>TIGR00365 TIGR00365 glutaredoxin homolog; InterPro: IPR004480 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system . Glutaredoxin functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. Like thioredoxin, which functions in a similar way, glutaredoxin possesses an active centre disulphide bond . It exists in either a reduced or an oxidized form where the two cysteine residues are linked in an intramolecular disulphide bond. Glutaredoxin has been sequenced in a variety of species. On the basis of extensive sequence similarity, it has been proposed that Vaccinia virus protein O2L is most probably a glutaredoxin. Finally, it must be noted that Bacteriophage T4 thioredoxin seems also to be evolutionary related. In position 5 of the pattern T4 thioredoxin has Val instead of Pro. This family groups a number of hypothetical proteins from different organisms which are related to glutaredoxin proteins..

Probab=100.00 E-value=2.9e-36 Score=231.26 Aligned_cols=100 Identities=51% Similarity=1.019 Sum_probs=97.1 Q ss_pred HHHHHHHHHHHCCEEEEECCCCCCCCCCHHHHHHHHHHHCCCC---EEEEECCCCHHHHHHHHHHHCCCCCCEEEECCEE Q ss_conf 9999999964489799944899989983179999999974996---5899711440379999997347877638989989 Q gi|254780968|r 5 VNSIIQNEIKKNDVVLFMKGTPTSPRCGFSGKVVQVLDSLGVS---YKGIDVLADDALRQSIKEYSNWPTIPQLYVKGDF 81 (106) Q Consensus 5 ~~~~i~~~i~~~~Vvifskgt~~~p~C~~c~~ak~lL~~~~i~---y~~~dv~~d~~~~~~l~~~sg~~TvPqIFv~G~~ 81 (106) T Consensus 1 i~kri~~~i~~nPv~lfMKGsP~~P~CGFS~~~v~~L~~~~~~PakF~~~DiL~d~~iR~~lk~ysnWPT~PQLyVnGEf 80 (103) T TIGR00365 1 IKKRIEKLIEANPVLLFMKGSPKLPKCGFSRQAVGILRECGIRPAKFAYVDILQDPEIRQGLKEYSNWPTFPQLYVNGEF 80 (103) T ss_pred CHHHHHHHHHHCCEEEEECCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHCHHCCCCCCCCCEEECCEE T ss_conf 91578889975982684368899889988178999998548982113200024781332201000357999835665535 Q ss_pred ECCHHHHHHHHHCCCHHHHHHHC Q ss_conf 42769999999889978998522 Q gi|254780968|r 82 IGGCDIVCEMFESGELHEILSID 104 (106) Q Consensus 82 IGG~d~l~~l~~~G~L~~ll~~~ 104 (106) T Consensus 81 ~GG~Dii~e~~~~GEL~~ll~~a 103 (103) T TIGR00365 81 VGGCDIIIEMYQSGELQELLEEA 103 (103) T ss_pred ECHHHHHHHHHHCCCCHHHHHHC T ss_conf 56158999997648877767409

HHsearch alignment for GI: 254780968 and conserved domain: TIGR00365