RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254780965|ref|YP_003065378.1| hypothetical protein
CLIBASIA_04330 [Candidatus Liberibacter asiaticus str. psy62]
         (229 letters)



>gnl|CDD|182860 PRK10949, PRK10949, protease 4; Provisional.
          Length = 618

 Score = 29.6 bits (67), Expect = 0.66
 Identities = 8/24 (33%), Positives = 11/24 (45%)

Query: 7  IIILLVLVGVILAFYFQQSSTPQN 30
            I L+LVGV +        TP+ 
Sbjct: 30 FFIFLILVGVGIWMQVSNGDTPET 53


>gnl|CDD|114894 pfam06202, GDE_C, Amylo-alpha-1,6-glucosidase.  This family
           includes human glycogen branching enzyme. This enzyme
           contains a number of distinct catalytic activities. It
           has been shown for the yeast homologue that mutations in
           this region disrupt the enzymes
           Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
          Length = 367

 Score = 29.2 bits (66), Expect = 0.89
 Identities = 27/146 (18%), Positives = 54/146 (36%), Gaps = 17/146 (11%)

Query: 32  LLFFSEKAVWKGDSETYFQCKRAHE-FDENFDN----CIITSIKKTGGTQEALRAAQYLE 86
               + K + +  S      ++  + F++ F N     +   +        +LR    + 
Sbjct: 176 AERLANKLLGEDKSSYEELAEKIKDNFEKKFWNPRRGILYDVLDPDDEKDYSLRPNFLIA 235

Query: 87  KYLEPGYVSSYRKEALIGIVEVQYPYRANENSGTLLIPTVGSHIIDINDSSVHQLYDSSP 146
             L P  +S  + +  + + E +           LL P  G   +D +D   H  YD   
Sbjct: 236 LSLPPTLLSPEKAKKALDLAEKK-----------LLTP-YGLRTLDPDDPDYHGYYDGDQ 283

Query: 147 IAKDFVLRNPGVFPYSAGHFVKSSHK 172
            ++D       V+P+  G+FV++  K
Sbjct: 284 DSRDAAYHQGTVWPWLLGYFVRAYLK 309


>gnl|CDD|178032 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl transferase
           family protein.
          Length = 451

 Score = 28.1 bits (62), Expect = 2.2
 Identities = 14/59 (23%), Positives = 27/59 (45%), Gaps = 11/59 (18%)

Query: 30  NHLLFFSEKA---------VWKGDSETYFQCKRAHEFDENFDNCIITSIKKTGGTQEAL 79
           +  ++F+E A         ++   S T F C+    FD+ + N ++  +K+  G Q  L
Sbjct: 112 DEFMYFAEAAAKEFKLPNVIFSTTSATAFVCRSV--FDKLYANNVLAPLKEPKGQQNEL 168


>gnl|CDD|117767 pfam09214, Prd1-P2, Bacteriophage Prd1, adsorption protein P2.
           Members of this family form a set of bacteriophage
           adsorption proteins, composed mainly of beta-strands
           whose complicated topology forms an elongated
           seahorse-shaped molecule with a distinct head,
           containing a pseudo-beta propeller structure with
           approximate 6-fold symmetry, and tail. They are required
           for the attachment of the phage to the host conjugative
           DNA transfer complex. This is a poorly understood large
           transmembrane complex of unknown architecture, with at
           least 11 different proteins.
          Length = 560

 Score = 27.7 bits (61), Expect = 2.4
 Identities = 27/100 (27%), Positives = 44/100 (44%), Gaps = 26/100 (26%)

Query: 128 SHIIDINDSSV-HQLYDSSPIA--------KDFVLRNPGVFPYSAGHFVKSSHKDGLIEL 178
           S +I + D SV  +L+ S P++         +++  N G+FP S G       K  LIE+
Sbjct: 377 SALIQLQDDSVIDELFYSLPLSIGGSGAAFDEWLANNCGLFPMSFG-----LDKSALIEI 431

Query: 179 IFSYPLRSCH--------GCEDIGFMDIAYKFTTKGAFIG 210
               P R           G +DI  +D +  + +  +FIG
Sbjct: 432 ----PRRQLEAINPQAGPGQDDIFILDDSAAYASFSSFIG 467


>gnl|CDD|180348 PRK06007, fliF, flagellar MS-ring protein; Reviewed.
          Length = 542

 Score = 27.5 bits (62), Expect = 3.2
 Identities = 9/34 (26%), Positives = 14/34 (41%)

Query: 1  MKYKIAIIILLVLVGVILAFYFQQSSTPQNHLLF 34
           K KIA+I     V   +      +S P   +L+
Sbjct: 21 KKRKIALIGAGAAVVAAIVALVLWASRPDYRVLY 54


>gnl|CDD|148815 pfam07423, DUF1510, Protein of unknown function (DUF1510).  This
          family consists of several hypothetical bacterial
          proteins of around 200 residues in length. The function
          of this family is unknown.
          Length = 214

 Score = 27.0 bits (60), Expect = 4.3
 Identities = 9/23 (39%), Positives = 14/23 (60%)

Query: 5  IAIIILLVLVGVILAFYFQQSST 27
          IAI I++VL+ ++    F  SS 
Sbjct: 18 IAIGIVVVLIIIVAYQLFFPSSP 40


>gnl|CDD|179879 PRK04792, tolB, translocation protein TolB; Provisional.
          Length = 448

 Score = 26.5 bits (59), Expect = 6.0
 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 2/35 (5%)

Query: 197 DIAYKFTT--KGAFIGRKVFGIRNDNAKYPMHFFI 229
           DI Y+  T  +GAF+ R  + + ND  KYP    I
Sbjct: 168 DIVYEKLTGERGAFLTRIAYVVVNDKDKYPYQLMI 202


>gnl|CDD|163375 TIGR03649, ergot_EASG, ergot alkaloid biosynthesis protein,
           AFUA_2G17970 family.  This family consists of fungal
           proteins of unknown function associated with secondary
           metabolite biosynthesis, such as of the ergot alkaloids
           such as ergovaline. Nomenclature differs because gene
           order differs - this is EasG in Neotyphodium lolii but
           is designated ergot alkaloid biosynthetic protein A in
           several other fungi.
          Length = 285

 Score = 26.5 bits (59), Expect = 6.0
 Identities = 22/84 (26%), Positives = 32/84 (38%), Gaps = 13/84 (15%)

Query: 78  ALRAAQYLEKYLEPGYVSSYRKEALIGIVEVQYPYRANENSGTLLIPTVGSHIIDINDSS 137
            LR   ++E + E  +V + RKE  I        Y A  +     IP V     DI   +
Sbjct: 132 VLRPTWFMENFSEEFHVEAIRKENKI--------YSATGDGK---IPFVS--ADDIARVA 178

Query: 138 VHQLYDSSPIAKDFVLRNPGVFPY 161
              L D      D+V+  P +  Y
Sbjct: 179 YRALTDKVAPNTDYVVLGPELLTY 202


>gnl|CDD|119237 pfam10717, ODV-E18, Occlusion-derived virus envelope protein
          ODV-E18.  This family of occlusion-derived viral
          envelope proteins are detected in viral-induced
          intranuclear microvesicles and are not detected in the
          plasma membrane, cytoplasmic membranes, or the nuclear
          envelope. The ODV-E18 protein is encoded by baculovirus
          late genes with transcription initiating from a TAAG
          motif. It exists as a dimer in the ODV envelope and
          contains a hydrophobic domain which is putatively
          acting as a target or retention signal for intranuclear
          microvesicles.
          Length = 85

 Score = 26.2 bits (58), Expect = 6.7
 Identities = 11/23 (47%), Positives = 14/23 (60%)

Query: 8  IILLVLVGVILAFYFQQSSTPQN 30
           IL+VLV +IL     QSS+  N
Sbjct: 29 TILIVLVIIILLILLFQSSSNGN 51


>gnl|CDD|185056 PRK15101, PRK15101, protease3; Provisional.
          Length = 961

 Score = 26.1 bits (58), Expect = 7.9
 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 5/41 (12%)

Query: 143 DSSPIAKDFVLRNPGVFPYSAGHFVKS-SHKDGLIELIFSY 182
            + P+    V RN GVF  S     K  + +D ++  IFSY
Sbjct: 339 GADPM----VDRNSGVFAISVSLTDKGLAQRDQVVAAIFSY 375


>gnl|CDD|152293 pfam11857, DUF3377, Domain of unknown function (DUF3377).  This
          domain is functionally uncharacterized. This domain is
          found in eukaryotes. This presumed domain is about 70
          amino acids in length.
          Length = 74

 Score = 26.1 bits (58), Expect = 8.3
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 6/36 (16%)

Query: 5  IAIIILLVLVGVILA-----FYFQQSSTPQNHLLFF 35
           A++I LVL+  IL        F++  TP+ HLL+ 
Sbjct: 32 AAVVIPLVLLLCILVLLYTIVQFKRKGTPR-HLLYC 66


>gnl|CDD|182949 PRK11081, PRK11081, tRNA guanosine-2'-O-methyltransferase;
           Provisional.
          Length = 229

 Score = 25.7 bits (57), Expect = 9.8
 Identities = 10/19 (52%), Positives = 13/19 (68%)

Query: 64  CIITSIKKTGGTQEALRAA 82
           CI+   +KTG +QEAL  A
Sbjct: 115 CILMGQEKTGISQEALALA 133


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.324    0.140    0.423 

Gapped
Lambda     K      H
   0.267   0.0711    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 3,789,744
Number of extensions: 232910
Number of successful extensions: 561
Number of sequences better than 10.0: 1
Number of HSP's gapped: 559
Number of HSP's successfully gapped: 24
Length of query: 229
Length of database: 5,994,473
Length adjustment: 90
Effective length of query: 139
Effective length of database: 4,049,753
Effective search space: 562915667
Effective search space used: 562915667
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 55 (25.0 bits)