RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780961|ref|YP_003065374.1| hypothetical protein CLIBASIA_04310 [Candidatus Liberibacter asiaticus str. psy62] (200 letters) >d1lbua2 d.65.1.1 (A:84-213) Zn2+ DD-carboxypeptidase C-terminal catalytic domain {Streptomyces albus G [TaxId: 1962]} Length = 130 Score = 82.4 bits (203), Expect = 3e-17 Identities = 25/125 (20%), Positives = 44/125 (35%), Gaps = 14/125 (11%) Query: 85 LSQLNRLLYDWHSKQSIDMDPQL--FDFLWEIQQYFSV--PEYIYILSGYRTQETNKMLS 140 ++LNR DW + + +W++Q + I + G+R+ N + Sbjct: 5 YAELNRCNSDWSGGKVSAATARANALVTMWKLQAMRHAMGDKPITVNGGFRSVTCNSNVG 64 Query: 141 RRNRKIARKSQHVLGKAVDFYIPGVSLRSLYKIAIRLK---RGGVGYY--SKFLHIDVGR 195 S+H+ G A D +L + A G GY + H+ G Sbjct: 65 GA-----SNSRHMYGHAADLGAGSQGFCALAQAARNHGFTEILGPGYPGHNDHTHVAGGD 119 Query: 196 VRSWT 200 R W+ Sbjct: 120 GRFWS 124 >d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 406 Score = 30.8 bits (69), Expect = 0.081 Identities = 9/58 (15%), Positives = 20/58 (34%) Query: 104 DPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQHVLGKAVDFY 161 +++ + EI + +++ S Y Q +L N A++ Y Sbjct: 83 STAIYNPMSEIGKLIEYSCLVFLPSPYAEQLKETILPDLNASFDNSDTKGFVNAINLY 140 >d2fcja1 c.136.1.1 (A:1-114) Hypothetical protein RBSTP2199 {Bacillus stearothermophilus [TaxId: 1422]} Length = 114 Score = 27.5 bits (61), Expect = 0.70 Identities = 15/90 (16%), Positives = 30/90 (33%), Gaps = 6/90 (6%) Query: 67 GSKAIVTFKRGSQYNQEGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYI 126 ++ +V + L +L L + D D + ++ F E++YI Sbjct: 23 LNEPVVIVCTNGTISDARLEELADELEGYDVYLLADADEAGEKLRRQFRRMFPEAEHLYI 82 Query: 127 LSGYR------TQETNKMLSRRNRKIARKS 150 YR ++L R + +S Sbjct: 83 DRAYREVAAAPIWHLAQVLLRARFDVRIES 112 >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 Score = 26.5 bits (58), Expect = 1.7 Identities = 15/68 (22%), Positives = 27/68 (39%), Gaps = 1/68 (1%) Query: 92 LYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRRNRKIARKSQ 151 L + + Q FL +++Y +P+ +Y Y T + K S K+ R+ Sbjct: 135 LVQYLLAAPTEDGGQYSMFLNLVKKYGLIPKDLYGDLPYSTTASRKWNSLLTTKL-REFA 193 Query: 152 HVLGKAVD 159 L A+ Sbjct: 194 ETLRTALK 201 >d1rr7a_ a.4.1.14 (A:) Middle operon regulator, Mor {Bacteriophage Mu [TaxId: 10677]} Length = 94 Score = 25.5 bits (56), Expect = 3.5 Identities = 21/99 (21%), Positives = 38/99 (38%), Gaps = 12/99 (12%) Query: 83 EGLSQLNRLLYDWHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYRTQETNKMLSRR 142 L++LN LL S+ +D + + I ++ +YI G R Sbjct: 4 ALLAELNDLLRGELSRLGVD-PAHSLEIVVAICKHLG-GGQVYIPRGQALD-----SLIR 56 Query: 143 NRKIARKSQHVLGKAVDFYIP--GVSLRSLYKIAIRLKR 179 + +I G+ V GV+ ++YK R++R Sbjct: 57 DLRIWNDFN---GRNVSELTTRYGVTFNTVYKAIRRMRR 92 >d1g99a1 c.55.1.2 (A:1-197) Acetate kinase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Length = 197 Score = 25.0 bits (54), Expect = 4.6 Identities = 6/37 (16%), Positives = 12/37 (32%) Query: 95 WHSKQSIDMDPQLFDFLWEIQQYFSVPEYIYILSGYR 131 + I D + +++P +Y G R Sbjct: 139 PGTPMVIVFDTAFHQTMPPYAYMYALPYDLYEKHGVR 175 >d1kwga3 c.23.16.5 (A:394-590) A4 beta-galactosidase middle domain {Thermus thermophilus [TaxId: 274]} Length = 197 Score = 24.8 bits (54), Expect = 5.6 Identities = 6/31 (19%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Query: 91 LLYDWHSKQSIDMDPQ--LFDFLWEIQQYFS 119 L++D+ + ++ PQ + +L + ++S Sbjct: 9 LVFDYEAAWIYEVQPQGAEWSYLGLVYLFYS 39 >d1ciya2 b.77.2.1 (A:256-461) delta-Endotoxin (insectocide), middle domain {Bacillus thuringiensis, CRYIA (A) [TaxId: 1428]} Length = 206 Score = 24.2 bits (52), Expect = 8.5 Identities = 9/27 (33%), Positives = 11/27 (40%) Query: 105 PQLFDFLWEIQQYFSVPEYIYILSGYR 131 P L D L I Y V SG++ Sbjct: 39 PHLMDILNSITIYTDVHRGFNYWSGHQ 65 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.323 0.137 0.403 Gapped Lambda K H 0.267 0.0576 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 750,731 Number of extensions: 33128 Number of successful extensions: 79 Number of sequences better than 10.0: 1 Number of HSP's gapped: 77 Number of HSP's successfully gapped: 13 Length of query: 200 Length of database: 2,407,596 Length adjustment: 81 Effective length of query: 119 Effective length of database: 1,295,466 Effective search space: 154160454 Effective search space used: 154160454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 51 (23.8 bits)