>TIGR01509 HAD-SF-IA-v3 HAD-superfamily hydrolase, subfamily IA, variant 3; InterPro: IPR006402 This group of sequences represent part of one structural subfamily of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. The superfamily is defined by the presence of three short catalytic motifs . The subfamilies are defined based on the location and the observed or predicted fold of a so-called capping domain , or the absence of such a domain. Subfamily I consists of sequences in which the capping domain is found in between the first and second catalytic motifs. Subfamily II consists of sequences in which the capping domain is found between the second and third motifs. Subfamily III sequences have no capping domain in either of these positions. The Subfamily IA and IB capping domains are predicted by PSI-PRED to consist of an alpha helical bundle. Subfamily I encompasses such a wide region of sequence space (the sequences are highly divergent) that modelling it with a single HMM is impossible, resulting in an overly broad description which allows in many unrelated sequences. Subfamily IA and IB are separated based on an aparrent phylogenetic bifurcation. Subfamily IA is still too broad to model, but can be further subdivided into large chunks based on phylogenetic trees. Of the three motifs defining the HAD superfamily, the third has three variant forms : (1) hhhhsDxxx(x)D, (2) hhhhssxxx(x)D and (3) hhhhDDxxx(x)s where _s_ refers to a small amino acid and _h_ to a hydrophobic one. All three of these variants are found in subfamily IA. .

Probab=97.28 E-value=0.0089 Score=35.78 Aligned_cols=151 Identities=19% Similarity=0.292 Sum_probs=88.6 Q ss_pred EEEECCCEEEEECCCCHHHHHHHHCCCHHHHHHHHHHHCCCCCHHHH-HHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHH Q ss_conf 48722750265245200278874122327788876520244100123-45568764200456898874211345433899 Q gi|254780960|r 82 LLIADMDSTMIEQECIDELADLIGIKEKVSLITARAMNGEIPFQDSL-RERISLFKGTSTKIIDSLLEKKITYNPGGYEL 160 (297) Q Consensus 82 l~~~d~d~tli~~~~l~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 160 (297) T Consensus 1 ~~~FD~DgvL~~~~~~~~~~-~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~ 73 (156) T TIGR01509 1 AILFDLDGVLVDTELGLVPD-ELGVSA----RLELALTLFKEYGRTDSPEDAQLL--KKQLFLDEILEEELKPLPGVRKL 73 (156) T ss_pred CEEEECCCEEECCCCCCCHH-HHHHHH----HHHHHHHHHHHHCCCCCHHHHHHH--HHHHHHHHHHHHCCCCCHHHHHH T ss_conf 75871077665276652027-788766----567777776541121126889864--45456888886303556038999 Q ss_pred HHHHHHCCCEEEEEECCCHHHHHHHHHHHCCCHHHHHCCCCHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC-CCEEE Q ss_conf 99998419869998167234223226550864134310100000000001563105211388775323310377-66799 Q gi|254780960|r 161 VHTMKQNGASTLLVTGGFSIFARFIAQHLGFDQYYANRFIEKDDRLTGQVMEPIIDGTAKSQILLEAIQKLQIN-PEDTI 239 (297) Q Consensus 161 i~~l~~~g~~v~iisg~~~~~~~~ia~~lgi~~~~a~~~~~~~~~~~~~~~~~~~~~~~k~~~~~~l~~~~~~~-~~~v~ 239 (297) T Consensus 74 l~~L~~~g--~~~~t~~~~~~~~~l~~~f~~--~~~---------------~~~~~~KP~p~~~~~~~~~~g~~~P~~~~ 134 (156) T TIGR01509 74 LEALRARG--VALLTNSPRAVRLGLRDAFDV--VID---------------EDVGRGKPDPDIYLQALKKLGLKPPSECL 134 (156) T ss_pred HHHHHHCC--EEEEECCCHHHHHHHHHHCCE--EEE---------------ECCCCCCCCHHHHHHHHHHHCCCCCHHEE T ss_conf 99885688--589877604445212443260--333---------------03578997589999999982898605377 Q ss_pred EEECCCCHHHHHHHCCCEE Q ss_conf 9978923488998489318 Q gi|254780960|r 240 AVGDGNNDLDMLRVAGYGV 258 (297) Q Consensus 240 avGDg~ND~pmL~~AgvGV 258 (297) T Consensus 135 ~~dD~~~gi~aa~~~G~~~ 153 (156) T TIGR01509 135 FVDDSPAGIEAAKAAGMHT 153 (156) T ss_pred EECCCHHHHHHHHHCCCEE T ss_conf 7515887899998669748

HHsearch alignment for GI: 254780960 and conserved domain: TIGR01509