Query         gi|254780962|ref|YP_003065375.1| hypothetical protein CLIBASIA_04315 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 49
No_of_seqs    2 out of 4
Neff          1.1 
Searched_HMMs 23785
Date          Tue May 31 22:44:31 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780962.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1zx3_A Hypothetical protein NE  12.9      16 0.00067   18.1  -1.7   15   26-40     36-50  (122)
  2 3gza_A Putative alpha-L-fucosi  11.8      74  0.0031   14.7   1.4   19    2-20     67-86  (443)
  3 2vws_A YFAU, 2-keto-3-deoxy su  10.7      88  0.0037   14.4   1.5   18    3-20     35-52  (267)
  4 2x8r_A Glycosyl hydrolase; pep   9.6 1.1E+02  0.0045   13.9   1.6   32    2-37     20-51  (210)
  5 1dxe_A 2-dehydro-3-deoxy-galac   7.8 1.4E+02   0.006   13.3   1.8   18    3-20     36-53  (256)
  6 3eyp_A Putative alpha-L-fucosi   7.7 1.1E+02  0.0047   13.8   1.0   16    2-17     62-77  (469)
  7 2wvv_A Alpha-L-fucosidase; alp   7.4      93  0.0039   14.2   0.5   15    3-17     87-101 (450)
  8 1jfx_A 1,4-beta-N-acetylmurami   7.3 1.4E+02  0.0058   13.4   1.3   31    2-36     21-51  (217)
  9 2v5j_A 2,4-dihydroxyhept-2-ENE   7.3 1.5E+02  0.0063   13.2   1.5   17    3-19     56-72  (287)
 10 2j8g_A Lysozyme; antimicrobial   6.7 1.3E+02  0.0053   13.6   0.9   30    2-35     22-51  (339)

No 1  
>1zx3_A Hypothetical protein NE0241; structural genomics, PSI, protein structure initiative, midwest center for structural genomics; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: a.43.1.6
Probab=12.86  E-value=16  Score=18.13  Aligned_cols=15  Identities=53%  Similarity=0.596  Sum_probs=11.7

Q ss_pred             CCCHHHHHHHHHHHH
Q ss_conf             474012455887754
Q gi|254780962|r   26 KKPIFKNNIMENMIG   40 (49)
Q Consensus        26 kkpifknnimenmig   40 (49)
                      ..|.-||-|||||-.
T Consensus        36 pdpmrknwimenmds   50 (122)
T 1zx3_A           36 PDPMRKNWIMENMDS   50 (122)
T ss_dssp             CCCSCCCCCCCSCCH
T ss_pred             CCHHHHHHHHHCCCC
T ss_conf             980666368761655


No 2  
>3gza_A Putative alpha-L-fucosidase; NP_812709.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE EPE; 1.60A {Bacteroides thetaiotaomicron vpi-5482}
Probab=11.79  E-value=74  Score=14.72  Aligned_cols=19  Identities=32%  Similarity=0.695  Sum_probs=14.8

Q ss_pred             CCCCCCCEEEEEECCC-CCH
Q ss_conf             6036785099995144-412
Q gi|254780962|r    2 AIKNSGAEFVLIDAKS-DGY   20 (49)
Q Consensus         2 aiknsgaefvlidak~-d~~   20 (49)
                      +.|.+||.++.+-||| ||+
T Consensus        67 ~~k~aGakyvvltaKHHDGF   86 (443)
T 3gza_A           67 AAKAAGCKFAVLTATHETGF   86 (443)
T ss_dssp             HHHTTTCSEEEEESCCSSCC
T ss_pred             HHHHCCCCEEEEEEEECCCC
T ss_conf             99986996899854536886


No 3  
>2vws_A YFAU, 2-keto-3-deoxy sugar aldolase; lyase, escherichia coli K-12 protein YFAU, degradation of homoprotocatechuate, class II aldolase; 1.39A {Escherichia coli} PDB: 2vwt_A
Probab=10.69  E-value=88  Score=14.35  Aligned_cols=18  Identities=28%  Similarity=0.462  Sum_probs=14.0

Q ss_pred             CCCCCCEEEEEECCCCCH
Q ss_conf             036785099995144412
Q gi|254780962|r    3 IKNSGAEFVLIDAKSDGY   20 (49)
Q Consensus         3 iknsgaefvlidak~d~~   20 (49)
                      +..+|..||.||..|--+
T Consensus        35 l~~~G~Dfv~iD~EHg~~   52 (267)
T 2vws_A           35 AATSGYDWLLIDGEHAPN   52 (267)
T ss_dssp             HHTTCCSEEEEETTTSCC
T ss_pred             HHHCCCCEEEECCCCCCC
T ss_conf             983798999981668988


No 4  
>2x8r_A Glycosyl hydrolase; peptidoglycan cleavage, endo-N-acetylmuramidases, motif; 1.70A {Aspergillus fumigatus}
Probab=9.58  E-value=1.1e+02  Score=13.92  Aligned_cols=32  Identities=34%  Similarity=0.635  Sum_probs=22.5

Q ss_pred             CCCCCCCEEEEEECCCCCHHHCCCCCCHHHHHHHHH
Q ss_conf             603678509999514441222254474012455887
Q gi|254780962|r    2 AIKNSGAEFVLIDAKSDGYKHLGFKKPIFKNNIMEN   37 (49)
Q Consensus         2 aiknsgaefvlidak~d~~khlgfkkpifknnimen   37 (49)
                      .+|++|.+||.|-+-. |   ..+.-|-|..|+-+-
T Consensus        20 ~~k~~gv~fviikate-G---~~~~D~~~~~n~~~a   51 (210)
T 2x8r_A           20 AAKKDGAQFVMIKATE-G---TTYKDTVFNSHYTGA   51 (210)
T ss_dssp             HHHHTTEEEEEEEEEE-T---TTEECTTHHHHHHHH
T ss_pred             HHHHCCCEEEEEEEEC-C---CCCCCHHHHHHHHHH
T ss_conf             9987799099999952-8---885786799999999


No 5  
>1dxe_A 2-dehydro-3-deoxy-galactarate aldolase; class II aldolase; 1.8A {Escherichia coli} SCOP: c.1.12.5 PDB: 1dxf_A
Probab=7.79  E-value=1.4e+02  Score=13.26  Aligned_cols=18  Identities=11%  Similarity=0.366  Sum_probs=13.5

Q ss_pred             CCCCCCEEEEEECCCCCH
Q ss_conf             036785099995144412
Q gi|254780962|r    3 IKNSGAEFVLIDAKSDGY   20 (49)
Q Consensus         3 iknsgaefvlidak~d~~   20 (49)
                      +..+|-.||+||..|-.+
T Consensus        36 ~a~~G~Dfv~iD~EHg~~   53 (256)
T 1dxe_A           36 LGLAGFDWLVLDGEHAPN   53 (256)
T ss_dssp             HTTSCCSEEEEESSSSSC
T ss_pred             HHHCCCCEEEEECCCCCC
T ss_conf             981799989982687988


No 6  
>3eyp_A Putative alpha-L-fucosidase; structural genomics, hydrolase, lipoprotein, PSI-2, protein structure initiative; 1.90A {Bacteroides thetaiotaomicron}
Probab=7.67  E-value=1.1e+02  Score=13.83  Aligned_cols=16  Identities=25%  Similarity=0.449  Sum_probs=13.2

Q ss_pred             CCCCCCCEEEEEECCC
Q ss_conf             6036785099995144
Q gi|254780962|r    2 AIKNSGAEFVLIDAKS   17 (49)
Q Consensus         2 aiknsgaefvlidak~   17 (49)
                      +.|.+||.++.+-|||
T Consensus        62 ~~k~aGaky~vltakH   77 (469)
T 3eyp_A           62 TLKAAGIPAAILTAKH   77 (469)
T ss_dssp             HHHHTTCCEEEEEEEC
T ss_pred             HHHHCCCCEEEECCEE
T ss_conf             9998699689965210


No 7  
>2wvv_A Alpha-L-fucosidase; alpha-L-fucose, hydrolase, glycoside hydrolase family 29; 1.73A {Bacteroides thetaiotaomicron} PDB: 2xii_A* 2xib_A* 2wvv_B 2wvt_A* 2wvu_A* 2wvs_A*
Probab=7.42  E-value=93  Score=14.23  Aligned_cols=15  Identities=33%  Similarity=0.541  Sum_probs=11.7

Q ss_pred             CCCCCCEEEEEECCC
Q ss_conf             036785099995144
Q gi|254780962|r    3 IKNSGAEFVLIDAKS   17 (49)
Q Consensus         3 iknsgaefvlidak~   17 (49)
                      .|.+||.|+.+-|||
T Consensus        87 ~k~aGakY~v~takH  101 (450)
T 2wvv_A           87 AKEMGTKYVKITTKH  101 (450)
T ss_dssp             HHHHTCSEEEEEEEC
T ss_pred             HHHCCCCEEEEEEEE
T ss_conf             998599679976773


No 8  
>1jfx_A 1,4-beta-N-acetylmuramidase M1; beta-alpha-barrel, cellosyl, lysozyme, hydrolase; 1.65A {Streptomyces coelicolor} SCOP: c.1.8.8
Probab=7.28  E-value=1.4e+02  Score=13.36  Aligned_cols=31  Identities=29%  Similarity=0.553  Sum_probs=21.2

Q ss_pred             CCCCCCCEEEEEECCCCCHHHCCCCCCHHHHHHHH
Q ss_conf             60367850999951444122225447401245588
Q gi|254780962|r    2 AIKNSGAEFVLIDAKSDGYKHLGFKKPIFKNNIME   36 (49)
Q Consensus         2 aiknsgaefvlidak~d~~khlgfkkpifknnime   36 (49)
                      ++|++|.+||.|-+-. |   -++.-|-|..|+-.
T Consensus        21 ~~k~~gi~fviiKate-G---~~~~D~~~~~n~~~   51 (217)
T 1jfx_A           21 SVKSAGMSFAYIKATE-G---TNYKDDRFSANYTN   51 (217)
T ss_dssp             HHHHTTCCEEEEEEEE-T---TTEECTTHHHHHHH
T ss_pred             HHHHCCCEEEEEEEEC-C---CCCCCHHHHHHHHH
T ss_conf             9987799099999965-9---88498689999999


No 9  
>2v5j_A 2,4-dihydroxyhept-2-ENE-1,7-dioic acid aldolase; lyase, class II aldolase, homoprotocatechuate, aromatic degradation; 1.60A {Escherichia coli} PDB: 2v5k_A
Probab=7.25  E-value=1.5e+02  Score=13.16  Aligned_cols=17  Identities=24%  Similarity=0.561  Sum_probs=13.2

Q ss_pred             CCCCCCEEEEEECCCCC
Q ss_conf             03678509999514441
Q gi|254780962|r    3 IKNSGAEFVLIDAKSDG   19 (49)
Q Consensus         3 iknsgaefvlidak~d~   19 (49)
                      +..+|-.||.||..|--
T Consensus        56 ~~~~GfDfv~ID~EHg~   72 (287)
T 2v5j_A           56 LAGAGFDWLLIDGEHAP   72 (287)
T ss_dssp             HHTSCCSEEEEESSSSS
T ss_pred             HHCCCCCEEEEECCCCC
T ss_conf             97389899998067898


No 10 
>2j8g_A Lysozyme; antimicrobial, muein hydrolase, bacteriolytic enzyme, pneumococcal cell WALL degradation, hydrolase, glycosidase, multimodular; HET: NAG AMV; 1.69A {Bacteriophage cp-1} SCOP: b.109.1.1 c.1.8.8 PDB: 2ixv_A* 2j8f_A* 2ixu_A* 1h09_A 1oba_A
Probab=6.65  E-value=1.3e+02  Score=13.55  Aligned_cols=30  Identities=10%  Similarity=0.282  Sum_probs=20.3

Q ss_pred             CCCCCCCEEEEEECCCCCHHHCCCCCCHHHHHHH
Q ss_conf             6036785099995144412222544740124558
Q gi|254780962|r    2 AIKNSGAEFVLIDAKSDGYKHLGFKKPIFKNNIM   35 (49)
Q Consensus         2 aiknsgaefvlidak~d~~khlgfkkpifknnim   35 (49)
                      ++|++|.+||.|-|-. +   -.+.-|-|..+|-
T Consensus        22 ~vk~~Gv~faiiKate-G---t~y~d~~~~~~~~   51 (339)
T 2j8g_A           22 ILEQMGTTNTIIKISE-S---TTYLNPCLSAQVE   51 (339)
T ss_dssp             HHHHHTCCEEEEEEEE-T---TTEECTTHHHHHH
T ss_pred             HHHHCCCCEEEEEECC-C---CCCCCHHHHHHHH
T ss_conf             9997699799999935-9---9806987999998


Done!