BLAST/PSIBLAST alignment of GI: 254780969 and GI: 17987411 at iteration 1
>gi|17987411|ref|NP_540045.1| morphology/transcription regulator BolA family protein [Brucella melitensis bv. 1 str. 16M] Length = 77
>gi|23501723|ref|NP_697850.1| bolA-like protein [Brucella suis 1330] Length = 77
>gi|62289783|ref|YP_221576.1| bolA-like protein [Brucella abortus bv. 1 str. 9-941] Length = 77
>gi|82699710|ref|YP_414284.1| hypothetical protein BAB1_0856 [Brucella melitensis biovar Abortus 2308] Length = 77
>gi|148560205|ref|YP_001258811.1| bolA-like protein [Brucella ovis ATCC 25840] Length = 77
>gi|161618800|ref|YP_001592687.1| hypothetical protein BCAN_A0851 [Brucella canis ATCC 23365] Length = 77
>gi|163843109|ref|YP_001627513.1| hypothetical protein BSUIS_A0875 [Brucella suis ATCC 23445] Length = 77
>gi|189024025|ref|YP_001934793.1| ATP/GTP-binding site motif A (P-loop):BolA-like protein [Brucella abortus S19] Length = 77
>gi|225852349|ref|YP_002732582.1| hypothetical protein BMEA_A0875 [Brucella melitensis ATCC 23457] Length = 77
>gi|254689089|ref|ZP_05152343.1| hypothetical protein Babob68_02675 [Brucella abortus bv. 6 str. 870] Length = 77
>gi|254697222|ref|ZP_05159050.1| hypothetical protein Babob28_05779 [Brucella abortus bv. 2 str. 86/8/59] Length = 77
>gi|254704148|ref|ZP_05165976.1| hypothetical protein Bsuib36_09494 [Brucella suis bv. 3 str. 686] Length = 77
>gi|254706953|ref|ZP_05168781.1| hypothetical protein BpinM_08191 [Brucella pinnipedialis M163/99/10] Length = 77
>gi|254709941|ref|ZP_05171752.1| hypothetical protein BpinB_06642 [Brucella pinnipedialis B2/94] Length = 77
>gi|254713941|ref|ZP_05175752.1| hypothetical protein BcetM6_11416 [Brucella ceti M644/93/1] Length = 77
>gi|254717001|ref|ZP_05178812.1| hypothetical protein BcetM_11379 [Brucella ceti M13/05/1] Length = 77
>gi|254718942|ref|ZP_05180753.1| hypothetical protein Bru83_05284 [Brucella sp. 83/13] Length = 77
>gi|254730121|ref|ZP_05188699.1| hypothetical protein Babob42_02709 [Brucella abortus bv. 4 str. 292] Length = 77
>gi|256031434|ref|ZP_05445048.1| hypothetical protein BpinM2_12409 [Brucella pinnipedialis M292/94/1] Length = 77
>gi|256044511|ref|ZP_05447415.1| hypothetical protein Bmelb1R_08443 [Brucella melitensis bv. 1 str. Rev.1] Length = 77
>gi|256060943|ref|ZP_05451101.1| hypothetical protein Bneo5_11361 [Brucella neotomae 5K33] Length = 77
>gi|256113372|ref|ZP_05454226.1| hypothetical protein Bmelb3E_11627 [Brucella melitensis bv. 3 str. Ether] Length = 77
>gi|256159555|ref|ZP_05457322.1| hypothetical protein BcetM4_11378 [Brucella ceti M490/95/1] Length = 77
>gi|256254841|ref|ZP_05460377.1| hypothetical protein BcetB_11200 [Brucella ceti B1/94] Length = 77
>gi|256257338|ref|ZP_05462874.1| hypothetical protein Babob9C_08259 [Brucella abortus bv. 9 str. C68] Length = 77
>gi|256264152|ref|ZP_05466684.1| BolA family protein [Brucella melitensis bv. 2 str. 63/9] Length = 77
>gi|256369266|ref|YP_003106774.1| bolA-related protein [Brucella microti CCM 4915] Length = 77
>gi|260168568|ref|ZP_05755379.1| bolA-related protein [Brucella sp. F5/99] Length = 77
>gi|260545469|ref|ZP_05821210.1| BolA family protein [Brucella abortus NCTC 8038] Length = 77
>gi|260563865|ref|ZP_05834351.1| BolA family protein [Brucella melitensis bv. 1 str. 16M] Length = 77
>gi|260566604|ref|ZP_05837074.1| BolA family protein [Brucella suis bv. 4 str. 40] Length = 77
>gi|260754587|ref|ZP_05866935.1| BolA family protein [Brucella abortus bv. 6 str. 870] Length = 77
>gi|260757810|ref|ZP_05870158.1| BolA family protein [Brucella abortus bv. 4 str. 292] Length = 77
>gi|260761633|ref|ZP_05873976.1| BolA family protein [Brucella abortus bv. 2 str. 86/8/59] Length = 77
>gi|260883614|ref|ZP_05895228.1| BolA family protein [Brucella abortus bv. 9 str. C68] Length = 77
>gi|261218806|ref|ZP_05933087.1| BolA family protein [Brucella ceti M13/05/1] Length = 77
>gi|261222023|ref|ZP_05936304.1| BolA family protein [Brucella ceti B1/94] Length = 77
>gi|261314416|ref|ZP_05953613.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] Length = 77
>gi|261317488|ref|ZP_05956685.1| BolA family protein [Brucella pinnipedialis B2/94] Length = 77
>gi|261321695|ref|ZP_05960892.1| BolA family protein [Brucella ceti M644/93/1] Length = 77
>gi|261324945|ref|ZP_05964142.1| BolA family protein [Brucella neotomae 5K33] Length = 77
>gi|261754815|ref|ZP_05998524.1| BolA family protein [Brucella suis bv. 3 str. 686] Length = 77
>gi|261758041|ref|ZP_06001750.1| BolA family protein [Brucella sp. F5/99] Length = 77
>gi|265983932|ref|ZP_06096667.1| BolA family protein [Brucella sp. 83/13] Length = 77
>gi|265988523|ref|ZP_06101080.1| BolA family protein [Brucella pinnipedialis M292/94/1] Length = 77
>gi|265990936|ref|ZP_06103493.1| BolA family protein [Brucella melitensis bv. 1 str. Rev.1] Length = 77
>gi|265994774|ref|ZP_06107331.1| BolA family protein [Brucella melitensis bv. 3 str. Ether] Length = 77
>gi|265997987|ref|ZP_06110544.1| BolA family protein [Brucella ceti M490/95/1] Length = 77
>gi|294852190|ref|ZP_06792863.1| ATP/GTP-binding site-containing protein A :BolA-like protein [Brucella sp. NVSL 07-0026] Length = 77
>gi|297248187|ref|ZP_06931905.1| ATP/GTP-binding site-containing protein A (P-loop):BolA-like protein [Brucella abortus bv. 5 str. B3196] Length = 77
>gi|306838827|ref|ZP_07471658.1| BolA family protein [Brucella sp. NF 2653] Length = 77
>gi|17983101|gb|AAL52309.1| bola protein family [Brucella melitensis bv. 1 str. 16M] Length = 77
>gi|23347648|gb|AAN29765.1| bolA-related protein [Brucella suis 1330] Length = 77
>gi|62195915|gb|AAX74215.1| bolA-related protein [Brucella abortus bv. 1 str. 9-941] Length = 77
>gi|82615811|emb|CAJ10812.1| ATP/GTP-binding site motif A (P-loop):BolA-like protein [Brucella melitensis biovar Abortus 2308] Length = 77
>gi|148371462|gb|ABQ61441.1| bolA-related protein [Brucella ovis ATCC 25840] Length = 77
>gi|161335611|gb|ABX61916.1| Hypothetical protein BCAN_A0851 [Brucella canis ATCC 23365] Length = 77
>gi|163673832|gb|ABY37943.1| Hypothetical protein BSUIS_A0875 [Brucella suis ATCC 23445] Length = 77
>gi|189019597|gb|ACD72319.1| ATP/GTP-binding site motif A (P-loop):BolA-like protein [Brucella abortus S19] Length = 77
>gi|225640714|gb|ACO00628.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457] Length = 77
>gi|255999426|gb|ACU47825.1| bolA-related protein [Brucella microti CCM 4915] Length = 77
>gi|260096876|gb|EEW80751.1| BolA family protein [Brucella abortus NCTC 8038] Length = 77
>gi|260153881|gb|EEW88973.1| BolA family protein [Brucella melitensis bv. 1 str. 16M] Length = 77
>gi|260156122|gb|EEW91202.1| BolA family protein [Brucella suis bv. 4 str. 40] Length = 77
>gi|260668128|gb|EEX55068.1| BolA family protein [Brucella abortus bv. 4 str. 292] Length = 77
>gi|260672065|gb|EEX58886.1| BolA family protein [Brucella abortus bv. 2 str. 86/8/59] Length = 77
>gi|260674695|gb|EEX61516.1| BolA family protein [Brucella abortus bv. 6 str. 870] Length = 77
>gi|260873142|gb|EEX80211.1| BolA family protein [Brucella abortus bv. 9 str. C68] Length = 77
>gi|260920607|gb|EEX87260.1| BolA family protein [Brucella ceti B1/94] Length = 77
>gi|260923895|gb|EEX90463.1| BolA family protein [Brucella ceti M13/05/1] Length = 77
>gi|261294385|gb|EEX97881.1| BolA family protein [Brucella ceti M644/93/1] Length = 77
>gi|261296711|gb|EEY00208.1| BolA family protein [Brucella pinnipedialis B2/94] Length = 77
>gi|261300925|gb|EEY04422.1| BolA family protein [Brucella neotomae 5K33] Length = 77
>gi|261303442|gb|EEY06939.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] Length = 77
>gi|261738025|gb|EEY26021.1| BolA family protein [Brucella sp. F5/99] Length = 77
>gi|261744568|gb|EEY32494.1| BolA family protein [Brucella suis bv. 3 str. 686] Length = 77
>gi|262552455|gb|EEZ08445.1| BolA family protein [Brucella ceti M490/95/1] Length = 77
>gi|262765887|gb|EEZ11676.1| BolA family protein [Brucella melitensis bv. 3 str. Ether] Length = 77
>gi|263001720|gb|EEZ14295.1| BolA family protein [Brucella melitensis bv. 1 str. Rev.1] Length = 77
>gi|263094370|gb|EEZ18215.1| BolA family protein [Brucella melitensis bv. 2 str. 63/9] Length = 77
>gi|264660720|gb|EEZ30981.1| BolA family protein [Brucella pinnipedialis M292/94/1] Length = 77
>gi|264662524|gb|EEZ32785.1| BolA family protein [Brucella sp. 83/13] Length = 77
>gi|294820779|gb|EFG37778.1| ATP/GTP-binding site-containing protein A :BolA-like protein [Brucella sp. NVSL 07-0026] Length = 77
>gi|297175356|gb|EFH34703.1| ATP/GTP-binding site-containing protein A (P-loop):BolA-like protein [Brucella abortus bv. 5 str. B3196] Length = 77
>gi|306406111|gb|EFM62359.1| BolA family protein [Brucella sp. NF 2653] Length = 77
>gi|326538573|gb|ADZ86788.1| conserved hypothetical protein [Brucella melitensis M5-90] Length = 77
Score = 117 bits (292), Expect = 6e-25, Method: Compositional matrix adjust.
Identities = 49/77 (63%), Positives = 67/77 (87%)
Query: 1 MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
M+M+ HEIEK+I++GIP + VTI DLAGDG+H+AAE+++E FRGK+R+QQHQMVYD+L
Sbjct: 1 MAMDAHEIEKLIREGIPDAKVTIRDLAGDGDHFAAEVVAESFRGKSRVQQHQMVYDALKG 60
Query: 61 KMGNALHALSIKTSVPD 77
MG LHAL+++TSVP+
Sbjct: 61 NMGGVLHALALQTSVPE 77