RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780963|ref|YP_003065376.1| hypothetical protein CLIBASIA_04320 [Candidatus Liberibacter asiaticus str. psy62] (215 letters) >gnl|CDD|107342 cd06347, PBP1_ABC_ligand_binding_like_12, Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine/isoleucine/valine binding protein (LIVBP); however its ligand specificity has not been determined experimentally. Length = 334 Score = 28.3 bits (64), Expect = 1.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Query: 115 FKKIGVGVVASTGFNTGDK 133 FKK+G +VA FN GD Sbjct: 160 FKKLGGEIVAEETFNAGDT 178 >gnl|CDD|146031 pfam03198, Glyco_hydro_72, Glycolipid anchored surface protein (GAS1). Length = 313 Score = 27.7 bits (62), Expect = 2.4 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Query: 39 VMIDLWSREISSYRTPLSLDLDYKHRVY--LDTYKSFSINLGFETFNEIVNPTT 90 V++DL + S R S ++DY R + +D +K++ LGF NE++N + Sbjct: 96 VILDLNTPRNSINRADPSWNVDYLERYFKVIDAFKNYPNVLGFFAGNEVINDAS 149 >gnl|CDD|177096 CHL00204, ycf1, Ycf1; Provisional. Length = 1832 Score = 27.0 bits (60), Expect = 3.9 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 3/26 (11%) Query: 88 PTTMRVLVLPVLSMHKTWNNN---FD 110 P T+ VL LP L H WNN+ FD Sbjct: 83 PHTITVLALPYLLFHFFWNNHKHFFD 108 >gnl|CDD|38076 KOG2865, KOG2865, KOG2865, NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion]. Length = 391 Score = 26.1 bits (57), Expect = 7.6 Identities = 13/97 (13%), Positives = 27/97 (27%), Gaps = 4/97 (4%) Query: 18 EFSQALEHEDELKVNFGL-MRRVMIDLWSREISSYRTPLSLDLDYKHRVYLDTYKSFSIN 76 + + E V + + + M I + P L+ D R+ + Sbjct: 287 DIMYDMAREWPRYVRLPMPIFKAMAAARDFMIVPFPPPSPLNRDQIERLTVTDLVLTGA- 345 Query: 77 LGFETFNEIVNPTTMRVLVLPVLSMHKTWNNNFDDSY 113 E V T + + + L ++ F Sbjct: 346 PTLEDLG--VVLTKLELYPVEFLRQYRKGGRYFGAEV 380 >gnl|CDD|32375 COG2192, COG2192, Predicted carbamoyl transferase, NodU family [Posttranslational modification, protein turnover, chaperones]. Length = 555 Score = 26.0 bits (57), Expect = 8.8 Identities = 9/32 (28%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Query: 100 SMHKTWNNNFDD--SYFFKKIGVGVVASTGFN 129 ++ + N + F ++ GVGV+ +T FN Sbjct: 488 TVRRDANPRYYGLLRAFKERTGVGVLLNTSFN 519 >gnl|CDD|31073 COG0729, COG0729, Outer membrane protein [Cell envelope biogenesis, outer membrane]. Length = 594 Score = 25.7 bits (56), Expect = 9.2 Identities = 7/27 (25%), Positives = 10/27 (37%) Query: 54 PLSLDLDYKHRVYLDTYKSFSINLGFE 80 P+ D+ D F I +G E Sbjct: 567 PIRFDIAVPLEDKDDKKFQFYIGIGQE 593 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.326 0.141 0.428 Gapped Lambda K H 0.267 0.0724 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,734,247 Number of extensions: 145427 Number of successful extensions: 378 Number of sequences better than 10.0: 1 Number of HSP's gapped: 378 Number of HSP's successfully gapped: 18 Length of query: 215 Length of database: 6,263,737 Length adjustment: 90 Effective length of query: 125 Effective length of database: 4,318,927 Effective search space: 539865875 Effective search space used: 539865875 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 55 (25.0 bits)