BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780966|ref|YP_003065379.1| hypothetical protein CLIBASIA_04335 [Candidatus Liberibacter asiaticus str. psy62] (53 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780966|ref|YP_003065379.1| hypothetical protein CLIBASIA_04335 [Candidatus Liberibacter asiaticus str. psy62] Length = 53 Score = 110 bits (275), Expect = 5e-27, Method: Compositional matrix adjust. Identities = 53/53 (100%), Positives = 53/53 (100%) Query: 1 MFYDLFKSRTMHYLKGKSSRKECFLAIFNPLIECLDFKEIVEDKENFPSLTIR 53 MFYDLFKSRTMHYLKGKSSRKECFLAIFNPLIECLDFKEIVEDKENFPSLTIR Sbjct: 1 MFYDLFKSRTMHYLKGKSSRKECFLAIFNPLIECLDFKEIVEDKENFPSLTIR 53 >gi|254780143|ref|YP_003064556.1| DNA-directed RNA polymerase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 1386 Score = 21.2 bits (43), Expect = 3.5, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 19/34 (55%) Query: 20 RKECFLAIFNPLIECLDFKEIVEDKENFPSLTIR 53 RKE +AI L++ + K ++D +N + +R Sbjct: 432 RKEDIIAIIKILVDLRNGKGTIDDIDNLGNRRVR 465 >gi|254780889|ref|YP_003065302.1| inosine 5'-monophosphate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 493 Score = 20.8 bits (42), Expect = 4.7, Method: Composition-based stats. Identities = 7/13 (53%), Positives = 11/13 (84%) Query: 40 IVEDKENFPSLTI 52 +V+ K+NFPSL + Sbjct: 265 VVQIKKNFPSLLV 277 >gi|255764471|ref|YP_003064835.2| GTP-binding protein EngA [Candidatus Liberibacter asiaticus str. psy62] Length = 470 Score = 20.8 bits (42), Expect = 5.1, Method: Composition-based stats. Identities = 9/11 (81%), Positives = 9/11 (81%) Query: 32 IECLDFKEIVE 42 I LDFKEIVE Sbjct: 133 IYSLDFKEIVE 143 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.328 0.143 0.431 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,416 Number of Sequences: 1233 Number of extensions: 1002 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 53 length of database: 328,796 effective HSP length: 25 effective length of query: 28 effective length of database: 297,971 effective search space: 8343188 effective search space used: 8343188 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 31 (16.5 bits)