BLAST/PSIBLAST alignment of GI: 254780965 and GI: 303246407 at iteration 1
>gi|303246407|ref|ZP_07332686.1| conserved hypothetical protein [Desulfovibrio fructosovorans JJ] Length = 212
>gi|302492117|gb|EFL51992.1| conserved hypothetical protein [Desulfovibrio fructosovorans JJ] Length = 212
 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 81/186 (43%), Gaps = 16/186 (8%)

Query: 35  FSEKAVWKGDSETYFQCKRAHEFDENFDNCIITSIKKTGGTQEALRAAQYLEKYLEPGYV 94
              K VWK     +  C +  +   +  +C+   +++TG T EAL   + L+     GY+
Sbjct: 31  IGPKGVWKLPEAAWTDCLQKAQ---DATDCLARIMRQTGATPEALAVNKMLDGE---GYM 84

Query: 95  SSYRKEALIGIVEVQYPYRANENSGTLLI---PTVGSHIIDINDSSVHQLYDSSPIAKDF 151
            ++++   + +  + +P RAN N+ T L+   PT+ S  I+  D  +     + P     
Sbjct: 85  ETFQEMGRVDVAVMVFPLRANTNAVTYLVNGSPTLVSSEIEPADLPLA----ADPTYAAL 140

Query: 152 VLRNPGV--FPYSAGHFVKSSHKDGLIELIFSYP-LRSCHGCEDIGFMDIAYKFTTKGAF 208
              +P +  +P   G     +   G    +F+YP L  CH C  +G   ++  F   G +
Sbjct: 141 QKAHPELMFWPTGEGPSAVDTPPGGGQGFVFTYPLLNGCHACAVLGQALLSLDFGPDGTY 200

Query: 209 IGRKVF 214
            G ++ 
Sbjct: 201 HGPRLL 206