQQAIVTRFGKIHATYREPGIYFKMPFSFMNVDRVKYLQKQIMRLNLDNIRVQ 82 F+V+ Q ++ FG+ T R G+ + PFS K + ++ + ++V Sbjct: 1 GLFVVEPNQARVLVLFGRYIGTIRRTGLRWVNPFSSK-----KRVSLRVRNFESEKLKVN 55 Query: 83 VSDGKFYEVDAMMTYRIIDPSLFCQSVSCDRIAAESRLRTRLDASIRRVYGLRRFDDALS 142 ++G E+ A++ +R++D + +V E + + ++++R V +DD ++ Sbjct: 56 DANGNPIEIAAVIVWRVVDTAKAVFNVD----DYEEFVHIQSESALRHVASQYPYDDPVN 111 Query: 143 KQR------EKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQEVSQQTYDRMKAERLAE 196 K+ +++ E+ +L+ G+ + + R+ E++Q R +A + Sbjct: 112 KETSLRGNSDEVSDELARELQERLAVAGVEVVEARITHLAYAPEIAQAMLQRQQASAIIA 171 Query: 197 A 197 A Sbjct: 172 A 172 >gnl|CDD|48220 cd03408, Band_7_5, A subgroup of the band 7 domain of flotillin (reggie) like proteins. This subgroup contains proteins similar to stomatin, prohibitin, flotillin, HlfK/C and podicin. Many of these band 7 domain-containing proteins are lipid raft-associated. Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Microdomains formed from flotillin proteins may in addition be dynamic units with their own regulatory functions. Flotillins have been implicated in signal transduction, vesicle trafficking, cytoskeleton rearrangement and are known to interact with a variety of proteins. Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons and participates in trafficking of Glut1 glucose transporters. Prohibitin may act as a chaperone for the stabilization of mitochondrial proteins. Prokaryotic HflK/C plays a role in the decision between lysogenic and lytic cycle growth during lambda phage infection. Flotillins have been implicated in the progression of prion disease, in the pathogenesis of neurodegenerative diseases such as Parkinson's and Alzheimer's disease and, in cancer invasion and metastasis. Mutations in the podicin gene give rise to autosomal recessive steroid resistant nephritic syndrome.. Length = 207 Score = 40.3 bits (94), Expect = 7e-04 Identities = 30/196 (15%), Positives = 54/196 (27%), Gaps = 26/196 (13%) Query: 19 LSFSSFFIVDARQQAIVTRFGKIHATYREPGIYF---------------KMPFSFMNVDR 63 + S IV Q A+ GK+ + G Y K S + Sbjct: 11 IKNGSQLIVREGQAAVFVNEGKVADVFAPGGYYLTTNNLPVLAFLLSGDKGFSSPFKGEV 70 Query: 64 VKYLQKQI--MRLNLDNIRVQVS---DGKFYEVDAMMTYRIIDPSLFCQSV-----SCDR 113 + + + G + ++ DP LF ++ Sbjct: 71 YFFNTRVFTDLLWGTPAPVFGRDSEFGGVPLRAFGTYSLKVTDPVLFVTNIVGTRGLFTV 130 Query: 114 IAAESRLRTRLDASIRRVYG-LRRFDDALSKQREKMMMEVCEDLRYDAEKLGISIEDVRV 172 E LR + A++ L+ R+++ V E L G+ + V + Sbjct: 131 EDLEKSLRALIVAALSSALSESGLAVMLLAANRDELSKAVREALAPWFASFGLELVSVYI 190 Query: 173 LRTDLTQEVSQQTYDR 188 EV + R Sbjct: 191 ESISYPDEVQKLIDKR 206 >gnl|CDD|48219 cd03407, Band_7_4, A subgroup of the band 7 domain of flotillin (reggie) like proteins. This subgroup contains proteins similar to stomatin, prohibitin, flotillin, HlfK/C and podicin. Many of these band 7 domain-containing proteins are lipid raft-associated. Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Microdomains formed from flotillin proteins may in addition be dynamic units with their own regulatory functions. Flotillins have been implicated in signal transduction, vesicle trafficking, cytoskeleton rearrangement and are known to interact with a variety of proteins. Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons and participates in trafficking of Glut1 glucose transporters. Prohibitin may act as a chaperone for the stabilization of mitochondrial proteins. Prokaryotic HflK/C plays a role in the decision between lysogenic and lytic cycle growth during lambda phage infection. Flotillins have been implicated in the progression of prion disease, in the pathogenesis of neurodegenerative diseases such as Parkinson's and Alzheimer's disease and, in cancer invasion and metastasis. Mutations in the podicin gene give rise to autosomal recessive steroid resistant nephritic syndrome.. Length = 262 Score = 40.3 bits (94), Expect = 7e-04 Identities = 53/218 (24%), Positives = 83/218 (38%), Gaps = 35/218 (16%) Query: 31 QQAIVTRFGKIHATYREPGIYFKMPFSFMNVDRVKYLQKQIMRLNLDNIRVQ--VSDGKF 88 Q AI+ RFGK PG +F +P R+ +R+ ++RV+ D F Sbjct: 3 QVAIIERFGKFFKV-AWPGCHFVIPLVETVAGRLS------LRVQQLDVRVETKTKDNVF 55 Query: 89 YEVDAMMTYRIID------PSLFCQSVSCDRIAAESRLRTRLDASIRRVYGLRRFDDALS 142 V + YR+ + + LR R+ L D L Sbjct: 56 VTVVGQIQYRVSEENATDAFYKLGNPEEQIQSYVFDVLRARIPK-----LTL----DELF 106 Query: 143 KQREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQEVSQQTYDRMKAERLAEAEFIRA 202 +Q++++ V E+LR + G I + D EV + + A+R A A Sbjct: 107 EQKDEIAKAVEEELREAMSRYGFEIVATLITDIDPDAEVKRAMNEINAAQRQRVA----A 162 Query: 203 RGREEGQKRMSIADRKATQILSEARRDSEINYGKGEAE 240 + E +K I D KA + +EA+R G G AE Sbjct: 163 VHKAEAEK---IKDIKAAEADAEAKRLQ----GVGAAE 193 >gnl|CDD|38293 KOG3083, KOG3083, KOG3083, Prohibitin [Posttranslational modification, protein turnover, chaperones]. Length = 271 Score = 36.9 bits (85), Expect = 0.007 Identities = 33/110 (30%), Positives = 49/110 (44%), Gaps = 19/110 (17%) Query: 136 RFD-DALSKQREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLT-----------QEVSQ 183 RFD L QRE + +V DL A G+ ++DV T LT ++V+Q Sbjct: 133 RFDAGELITQRELVSRQVSNDLTERAATFGLILDDVS--ITHLTFGKEFTEAVEAKQVAQ 190 Query: 184 QTYDR-----MKAERLAEAEFIRARGREEGQKRMSIADRKATQILSEARR 228 Q +R KAE+ +A I A G + + ++ + A L E RR Sbjct: 191 QEAERARFVVEKAEQQKKAAVISAEGDSKAAELIANSLATAGDGLIELRR 240 >gnl|CDD|38300 KOG3090, KOG3090, KOG3090, Prohibitin-like protein [Posttranslational modification, protein turnover, chaperones]. Length = 290 Score = 34.6 bits (79), Expect = 0.039 Identities = 31/145 (21%), Positives = 58/145 (40%), Gaps = 23/145 (15%) Query: 141 LSKQREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQEVSQQTYDRMKAERLAE-AEF 199 L QRE++ + + L A I+++DV + +E + + A + A+ A+F Sbjct: 150 LITQREQVSRLIRKILTERAADFNIALDDVSITELTFGKEFTAAIEAKQVAAQEAQRAKF 209 Query: 200 IRARGREEGQKRMSIADRKATQILSEARRDSEINYGKGEAERGRILSNVFQKDPEFFEF- 258 I + +E Q S I +GEA+ +++ + +P F Sbjct: 210 IVEKAEQEKQ--------------------SAIVRAQGEAKSAQLIGEAIKNNPAFITLR 249 Query: 259 -YRSMRAYTDSLASSDTFLVLSPDS 282 + R ++ASS + LS D Sbjct: 250 KIEAAREIAQTIASSANKVYLSSDD 274 >gnl|CDD|32449 COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 548 Score = 32.3 bits (73), Expect = 0.14 Identities = 44/254 (17%), Positives = 78/254 (30%), Gaps = 52/254 (20%) Query: 11 LFIFLLLGLSFSSF-FIVDARQQAIVTRFGKIHATYRE---------PGIYFKMPFSFMN 60 + I ++L L F F + AR + R G + E G MP Sbjct: 19 VVILVILVLIFFGKRFYIIARPNEALIRTGSKLGSKDEAGGGQKVVRGGGAIVMPI---- 74 Query: 61 VDRVKYLQKQIMRLNLDNIRVQVSDGKFYEVDAM-MTYRIIDPSLFCQSVSCDRIAAESR 119 + I R++L I+++V Y D M + + + AAE Sbjct: 75 -------FQTIERMSLTTIKLEVEIDNVYTKDGMPLNVEAVAYVKIGDTFQDIATAAERF 127 Query: 120 LRTRLDASIRRVYGLRRFDDAL------------SKQREKMMMEVCEDLRYDAEKLGISI 167 + ++ + AL ++ R V E + D K+G+ + Sbjct: 128 GGKGSREDLEQLAE-DTLEGALRAVLAQMTVEELNEDRLGFAQVVQEVVGDDLSKMGLVL 186 Query: 168 EDVRVLRTDLTQEVSQQTYDRMKAERLAEAEFIRARGREEGQKRMSIADRKATQILSEAR 227 + + + D+ E ++ A GR IA ++E Sbjct: 187 DSLAI--NDINDT---------SKENQDPNNYLDALGRRR------IAQVLQDAEIAENE 229 Query: 228 RDSEINYGKGEAER 241 + E EA R Sbjct: 230 AEKETEIAIAEANR 243 >gnl|CDD|48213 cd03401, Band_7_prohibitin, Band_7_prohibitin. A subgroup of the band 7 domain of flotillin (reggie) like proteins. This subgroup group includes proteins similar to prohibitin (a lipid raft-associated integral membrane protein). Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. These microdomains in addition to being stable scaffolds may also be also dynamic units with their own regulatory functions. Prohibitin is a mitochondrial inner-membrane protein which may act as a chaperone for the stabilization of mitochondrial proteins. Human prohibitin forms a heter-oligomeric complex with Bap-37 (prohibitin 2, a band 7 domain carrying homologue). This complex may protect non-assembled membrane proteins against proteolysis by the m-AAA protease. Prohibitin and Bap-37 yeast homologues have been implicated in yeast longevity and, in the maintenance of mitochondrial morphology.. Length = 196 Score = 32.5 bits (74), Expect = 0.15 Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 18/82 (21%) Query: 144 QREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLT-----------QEVSQQ-----TYD 187 QRE++ + E L A+ GI ++DV + T LT ++V+QQ + Sbjct: 117 QREEVSALIREALTERAKDFGIILDDVSI--THLTFSKEFTKAVEAKQVAQQEAERAKFV 174 Query: 188 RMKAERLAEAEFIRARGREEGQ 209 KAE+ +A IRA G E Sbjct: 175 VEKAEQEKQAAVIRAEGEAEAA 196 >gnl|CDD|48212 cd03400, Band_7_1, A subgroup of the band 7 domain of flotillin (reggie) like proteins. This subgroup contains proteins similar to stomatin, prohibitin, flotillin, HlfK/C and podicin. Many of these band 7 domain-containing proteins are lipid raft-associated. Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Microdomains formed from flotillin proteins may in addition be dynamic units with their own regulatory functions. Flotillins have been implicated in signal transduction, vesicle trafficking, cytoskeleton rearrangement and are known to interact with a variety of proteins. Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons and participates in trafficking of Glut1 glucose transporters. Prohibitin may act as a chaperone for the stabilization of mitochondrial proteins. Prokaryotic HflK/C plays a role in the decision between lysogenic and lytic cycle growth during lambda phage infection. Flotillins have been implicated in the progression of prion disease, in the pathogenesis of neurodegenerative diseases such as Parkinson's and Alzheimer's disease and, in cancer invasion and metastasis. Mutations in the podicin gene give rise to autosomal recessive steroid resistant nephritic syndrome.. Length = 124 Score = 32.6 bits (74), Expect = 0.15 Identities = 19/105 (18%), Positives = 40/105 (38%) Query: 77 DNIRVQVSDGKFYEVDAMMTYRIIDPSLFCQSVSCDRIAAESRLRTRLDASIRRVYGLRR 136 + I V +G D + YRI A +R + +R V G Sbjct: 12 EKIDVLSKEGLSINADVSVQYRINPNKAAAVHSKLGTDYARKIVRPTFRSLVREVTGRYT 71 Query: 137 FDDALSKQREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQEV 181 + S +R+++ + ++L + G+ +E+V + L ++ Sbjct: 72 AEQIYSTKRKEIESAIKKELIEEFVGDGLILEEVLLRNIKLPDQI 116 >gnl|CDD|35385 KOG0163, KOG0163, KOG0163, Myosin class VI heavy chain [Cytoskeleton]. Length = 1259 Score = 31.1 bits (70), Expect = 0.42 Identities = 25/98 (25%), Positives = 45/98 (45%), Gaps = 6/98 (6%) Query: 135 RRFDDALSKQREKMMMEVCEDLRYDAEKLGISIED-VRVLRTDLTQEVSQQTYDRMKAER 193 R+ DD + K KM ++ + + + E V+ L + Q++ + R K + Sbjct: 875 RQIDDLVKKI--KMPRITQREMNSEYDVAVKNYEKLVKRLDSKEQQQIEELERLR-KIQE 931 Query: 194 LAEAEFIRARGREEGQKRMSIADRKATQILSEARRDSE 231 LAEAE R R E ++R ++K + E +R +E Sbjct: 932 LAEAE--RKRREAEEKRRREEEEKKRAKAEMETKRKAE 967 >gnl|CDD|48218 cd03406, Band_7_3, A subgroup of the band 7 domain of flotillin (reggie) like proteins. This subgroup contains proteins similar to stomatin, prohibitin, flotillin, HlfK/C and podicin. Many of these band 7 domain-containing proteins are lipid raft-associated. Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Microdomains formed from flotillin proteins may in addition be dynamic units with their own regulatory functions. Flotillins have been implicated in signal transduction, vesicle trafficking, cytoskeleton rearrangement and are known to interact with a variety of proteins. Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons and participates in trafficking of Glut1 glucose transporters. Prohibitin may act as a chaperone for the stabilization of mitochondrial proteins. Prokaryotic HflK/C plays a role in the decision between lysogenic and lytic cycle growth during lambda phage infection. Flotillins have been implicated in the progression of prion disease, in the pathogenesis of neurodegenerative diseases such as Parkinson's and Alzheimer's disease and, in cancer invasion and metastasis. Mutations in the podicin gene give rise to autosomal recessive steroid resistant nephritic syndrome.. Length = 280 Score = 30.0 bits (67), Expect = 0.79 Identities = 49/267 (18%), Positives = 102/267 (38%), Gaps = 41/267 (15%) Query: 21 FSSFFIVDARQQAIVTRFGKIHATYREPGIYFKMPFSFMNVDRVKYLQKQIMRLNLDNIR 80 S+ ++ + R G + + PG + +PF + K +Q + + N+ Sbjct: 2 SSALHKIEEGHVGVYYRGGALLTSTSGPGFHLMLPF----ITTYKSVQVTLQTDEVKNVP 57 Query: 81 VQVSDGKFYEVDAMMTYRIIDPS-----LFCQSVSCDRIAAESRLRTRLDA-----SIRR 130 S G D + + P + + D+ +++ L+ +++ Sbjct: 58 CGTSGGVMIYFDRIEVVNFLIPDSVYDIVKNYTADYDKTLIFNKIHHELNQFCSVHTLQE 117 Query: 131 VYGLRRFDDALSKQREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQEVSQQTYDRMK 190 VY + FD + E + + + +DL A G+ I+ VRV + + + + ++ Y+ M+ Sbjct: 118 VY-IDLFD----QIDENLKLALQKDLTRMAP--GLEIQAVRVTKPKIPEAI-RRNYELME 169 Query: 191 AERL-------------AEAEFIRARGREEGQKRMSIADRKATQILSEARRDSEINYGKG 237 AE+ EAE R + E +K +A Q + E + I+ + Sbjct: 170 AEKTKLLIAIQKQKVVEKEAETERKKAVIEAEKVAQVAKILFGQKVMEKETEKRISEIED 229 Query: 238 EAERGRILSNVFQKDPEFFEFYRSMRA 264 EA R +K E+Y + + Sbjct: 230 EAFLAR------EKAKADAEYYTAQKE 250 Score = 28.4 bits (63), Expect = 2.7 Identities = 27/115 (23%), Positives = 55/115 (47%), Gaps = 7/115 (6%) Query: 154 EDLRYDAEKLGISIEDVRVLRTDLTQEVSQQTYDRMKAERLAEAEFIRARGREEGQKRMS 213 E + + KL I+I+ +V+ + E + + K ++A+ F + +E +KR+S Sbjct: 166 ELMEAEKTKLLIAIQKQKVVEKEAETERKKAVIEAEKVAQVAKILFGQKVMEKETEKRIS 225 Query: 214 IADRKATQILSEARRDSEINYGKGEAERGRILSNVFQKDPEFFE--FYRSMRAYT 266 + +A +A+ D+E + EAE +N + PE+ E Y ++ A + Sbjct: 226 EIEDEAFLAREKAKADAEYYTAQKEAE-----ANKLKLTPEYLELMKYEAIAANS 275 >gnl|CDD|37110 KOG1899, KOG1899, KOG1899, LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only]. Length = 861 Score = 29.7 bits (66), Expect = 0.89 Identities = 32/136 (23%), Positives = 55/136 (40%), Gaps = 9/136 (6%) Query: 140 ALSKQREKMMMEVCE-DLRYDA-EKLGISIEDVRVLRTDLTQEVSQQTYDRMKAERLAEA 197 +L Q+ +M EV E L+ A EK E L +L QEV+Q + ERL Sbjct: 171 SLETQKLDLMAEVSELKLKLTALEKEQNETEKKLRLSENLMQEVNQSKVGEVVQERLQYE 230 Query: 198 EFIRARGREEGQKRMSIADRKATQILSEARRDSEINYGKGEAERGRI------LSNVFQK 251 +++ E R ++ K + + R + GE + R L ++ + Sbjct: 231 TKLKSTKGEMAPLREQRSE-KNDEEMRLLRTLVQRLMADGEHKSLRDNTLKNALESLMRA 289 Query: 252 DPEFFEFYRSMRAYTD 267 + + F S+R Y + Sbjct: 290 NEQKDRFIESLRNYLN 305 >gnl|CDD|177157 MTH00094, ND4, NADH dehydrogenase subunit 4; Provisional. Length = 403 Score = 29.5 bits (67), Expect = 1.1 Identities = 14/61 (22%), Positives = 23/61 (37%), Gaps = 8/61 (13%) Query: 1 MSNKSCISF-FLFIFLLLGLSFSSFFIVDARQQAIVTRFGKIHATYREPGIYFKMPFSFM 59 K+ SF F+F + L+ +S F IV + + F + +P FM Sbjct: 340 SFMKNKFSFFFIFFYFLVSFYYSLFLIVSSFMGKKFSNFNNF-------NVGLSLPLVFM 392 Query: 60 N 60 Sbjct: 393 M 393 >gnl|CDD|38173 KOG2962, KOG2962, KOG2962, Prohibitin-related membrane protease subunits [General function prediction only]. Length = 322 Score = 28.5 bits (63), Expect = 2.6 Identities = 53/277 (19%), Positives = 106/277 (38%), Gaps = 41/277 (14%) Query: 10 FLFIFLLLGLSFSSFFIVDARQQAIVTRFGKIHATYREPGIYFKMPFSFMNVDRVKYLQK 69 I LL+ S+ ++ + R G + + PG + +PF + K +Q Sbjct: 9 AAAIALLVAFLSSAVHKIEEGHVGVYYRGGALLTSITGPGFHLMLPF----ITTYKSVQV 64 Query: 70 QIMRLNLDNIRVQVSDGKFYEVDAMMTYRIIDPS-----LFCQSVSCDRIAAESRLRTRL 124 + + N+ S G D + + P + +V D+ +++ L Sbjct: 65 TLQTDEVKNVPCGTSGGVLIYFDRIEVVNFLRPDAVYDIVKNYTVDYDKTLIFNKIHHEL 124 Query: 125 DA-----SIRRVYGLRRFDDALSKQREKMMMEVCEDLRYDAEKLGISIEDVRVLRTDLTQ 179 + +++ VY + FD + E + + DL A G+ I+ VRV + + + Sbjct: 125 NQFCSVHTLQEVY-IDLFD----QIDENLKDALQADLTRMAP--GLEIQAVRVTKPKIPE 177 Query: 180 EVSQQTYDRMKAERL-------------AEAEFIRARGREEGQKRMSIADRKATQILSEA 226 + ++ ++ M+AE+ EAE R + E +K +A Q L E Sbjct: 178 AI-RRNFELMEAEKTKLLIAAEKQKVVEKEAETERKKAVIEAEKNAQVAKILMQQKLMEK 236 Query: 227 RRDSEINYGKGEAERGRILSNVFQKDPEFFEFYRSMR 263 + I+ + A R +K E+YR+++ Sbjct: 237 ETEKRISEIEDAAFLAR------EKSKADAEYYRALK 267 >gnl|CDD|177150 MTH00083, COX3, cytochrome c oxidase subunit III; Provisional. Length = 256 Score = 27.6 bits (62), Expect = 4.4 Identities = 12/24 (50%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Query: 1 MSNKSCISFFLFIFLLLGLSFSSF 24 +SNKSC + L + LGL F+SF Sbjct: 149 LSNKSC-TNSLLLTCFLGLYFTSF 171 >gnl|CDD|33674 COG3885, COG3885, Uncharacterized conserved protein [Function unknown]. Length = 261 Score = 27.6 bits (61), Expect = 4.7 Identities = 7/33 (21%), Positives = 18/33 (54%) Query: 248 VFQKDPEFFEFYRSMRAYTDSLASSDTFLVLSP 280 + +D E + ++++ S+T++V+SP Sbjct: 15 IDPEDEESRKLNKAIKEIASDDKGSETYVVISP 47 >gnl|CDD|35900 KOG0681, KOG0681, KOG0681, Actin-related protein - Arp5p [Cytoskeleton]. Length = 645 Score = 27.3 bits (60), Expect = 5.4 Identities = 28/122 (22%), Positives = 53/122 (43%), Gaps = 10/122 (8%) Query: 113 RIAAESRLRTRLDASIRRVYGLRRFDDALSKQREKMMMEVCEDLRYDAEKLGISIEDVRV 172 + + ++RLR R++ + R+ + L ++RE+ ++ E+LR EKL I + Sbjct: 357 KASTDARLRARVEKELERL-------NKLEEEREENLISWLEELREKLEKLLERISQKKR 409 Query: 173 LRTDLTQEVSQQTYDRMKA-ERLAEAEFIR--ARGREEGQKRMSIADRKATQILSEARRD 229 L+ +L S + RM+A RLA + +R + D + L E + Sbjct: 410 LKQELKDRKSHASQLRMRALARLAYEQVVRRKRKEATPDNFGARDEDWDVYEDLEEENKS 469 Query: 230 SE 231 Sbjct: 470 IL 471 >gnl|CDD|33246 COG3442, COG3442, Predicted glutamine amidotransferase [General function prediction only]. Length = 250 Score = 26.8 bits (59), Expect = 8.4 Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Query: 156 LRYDAEKLGISIEDVRVLRTDLTQEVSQQTYD 187 LR AEK GI +E ++ LT +YD Sbjct: 26 LRQRAEKRGIKVE---IVEVSLTDTFPDDSYD 54 >gnl|CDD|145733 pfam02738, Ald_Xan_dh_C2, Molybdopterin-binding domain of aldehyde dehydrogenase. Length = 543 Score = 26.5 bits (59), Expect = 9.3 Identities = 17/73 (23%), Positives = 27/73 (36%), Gaps = 16/73 (21%) Query: 145 REKMMMEVCEDLRYDAEKLGISIEDVRVL-------RTDLTQEVSQQTYDRMKAERLAEA 197 E+++ E+ A +LGI ++R T Q + E + Sbjct: 224 LERLIDEL-------ARELGIDPLEIRRKNLYKEGDTTPFGQRLDSGNLPECLDECRKSS 276 Query: 198 EFIRARGREEGQK 210 EF RAR R +K Sbjct: 277 EF-RAR-RAAVEK 287 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.326 0.138 0.388 Gapped Lambda K H 0.267 0.0695 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,663,332 Number of extensions: 196238 Number of successful extensions: 1082 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1045 Number of HSP's successfully gapped: 59 Length of query: 302 Length of database: 6,263,737 Length adjustment: 93 Effective length of query: 209 Effective length of database: 4,254,100 Effective search space: 889106900 Effective search space used: 889106900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 57 (25.8 bits)