>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor. This reaction is an essential step in the degradation of lignin, a complex phenolic polymer that is the most abundant aromatic material in the biosphere. The beta etherase activity of LigE is enantioselective and it complements the activity of the other GST family beta etherase, LigF.

Probab=96.88 E-value=0.0025 Score=40.84 Aligned_cols=66 Identities=21% Similarity=0.277 Sum_probs=50.0 Q ss_pred CCCCCHHHHHHHHHHHCCCCEEEEECCC-C-HHHHHHHHHHHCCCCCCEEEE-CCEEECCHHHHHHHHHC Q ss_conf 8998317999999997499658997114-4-037999999734787763898-99894276999999988 Q gi|254780968|r 28 SPRCGFSGKVVQVLDSLGVSYKGIDVLA-D-DALRQSIKEYSNWPTIPQLYV-KGDFIGGCDIVCEMFES 94 (106) Q Consensus 28 ~p~C~~c~~ak~lL~~~~i~y~~~dv~~-d-~~~~~~l~~~sg~~TvPqIFv-~G~~IGG~d~l~~l~~~ 94 (106) T Consensus 13 ~~~SP~~wkvRlaL~~Kgi~y~~~~v~~~~~~~~~~~~-~~~~~~~VPvl~d~~g~~i~dS~~Ia~YLee 81 (84) T cd03038 13 RAFSPNVWKTRLALNHKGLEYKTVPVEFPDIPPILGEL-TSGGFYTVPVIVDGSGEVIGDSFAIAEYLEE 81 (84) T ss_pred CEECCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHC-CCCCCCEEEEEEECCCCEEECHHHHHHHHHH T ss_conf 70386269999999827997479887167864210002-5898542668992999998779999999985

HHsearch alignment for GI: 254780968 and conserved domain: cd03038