RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780963|ref|YP_003065376.1| hypothetical protein CLIBASIA_04320 [Candidatus Liberibacter asiaticus str. psy62] (215 letters) >gnl|CDD|163517 TIGR03805, beta_helix_1, parallel beta-helix repeat-containing protein. Members of this protein family contain a tandem pair of beta-helix repeats (see TIGR03804). Each repeat is expected to consist of three beta strands that form a single turn as they form a right-handed helix of stacked beta-structure. Member proteinsa occur regularly in two-gene pairs along with another uncharacterized protein family; both protein families exhibit either lipoprotein or regular signal peptides, suggesting transit through the plasma membrane, and the two may be fused. The function of the pair is unknown. Length = 314 Score = 25.8 bits (57), Expect = 8.3 Identities = 10/42 (23%), Positives = 16/42 (38%), Gaps = 9/42 (21%) Query: 148 TPWLILQSDFAIRHASSDVVVCMRYQAKFLITDSIGILYRNV 189 T + SD A+ + D V + S GI+ R + Sbjct: 61 TSDDVTLSDLAVENTKGDGVK---------VKGSDGIIIRRL 93 >gnl|CDD|161787 TIGR00243, Dxr, 1-deoxy-D-xylulose 5-phosphate reductoisomerase. 1-deoxy-D-xylulose 5-phosphate is converted to 2-C-methyl-D-erythritol 4-phosphate in the presence of NADPH. It is involved in the synthesis of isopentenyl diphosphate (IPP), a basic building block in isoprenoid, thiamin, and pyridoxal biosynthesis. Length = 389 Score = 25.6 bits (56), Expect = 9.4 Identities = 4/17 (23%), Positives = 9/17 (52%) Query: 52 RTPLSLDLDYKHRVYLD 68 R P++ + + +RV Sbjct: 268 RLPIAYAMAWPNRVNSG 284 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.326 0.141 0.428 Gapped Lambda K H 0.267 0.0834 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,602,894 Number of extensions: 225807 Number of successful extensions: 453 Number of sequences better than 10.0: 1 Number of HSP's gapped: 453 Number of HSP's successfully gapped: 8 Length of query: 215 Length of database: 5,994,473 Length adjustment: 89 Effective length of query: 126 Effective length of database: 4,071,361 Effective search space: 512991486 Effective search space used: 512991486 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 55 (24.8 bits)