BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780962|ref|YP_003065375.1| hypothetical protein CLIBASIA_04315 [Candidatus Liberibacter asiaticus str. psy62] (49 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254780962|ref|YP_003065375.1| hypothetical protein CLIBASIA_04315 [Candidatus Liberibacter asiaticus str. psy62] gi|254040639|gb|ACT57435.1| hypothetical protein CLIBASIA_04315 [Candidatus Liberibacter asiaticus str. psy62] Length = 49 Score = 86.5 bits (213), Expect = 1e-15, Method: Composition-based stats. Identities = 49/49 (100%), Positives = 49/49 (100%) Query: 1 MAIKNSGAEFVLIDAKSDGYKHLGFKKPIFKNNIMENMIGRMSLRREYG 49 MAIKNSGAEFVLIDAKSDGYKHLGFKKPIFKNNIMENMIGRMSLRREYG Sbjct: 1 MAIKNSGAEFVLIDAKSDGYKHLGFKKPIFKNNIMENMIGRMSLRREYG 49 >gi|254780989|ref|YP_003065402.1| GCN5-related N-acetyltransferase [Candidatus Liberibacter asiaticus str. psy62] gi|254040666|gb|ACT57462.1| GCN5-related N-acetyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 185 Score = 86.1 bits (212), Expect = 1e-15, Method: Composition-based stats. Identities = 44/68 (64%), Positives = 46/68 (67%), Gaps = 20/68 (29%) Query: 1 MAIKNSGAEFVLIDAKSDGYKHLGFKKP--------------------IFKNNIMENMIG 40 MAIKNSGAEFVLIDAK D +KHLGFKKP IFKNNIMENMIG Sbjct: 117 MAIKNSGAEFVLIDAKHDWHKHLGFKKPHQHQIRYAHGGGAATDWLVHIFKNNIMENMIG 176 Query: 41 RMSLRREY 48 +MSLRREY Sbjct: 177 KMSLRREY 184 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.320 0.147 0.445 Lambda K H 0.267 0.0459 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 570,606,488 Number of Sequences: 14124377 Number of extensions: 18615374 Number of successful extensions: 30308 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 30305 Number of HSP's gapped (non-prelim): 2 length of query: 49 length of database: 4,842,793,630 effective HSP length: 22 effective length of query: 27 effective length of database: 4,532,057,336 effective search space: 122365548072 effective search space used: 122365548072 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 76 (33.7 bits)