>TIGR01549 HAD-SF-IA-v1 HAD-superfamily hydrolase, subfamily IA, variant 1; InterPro: IPR006439 This family represents part of one structural subfamily of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. The superfamily is defined by the presence of three short catalytic motifs . The subfamilies are defined based on the location and the observed or predicted fold of a so-called capping domain , or the absence of such a domain. Subfamily I consists of sequences in which the capping domain is found in between the first and second catalytic motifs. Subfamily II consists of sequences in which the capping domain is found between the second and third motifs. Subfamily III sequences have no capping domain in either of these positions. The Subfamily IA and IB capping domains are predicted by PSI-PRED to consist of an alpha helical bundle. Subfamily I encompasses such a wide region of sequence space (the sequences are highly divergent) that modelling it with a single HMM is impossible, resulting in an overly broad description which allows in many unrelated sequences. Subfamily IA and IB are separated based on an apparent phylogenetic bifurcation. Subfamily IA is still too broad to model, but can be further subdivided into large chunks based on phylogenetic trees. Of the three motifs defining the HAD superfamily, the third has three variant forms : (1) hhhhsDxxx(x)(D/E), (2) hhhhssxxx(x)D and (3) hhhhDDxxx(x)s where _s_ refers to a small amino acid and _h_ to a hydrophobic one. All three of these variants are found in subfamily 1A. ; GO: 0008967 phosphoglycolate phosphatase activity, 0008152 metabolic process.

Probab=97.88 E-value=0.00014 Score=46.82 Aligned_cols=146 Identities=21% Similarity=0.250 Sum_probs=78.8 Q ss_pred EEEECCCEEEEECCCCHHHHHH--HHCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHH Q ss_conf 4872275026524520027887--41223277888765202441001234556876420045689887421134543389 Q gi|254780960|r 82 LLIADMDSTMIEQECIDELADL--IGIKEKVSLITARAMNGEIPFQDSLRERISLFKGTSTKIIDSLLEKKITYNPGGYE 159 (297) Q Consensus 82 l~~~d~d~tli~~~~l~~~a~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 159 (297) T Consensus 1 ~i~FD~dGTL~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---------~~-~~~~~~~~~~-~~~~~~~~~~~~ 69 (151) T TIGR01549 1 AILFDIDGTLVDSEAIREALEQTFEEFGASFKRLKALRLAEELLW---------RI-ATSLEELQGL-EAEEAYIRDAVD 69 (151) T ss_pred CEEECCCCCEECCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHH---------HH-HCCHHHHHHH-HHHHHHCCCHHH T ss_conf 857613771436505788999999862310778999988888787---------75-0137998854-211101246689 Q ss_pred HHHHHHHCCCEEEEEECCCHHHHHHHHHHHCCCHHHHHCCCCHHHCCCCCCCCCCCCHHHHHHH--HHHHHHHHCCCCCE Q ss_conf 9999984198699981672342232265508641343101000000000015631052113887--75323310377667 Q gi|254780960|r 160 LVHTMKQNGASTLLVTGGFSIFARFIAQHLGFDQYYANRFIEKDDRLTGQVMEPIIDGTAKSQI--LLEAIQKLQINPED 237 (297) Q Consensus 160 ~i~~l~~~g~~v~iisg~~~~~~~~ia~~lgi~~~~a~~~~~~~~~~~~~~~~~~~~~~~k~~~--~~~l~~~~~~~~~~ 237 (297) T Consensus 70 ~l~~--l~~~~~~i~S~~~~~~~~~~~~~~~~~f~~~~~~--------------~~~~~~Kp~~~~~~~~~~~~~~-~~~ 132 (151) T TIGR01549 70 LLKR--LAGYRLGIISNGSLRAQKLLLRLLYDYFELILVS--------------DEPGVSKPNPEIFLAALESLGL-GPE 132 (151) T ss_pred HHHH--HCCCCEEEEECCCHHHHHHHHHHHHHHCCCEEEC--------------CCCCCCCCCHHHHHHHHHHCCC-CCC T ss_conf 9998--6178289986786899999998632100001212--------------6667658898999999997189-997 Q ss_pred EEEEECC-CCHHHHHHHCC Q ss_conf 9999789-23488998489 Q gi|254780960|r 238 TIAVGDG-NNDLDMLRVAG 255 (297) Q Consensus 238 v~avGDg-~ND~pmL~~Ag 255 (297) T Consensus 133 ~l~vGD~~~~D~~~a~~aG 151 (151) T TIGR01549 133 VLHVGDNLLNDIEGARNAG 151 (151) T ss_pred EEEECCCHHHHHHHHHHCC T ss_conf 8988288268776465149

HHsearch alignment for GI: 254780960 and conserved domain: TIGR01549