BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780969|ref|YP_003065382.1| hypothetical protein
CLIBASIA_04350 [Candidatus Liberibacter asiaticus str. psy62]
         (79 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780969|ref|YP_003065382.1| hypothetical protein CLIBASIA_04350 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040646|gb|ACT57442.1| hypothetical protein CLIBASIA_04350 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 79

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN
Sbjct: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60

Query: 61 KMGNALHALSIKTSVPDSQ 79
          KMGNALHALSIKTSVPDSQ
Sbjct: 61 KMGNALHALSIKTSVPDSQ 79


>gi|315122613|ref|YP_004063102.1| hypothetical protein CKC_04325 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
 gi|313496015|gb|ADR52614.1| hypothetical protein CKC_04325 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
          Length = 81

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 59/76 (77%), Positives = 66/76 (86%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MN HEIE+MI KGIP S+V I DLAGDGNHYAAEIISEEFRGKNRIQQH+MVY +L  KM
Sbjct: 1  MNIHEIEEMITKGIPNSVVRIQDLAGDGNHYAAEIISEEFRGKNRIQQHKMVYAALEGKM 60

Query: 63 GNALHALSIKTSVPDS 78
          G+ LHALSIKT +P+S
Sbjct: 61 GDTLHALSIKTVIPNS 76


>gi|319408641|emb|CBI82296.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 78

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 52/77 (67%), Positives = 67/77 (87%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+MN H IE +I++GIP + VTIHDLAGDG HYAAE+ISE FRGK+R+QQH+MVYD+L  
Sbjct: 1  MAMNAHAIETLIREGIPDAKVTIHDLAGDGEHYAAEVISESFRGKSRVQQHKMVYDALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG+ALHAL+++TSVP+
Sbjct: 61 NMGSALHALALQTSVPN 77


>gi|13470368|ref|NP_101936.1| hypothetical protein msl0055 [Mesorhizobium loti MAFF303099]
 gi|319784048|ref|YP_004143524.1| BolA family protein [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
 gi|14021109|dbj|BAB47722.1| msl0055 [Mesorhizobium loti MAFF303099]
 gi|317169936|gb|ADV13474.1| BolA family protein [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
          Length = 77

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 66/77 (85%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+ H+IEK+IK GIP + VTI DLAGDG+HYAAE+++E FRGK+R+QQHQMVYD+L  
Sbjct: 1  MAMDAHDIEKLIKDGIPDAKVTIRDLAGDGDHYAAEVVAESFRGKSRVQQHQMVYDALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG  LHAL+++TSVPD
Sbjct: 61 NMGGVLHALALQTSVPD 77


>gi|260460832|ref|ZP_05809082.1| BolA family protein [Mesorhizobium opportunistum WSM2075]
 gi|259033409|gb|EEW34670.1| BolA family protein [Mesorhizobium opportunistum WSM2075]
          Length = 77

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 66/77 (85%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+ H+IEK+IK GIP + VTI DLAGDG+HYAAE+++E FRGK+R+QQHQMVYD+L  
Sbjct: 1  MAMDAHDIEKLIKDGIPDAKVTIRDLAGDGDHYAAEVVAESFRGKSRVQQHQMVYDALRG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG  LHAL+++TSVPD
Sbjct: 61 NMGGVLHALALQTSVPD 77


>gi|153009718|ref|YP_001370933.1| BolA family protein [Ochrobactrum anthropi ATCC 49188]
 gi|239831718|ref|ZP_04680047.1| BolA family protein [Ochrobactrum intermedium LMG 3301]
 gi|151561606|gb|ABS15104.1| BolA family protein [Ochrobactrum anthropi ATCC 49188]
 gi|239823985|gb|EEQ95553.1| BolA family protein [Ochrobactrum intermedium LMG 3301]
          Length = 77

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 50/77 (64%), Positives = 67/77 (87%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+ HEIEK+I++GIP + VTI DLAGDG+HYAAE+++E FRGK+R+QQHQMVYD+L  
Sbjct: 1  MAMDAHEIEKLIREGIPDAKVTIRDLAGDGDHYAAEVVAESFRGKSRVQQHQMVYDALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG  LHAL+++TSVP+
Sbjct: 61 NMGGVLHALALQTSVPE 77


>gi|254693572|ref|ZP_05155400.1| hypothetical protein Babob3T_02689 [Brucella abortus bv. 3 str.
          Tulya]
 gi|261213837|ref|ZP_05928118.1| BolA family protein [Brucella abortus bv. 3 str. Tulya]
 gi|260915444|gb|EEX82305.1| BolA family protein [Brucella abortus bv. 3 str. Tulya]
          Length = 77

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 49/77 (63%), Positives = 68/77 (88%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+ HEIEK+I++GIP + VTI DLAGDG+H+AAE+++E FRGK+R+QQHQMVYD+L  
Sbjct: 1  MAMDAHEIEKLIREGIPDAKVTIRDLAGDGDHFAAEVVAESFRGKSRVQQHQMVYDALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG+ LHAL+++TSVP+
Sbjct: 61 NMGDVLHALALQTSVPE 77


>gi|306844069|ref|ZP_07476664.1| BolA family protein [Brucella sp. BO1]
 gi|306275824|gb|EFM57548.1| BolA family protein [Brucella sp. BO1]
          Length = 78

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 49/77 (63%), Positives = 67/77 (87%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+ HEIEK+I++GIP + VTI DLAGDG+H+AAE+++E FRGK+R+QQHQMVYD+L  
Sbjct: 1  MAMDAHEIEKLIREGIPDAKVTIRDLAGDGDHFAAEVVAESFRGKSRVQQHQMVYDALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG  LHAL+++TSVP+
Sbjct: 61 NMGGVLHALALQTSVPE 77


>gi|17987411|ref|NP_540045.1| morphology/transcription regulator BolA family protein [Brucella
          melitensis bv. 1 str. 16M]
 gi|23501723|ref|NP_697850.1| bolA-like protein [Brucella suis 1330]
 gi|62289783|ref|YP_221576.1| bolA-like protein [Brucella abortus bv. 1 str. 9-941]
 gi|82699710|ref|YP_414284.1| hypothetical protein BAB1_0856 [Brucella melitensis biovar
          Abortus 2308]
 gi|148560205|ref|YP_001258811.1| bolA-like protein [Brucella ovis ATCC 25840]
 gi|161618800|ref|YP_001592687.1| hypothetical protein BCAN_A0851 [Brucella canis ATCC 23365]
 gi|163843109|ref|YP_001627513.1| hypothetical protein BSUIS_A0875 [Brucella suis ATCC 23445]
 gi|189024025|ref|YP_001934793.1| ATP/GTP-binding site motif A (P-loop):BolA-like protein [Brucella
          abortus S19]
 gi|225852349|ref|YP_002732582.1| hypothetical protein BMEA_A0875 [Brucella melitensis ATCC 23457]
 gi|254689089|ref|ZP_05152343.1| hypothetical protein Babob68_02675 [Brucella abortus bv. 6 str.
          870]
 gi|254697222|ref|ZP_05159050.1| hypothetical protein Babob28_05779 [Brucella abortus bv. 2 str.
          86/8/59]
 gi|254704148|ref|ZP_05165976.1| hypothetical protein Bsuib36_09494 [Brucella suis bv. 3 str. 686]
 gi|254706953|ref|ZP_05168781.1| hypothetical protein BpinM_08191 [Brucella pinnipedialis
          M163/99/10]
 gi|254709941|ref|ZP_05171752.1| hypothetical protein BpinB_06642 [Brucella pinnipedialis B2/94]
 gi|254713941|ref|ZP_05175752.1| hypothetical protein BcetM6_11416 [Brucella ceti M644/93/1]
 gi|254717001|ref|ZP_05178812.1| hypothetical protein BcetM_11379 [Brucella ceti M13/05/1]
 gi|254718942|ref|ZP_05180753.1| hypothetical protein Bru83_05284 [Brucella sp. 83/13]
 gi|254730121|ref|ZP_05188699.1| hypothetical protein Babob42_02709 [Brucella abortus bv. 4 str.
          292]
 gi|256031434|ref|ZP_05445048.1| hypothetical protein BpinM2_12409 [Brucella pinnipedialis
          M292/94/1]
 gi|256044511|ref|ZP_05447415.1| hypothetical protein Bmelb1R_08443 [Brucella melitensis bv. 1
          str. Rev.1]
 gi|256060943|ref|ZP_05451101.1| hypothetical protein Bneo5_11361 [Brucella neotomae 5K33]
 gi|256113372|ref|ZP_05454226.1| hypothetical protein Bmelb3E_11627 [Brucella melitensis bv. 3
          str. Ether]
 gi|256159555|ref|ZP_05457322.1| hypothetical protein BcetM4_11378 [Brucella ceti M490/95/1]
 gi|256254841|ref|ZP_05460377.1| hypothetical protein BcetB_11200 [Brucella ceti B1/94]
 gi|256257338|ref|ZP_05462874.1| hypothetical protein Babob9C_08259 [Brucella abortus bv. 9 str.
          C68]
 gi|256264152|ref|ZP_05466684.1| BolA family protein [Brucella melitensis bv. 2 str. 63/9]
 gi|256369266|ref|YP_003106774.1| bolA-related protein [Brucella microti CCM 4915]
 gi|260168568|ref|ZP_05755379.1| bolA-related protein [Brucella sp. F5/99]
 gi|260545469|ref|ZP_05821210.1| BolA family protein [Brucella abortus NCTC 8038]
 gi|260563865|ref|ZP_05834351.1| BolA family protein [Brucella melitensis bv. 1 str. 16M]
 gi|260566604|ref|ZP_05837074.1| BolA family protein [Brucella suis bv. 4 str. 40]
 gi|260754587|ref|ZP_05866935.1| BolA family protein [Brucella abortus bv. 6 str. 870]
 gi|260757810|ref|ZP_05870158.1| BolA family protein [Brucella abortus bv. 4 str. 292]
 gi|260761633|ref|ZP_05873976.1| BolA family protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883614|ref|ZP_05895228.1| BolA family protein [Brucella abortus bv. 9 str. C68]
 gi|261218806|ref|ZP_05933087.1| BolA family protein [Brucella ceti M13/05/1]
 gi|261222023|ref|ZP_05936304.1| BolA family protein [Brucella ceti B1/94]
 gi|261314416|ref|ZP_05953613.1| conserved hypothetical protein [Brucella pinnipedialis
          M163/99/10]
 gi|261317488|ref|ZP_05956685.1| BolA family protein [Brucella pinnipedialis B2/94]
 gi|261321695|ref|ZP_05960892.1| BolA family protein [Brucella ceti M644/93/1]
 gi|261324945|ref|ZP_05964142.1| BolA family protein [Brucella neotomae 5K33]
 gi|261754815|ref|ZP_05998524.1| BolA family protein [Brucella suis bv. 3 str. 686]
 gi|261758041|ref|ZP_06001750.1| BolA family protein [Brucella sp. F5/99]
 gi|265983932|ref|ZP_06096667.1| BolA family protein [Brucella sp. 83/13]
 gi|265988523|ref|ZP_06101080.1| BolA family protein [Brucella pinnipedialis M292/94/1]
 gi|265990936|ref|ZP_06103493.1| BolA family protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994774|ref|ZP_06107331.1| BolA family protein [Brucella melitensis bv. 3 str. Ether]
 gi|265997987|ref|ZP_06110544.1| BolA family protein [Brucella ceti M490/95/1]
 gi|294852190|ref|ZP_06792863.1| ATP/GTP-binding site-containing protein A :BolA-like protein
          [Brucella sp. NVSL 07-0026]
 gi|297248187|ref|ZP_06931905.1| ATP/GTP-binding site-containing protein A (P-loop):BolA-like
          protein [Brucella abortus bv. 5 str. B3196]
 gi|306838827|ref|ZP_07471658.1| BolA family protein [Brucella sp. NF 2653]
 gi|17983101|gb|AAL52309.1| bola protein family [Brucella melitensis bv. 1 str. 16M]
 gi|23347648|gb|AAN29765.1| bolA-related protein [Brucella suis 1330]
 gi|62195915|gb|AAX74215.1| bolA-related protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615811|emb|CAJ10812.1| ATP/GTP-binding site motif A (P-loop):BolA-like protein [Brucella
          melitensis biovar Abortus 2308]
 gi|148371462|gb|ABQ61441.1| bolA-related protein [Brucella ovis ATCC 25840]
 gi|161335611|gb|ABX61916.1| Hypothetical protein BCAN_A0851 [Brucella canis ATCC 23365]
 gi|163673832|gb|ABY37943.1| Hypothetical protein BSUIS_A0875 [Brucella suis ATCC 23445]
 gi|189019597|gb|ACD72319.1| ATP/GTP-binding site motif A (P-loop):BolA-like protein [Brucella
          abortus S19]
 gi|225640714|gb|ACO00628.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|255999426|gb|ACU47825.1| bolA-related protein [Brucella microti CCM 4915]
 gi|260096876|gb|EEW80751.1| BolA family protein [Brucella abortus NCTC 8038]
 gi|260153881|gb|EEW88973.1| BolA family protein [Brucella melitensis bv. 1 str. 16M]
 gi|260156122|gb|EEW91202.1| BolA family protein [Brucella suis bv. 4 str. 40]
 gi|260668128|gb|EEX55068.1| BolA family protein [Brucella abortus bv. 4 str. 292]
 gi|260672065|gb|EEX58886.1| BolA family protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674695|gb|EEX61516.1| BolA family protein [Brucella abortus bv. 6 str. 870]
 gi|260873142|gb|EEX80211.1| BolA family protein [Brucella abortus bv. 9 str. C68]
 gi|260920607|gb|EEX87260.1| BolA family protein [Brucella ceti B1/94]
 gi|260923895|gb|EEX90463.1| BolA family protein [Brucella ceti M13/05/1]
 gi|261294385|gb|EEX97881.1| BolA family protein [Brucella ceti M644/93/1]
 gi|261296711|gb|EEY00208.1| BolA family protein [Brucella pinnipedialis B2/94]
 gi|261300925|gb|EEY04422.1| BolA family protein [Brucella neotomae 5K33]
 gi|261303442|gb|EEY06939.1| conserved hypothetical protein [Brucella pinnipedialis
          M163/99/10]
 gi|261738025|gb|EEY26021.1| BolA family protein [Brucella sp. F5/99]
 gi|261744568|gb|EEY32494.1| BolA family protein [Brucella suis bv. 3 str. 686]
 gi|262552455|gb|EEZ08445.1| BolA family protein [Brucella ceti M490/95/1]
 gi|262765887|gb|EEZ11676.1| BolA family protein [Brucella melitensis bv. 3 str. Ether]
 gi|263001720|gb|EEZ14295.1| BolA family protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094370|gb|EEZ18215.1| BolA family protein [Brucella melitensis bv. 2 str. 63/9]
 gi|264660720|gb|EEZ30981.1| BolA family protein [Brucella pinnipedialis M292/94/1]
 gi|264662524|gb|EEZ32785.1| BolA family protein [Brucella sp. 83/13]
 gi|294820779|gb|EFG37778.1| ATP/GTP-binding site-containing protein A :BolA-like protein
          [Brucella sp. NVSL 07-0026]
 gi|297175356|gb|EFH34703.1| ATP/GTP-binding site-containing protein A (P-loop):BolA-like
          protein [Brucella abortus bv. 5 str. B3196]
 gi|306406111|gb|EFM62359.1| BolA family protein [Brucella sp. NF 2653]
 gi|326538573|gb|ADZ86788.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 77

 Score =  117 bits (292), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 49/77 (63%), Positives = 67/77 (87%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+ HEIEK+I++GIP + VTI DLAGDG+H+AAE+++E FRGK+R+QQHQMVYD+L  
Sbjct: 1  MAMDAHEIEKLIREGIPDAKVTIRDLAGDGDHFAAEVVAESFRGKSRVQQHQMVYDALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG  LHAL+++TSVP+
Sbjct: 61 NMGGVLHALALQTSVPE 77


>gi|225627328|ref|ZP_03785365.1| morphology/transcription regulator BolA family protein [Brucella
           ceti str. Cudo]
 gi|237815268|ref|ZP_04594266.1| morphology/transcription regulator BolA family protein [Brucella
           abortus str. 2308 A]
 gi|225617333|gb|EEH14378.1| morphology/transcription regulator BolA family protein [Brucella
           ceti str. Cudo]
 gi|237790105|gb|EEP64315.1| morphology/transcription regulator BolA family protein [Brucella
           abortus str. 2308 A]
          Length = 101

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 49/77 (63%), Positives = 67/77 (87%)

Query: 1   MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
           M+M+ HEIEK+I++GIP + VTI DLAGDG+H+AAE+++E FRGK+R+QQHQMVYD+L  
Sbjct: 25  MAMDAHEIEKLIREGIPDAKVTIRDLAGDGDHFAAEVVAESFRGKSRVQQHQMVYDALKG 84

Query: 61  KMGNALHALSIKTSVPD 77
            MG  LHAL+++TSVP+
Sbjct: 85  NMGGVLHALALQTSVPE 101


>gi|121601845|ref|YP_989151.1| BolA family protein [Bartonella bacilliformis KC583]
 gi|120614022|gb|ABM44623.1| BolA family protein [Bartonella bacilliformis KC583]
          Length = 77

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 65/76 (85%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+ HEIE +I++GIP + VTIHDLAGDG HYAAE+ISE FRGKNR+QQH+MVYDSL  
Sbjct: 1  MAMSIHEIETLIREGIPDAKVTIHDLAGDGEHYAAEVISESFRGKNRVQQHKMVYDSLKG 60

Query: 61 KMGNALHALSIKTSVP 76
           MG+ LHAL+++T +P
Sbjct: 61 NMGSMLHALALQTHIP 76


>gi|222086140|ref|YP_002544672.1| stress-induced morphogen protein [Agrobacterium radiobacter K84]
 gi|221723588|gb|ACM26744.1| stress-induced morphogen protein [Agrobacterium radiobacter K84]
          Length = 75

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 50/75 (66%), Positives = 62/75 (82%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MNP +IE MIK GIP + VTI DLAGDG+HYAAE+++E FRGK+R+QQHQMVYD+L   M
Sbjct: 1  MNPGDIEDMIKAGIPGAKVTIRDLAGDGDHYAAEVVAEAFRGKSRVQQHQMVYDALKGNM 60

Query: 63 GNALHALSIKTSVPD 77
          G  LHAL+++TS PD
Sbjct: 61 GGVLHALALQTSAPD 75


>gi|326408856|gb|ADZ65921.1| ATP/GTP-binding site motif A (P-loop):BolA-like protein [Brucella
          melitensis M28]
          Length = 75

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 65/75 (86%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+ HEIEK+I++GIP + VTI DLAGDG+H+AAE+++E FRGK+R+QQHQMVYD+L   M
Sbjct: 1  MDAHEIEKLIREGIPDAKVTIRDLAGDGDHFAAEVVAESFRGKSRVQQHQMVYDALKGNM 60

Query: 63 GNALHALSIKTSVPD 77
          G  LHAL+++TSVP+
Sbjct: 61 GGVLHALALQTSVPE 75


>gi|306841929|ref|ZP_07474607.1| morphology/transcription regulator BolA family protein [Brucella
          sp. BO2]
 gi|306287962|gb|EFM59370.1| morphology/transcription regulator BolA family protein [Brucella
          sp. BO2]
          Length = 76

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 65/75 (86%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+ HEIEK+I++GIP + VTI DLAGDG+H+AAE+++E FRGK+R+QQHQMVYD+L   M
Sbjct: 1  MDAHEIEKLIREGIPDAKVTIRDLAGDGDHFAAEVVAESFRGKSRVQQHQMVYDALKGNM 60

Query: 63 GNALHALSIKTSVPD 77
          G  LHAL+++TSVP+
Sbjct: 61 GGVLHALALQTSVPE 75


>gi|163759576|ref|ZP_02166661.1| hypothetical protein HPDFL43_09492 [Hoeflea phototrophica DFL-43]
 gi|162283173|gb|EDQ33459.1| hypothetical protein HPDFL43_09492 [Hoeflea phototrophica DFL-43]
          Length = 77

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 63/77 (81%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M MN  +IE MIK GIP + VTI DLAGDG+HYAAE++SE FRGK+R+QQHQMVY++L  
Sbjct: 1  MPMNAGDIETMIKAGIPDAKVTIRDLAGDGDHYAAEVVSESFRGKSRVQQHQMVYNALQG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG  LHAL+++TSVPD
Sbjct: 61 NMGGVLHALALQTSVPD 77


>gi|218460780|ref|ZP_03500871.1| stress-induced morphogen protein [Rhizobium etli Kim 5]
 gi|327190541|gb|EGE57635.1| stress-induced morphogen protein [Rhizobium etli CNPAF512]
          Length = 77

 Score =  113 bits (282), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 49/77 (63%), Positives = 63/77 (81%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M P +IE MIK GIP + VTI DLAGDG+HYAAE+++E FRGK+R+QQHQMVY++L  
Sbjct: 1  MAMKPGDIEDMIKAGIPGAKVTIRDLAGDGDHYAAEVVAEAFRGKSRVQQHQMVYEALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG  LHAL+++TS PD
Sbjct: 61 NMGGVLHALALQTSAPD 77


>gi|222148440|ref|YP_002549397.1| BolA/YrbA family protein [Agrobacterium vitis S4]
 gi|221735428|gb|ACM36391.1| BolA/YrbA family protein [Agrobacterium vitis S4]
          Length = 78

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 48/78 (61%), Positives = 64/78 (82%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M P +IE MIK GIP + V I DLAGDG+HYAAE+++E FRGK+R+QQHQMVYD+L  
Sbjct: 1  MAMKPGDIEDMIKAGIPGAKVVIRDLAGDGDHYAAEVVAEAFRGKSRVQQHQMVYDALKG 60

Query: 61 KMGNALHALSIKTSVPDS 78
           MG  LHAL+++TS+P++
Sbjct: 61 NMGGVLHALALQTSIPEA 78


>gi|86357902|ref|YP_469794.1| stress-induced morphogen protein [Rhizobium etli CFN 42]
 gi|86282004|gb|ABC91067.1| probable stress-induced morphogen protein, BolA family [Rhizobium
          etli CFN 42]
          Length = 77

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 49/77 (63%), Positives = 63/77 (81%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M P +IE MIK GIP + VTI DLAGDG+HYAAE+++E FRGK+R+QQHQMVY++L  
Sbjct: 1  MAMKPGDIEDMIKAGIPGAKVTIRDLAGDGDHYAAEVVAEAFRGKSRVQQHQMVYEALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG  LHAL+++TS PD
Sbjct: 61 NMGGLLHALALQTSAPD 77


>gi|163868502|ref|YP_001609711.1| hypothetical protein Btr_1354 [Bartonella tribocorum CIP 105476]
 gi|161018158|emb|CAK01716.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 77

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 62/76 (81%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+ H IE +I++GIP + VTI DLAGDG HYAAE+ISE FRGK R+QQH+MVYD+L  
Sbjct: 1  MAMSAHAIETLIREGIPNATVTIRDLAGDGEHYAAEVISESFRGKTRVQQHKMVYDALKG 60

Query: 61 KMGNALHALSIKTSVP 76
           MGN LHAL ++TS+P
Sbjct: 61 NMGNDLHALMLQTSIP 76


>gi|190891987|ref|YP_001978529.1| stress-induced morphogen protein, BolA family [Rhizobium etli
          CIAT 652]
 gi|218512341|ref|ZP_03509181.1| probable stress-induced morphogen protein, BolA family [Rhizobium
          etli 8C-3]
 gi|190697266|gb|ACE91351.1| probable stress-induced morphogen protein, BolA family [Rhizobium
          etli CIAT 652]
          Length = 77

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 49/77 (63%), Positives = 63/77 (81%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M P +IE MIK GIP + VTI DLAGDG+HYAAE+++E FRGK+R+QQHQMVY++L  
Sbjct: 1  MAMKPGDIEDMIKAGIPGAKVTIRDLAGDGDHYAAEVVAEVFRGKSRVQQHQMVYEALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG  LHAL+++TS PD
Sbjct: 61 NMGGVLHALALQTSAPD 77


>gi|148256692|ref|YP_001241277.1| hypothetical protein BBta_5397 [Bradyrhizobium sp. BTAi1]
 gi|146408865|gb|ABQ37371.1| transcriptional regulator, BolA protein family [Bradyrhizobium
          sp. BTAi1]
          Length = 79

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 64/79 (81%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+ H+IE+MIK  IP + VTI DLAGDG+HYAA +ISE FRGK+R+QQHQ+VY SL  
Sbjct: 1  MPMDAHDIEQMIKAAIPDAQVTIRDLAGDGDHYAATVISETFRGKSRVQQHQLVYQSLRG 60

Query: 61 KMGNALHALSIKTSVPDSQ 79
          +MG+ LHAL+++T VPD +
Sbjct: 61 QMGDVLHALALQTGVPDQR 79


>gi|110633629|ref|YP_673837.1| BolA-like protein [Mesorhizobium sp. BNC1]
 gi|110284613|gb|ABG62672.1| transcriptional regulator, BolA protein family [Chelativorans sp.
          BNC1]
          Length = 77

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 66/77 (85%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+  +IE++IK+ IP + VTI DLAGDG+HYAAE++SE FRGK+R+QQHQMVY++L  
Sbjct: 1  MAMSAGDIERLIKEAIPDAKVTIRDLAGDGDHYAAEVVSESFRGKSRVQQHQMVYEALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG ALHAL+++TSVP+
Sbjct: 61 NMGGALHALALQTSVPN 77


>gi|319404172|emb|CBI77765.1| conserved hypothetical protein [Bartonella rochalimae ATCC
          BAA-1498]
          Length = 77

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 63/76 (82%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+  EIE +I++ IP + +TI DLAGDG HYAAE+ISE FRGK+R+QQH+MVYD+L  
Sbjct: 1  MAMSADEIEALIRESIPNAKITIRDLAGDGEHYAAEVISENFRGKSRVQQHKMVYDALKG 60

Query: 61 KMGNALHALSIKTSVP 76
           MGN LHALS++TSVP
Sbjct: 61 NMGNVLHALSLQTSVP 76


>gi|218673903|ref|ZP_03523572.1| BolA family protein [Rhizobium etli GR56]
 gi|241204865|ref|YP_002975961.1| BolA family protein [Rhizobium leguminosarum bv. trifolii
          WSM1325]
 gi|240858755|gb|ACS56422.1| BolA family protein [Rhizobium leguminosarum bv. trifolii
          WSM1325]
          Length = 77

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 63/77 (81%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M P +IE MIK GIP + VTI DLAGDG+HYAAE+++E FRGK+R+QQHQMVY++L  
Sbjct: 1  MAMKPGDIEDMIKAGIPGAKVTIRDLAGDGDHYAAEVVAEAFRGKSRVQQHQMVYEALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG  LHAL+++TS P+
Sbjct: 61 NMGGVLHALALQTSAPE 77


>gi|240850734|ref|YP_002972134.1| BolA family protein [Bartonella grahamii as4aup]
 gi|240267857|gb|ACS51445.1| BolA family protein [Bartonella grahamii as4aup]
          Length = 77

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 62/76 (81%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+ H IE +I++GIP + VTI DLAGDG HYAAE+ISE FRGK R+QQH+MVYD+L  
Sbjct: 1  MAMSAHAIETLIREGIPDATVTIRDLAGDGEHYAAEVISESFRGKTRVQQHKMVYDALKG 60

Query: 61 KMGNALHALSIKTSVP 76
           MGN LHAL ++T++P
Sbjct: 61 NMGNDLHALMLQTNIP 76


>gi|209549529|ref|YP_002281446.1| BolA family protein [Rhizobium leguminosarum bv. trifolii
          WSM2304]
 gi|209535285|gb|ACI55220.1| BolA family protein [Rhizobium leguminosarum bv. trifolii
          WSM2304]
          Length = 77

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 63/77 (81%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M P +IE MIK GIP + VTI DLAGDG+HYAAE+++E FRGK+R+QQHQMVY++L  
Sbjct: 1  MAMKPGDIEDMIKAGIPGAKVTIRDLAGDGDHYAAEVVAEVFRGKSRVQQHQMVYEALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG  LHAL+++TS P+
Sbjct: 61 NMGGVLHALALQTSAPE 77


>gi|159184946|ref|NP_354833.2| BolA/YrbA family protein [Agrobacterium tumefaciens str. C58]
 gi|159140224|gb|AAK87618.2| BolA/YrbA family protein [Agrobacterium tumefaciens str. C58]
          Length = 77

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 61/77 (79%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M P +IE MIK GIP + VTI DLAGDG+HYAAE+++E F+GK R+QQHQMVYD+L  
Sbjct: 1  MPMKPGDIEDMIKAGIPGAKVTIRDLAGDGDHYAAEVVAEAFKGKTRVQQHQMVYDALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG  LHAL+++TS P+
Sbjct: 61 NMGGVLHALALQTSAPE 77


>gi|146339788|ref|YP_001204836.1| BolA-like protein [Bradyrhizobium sp. ORS278]
 gi|146192594|emb|CAL76599.1| Conserved Hypothetical protein; BolA-like protein [Bradyrhizobium
          sp. ORS278]
          Length = 79

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 63/79 (79%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+ H IE+MIK  IP + VTI DLAGDG+HYAA +ISE FRGK+R+QQHQ+VY SL  
Sbjct: 1  MPMDAHVIEEMIKAAIPDAQVTIRDLAGDGDHYAATVISEAFRGKSRVQQHQLVYQSLRG 60

Query: 61 KMGNALHALSIKTSVPDSQ 79
          +MG+ LHAL+++T VPD +
Sbjct: 61 QMGDVLHALALQTGVPDQR 79


>gi|319898856|ref|YP_004158949.1| hypothetical protein BARCL_0690 [Bartonella clarridgeiae 73]
 gi|319402820|emb|CBI76371.1| conserved protein of unknown function [Bartonella clarridgeiae
          73]
          Length = 77

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 63/76 (82%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+  EIE +I++ +P + +TI DLAGDG HYAAEIISE FRGKNR+QQH+MVYD+L  
Sbjct: 1  MAMSADEIETLIRESLPDAKITIRDLAGDGEHYAAEIISESFRGKNRVQQHKMVYDALKG 60

Query: 61 KMGNALHALSIKTSVP 76
           +GN LHAL+++TSVP
Sbjct: 61 NIGNILHALALQTSVP 76


>gi|319407189|emb|CBI80828.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 77

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 63/76 (82%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+  EIE +I++ IP + +TI DLAGDG HYAAE+ISE FRGK+R+QQH+MVYD+L  
Sbjct: 1  MAMSADEIEVLIRESIPNAKITIRDLAGDGEHYAAEVISEIFRGKSRVQQHKMVYDALKG 60

Query: 61 KMGNALHALSIKTSVP 76
           MGN LHALS++TSVP
Sbjct: 61 NMGNVLHALSLQTSVP 76


>gi|319405618|emb|CBI79241.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 77

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 64/76 (84%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+ +EIE +I++ IP + +TI DLAGDG HYAAEIISE FRGK+R+QQH+MVYD+L  
Sbjct: 1  MAMSANEIEILIRESIPDAKITIRDLAGDGEHYAAEIISENFRGKSRVQQHKMVYDALKG 60

Query: 61 KMGNALHALSIKTSVP 76
           MGN LHAL+++TS+P
Sbjct: 61 NMGNVLHALALQTSIP 76


>gi|325293251|ref|YP_004279115.1| BolA/YrbA family protein [Agrobacterium sp. H13-3]
 gi|325061104|gb|ADY64795.1| BolA/YrbA family protein [Agrobacterium sp. H13-3]
          Length = 77

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 61/77 (79%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M P +IE MIK GIP + VTI DLAGDG+HYAAE++++ F+GK R+QQHQMVYD+L  
Sbjct: 1  MPMKPGDIEDMIKAGIPGAKVTIRDLAGDGDHYAAEVVADAFKGKTRVQQHQMVYDALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG  LHAL+++TS P+
Sbjct: 61 NMGGVLHALALQTSAPE 77


>gi|15965533|ref|NP_385886.1| hypothetical protein SMc00487 [Sinorhizobium meliloti 1021]
 gi|307302652|ref|ZP_07582408.1| BolA family protein [Sinorhizobium meliloti BL225C]
 gi|307318499|ref|ZP_07597933.1| BolA family protein [Sinorhizobium meliloti AK83]
 gi|15074714|emb|CAC46359.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306895839|gb|EFN26591.1| BolA family protein [Sinorhizobium meliloti AK83]
 gi|306903016|gb|EFN33607.1| BolA family protein [Sinorhizobium meliloti BL225C]
          Length = 77

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 61/77 (79%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M P +IE MIK GIP + VTI DLAGDG+HYAAE+++E FRGK R+QQHQMVY++L  
Sbjct: 1  MPMAPGDIEDMIKAGIPGARVTIRDLAGDGDHYAAEVVAEAFRGKTRVQQHQMVYNALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG  LHAL+++TS P+
Sbjct: 61 NMGGILHALALQTSAPE 77


>gi|209884594|ref|YP_002288451.1| BolA family protein [Oligotropha carboxidovorans OM5]
 gi|209872790|gb|ACI92586.1| BolA family protein [Oligotropha carboxidovorans OM5]
          Length = 149

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 61/77 (79%)

Query: 1   MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
           M M+  EIE +I++GIP + V I DLAGDGNHYAA +ISE FRGK+R+QQHQ+VY SL  
Sbjct: 73  MPMDAREIETLIREGIPDATVEIRDLAGDGNHYAATVISESFRGKSRVQQHQIVYQSLKG 132

Query: 61  KMGNALHALSIKTSVPD 77
           +MG  LHAL+++T VP+
Sbjct: 133 QMGGVLHALALQTGVPE 149


>gi|150396718|ref|YP_001327185.1| BolA family protein [Sinorhizobium medicae WSM419]
 gi|150028233|gb|ABR60350.1| BolA family protein [Sinorhizobium medicae WSM419]
          Length = 77

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 61/77 (79%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M P +IE MIK GIP + VTI DLAGDG+HYAAE+++E FRGK R+QQHQMVY++L  
Sbjct: 1  MPMAPGDIEDMIKAGIPGAKVTIRDLAGDGDHYAAEVVAEAFRGKTRVQQHQMVYNALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG  LHAL+++TS P+
Sbjct: 61 NMGGILHALALQTSAPE 77


>gi|298292127|ref|YP_003694066.1| BolA family protein [Starkeya novella DSM 506]
 gi|296928638|gb|ADH89447.1| BolA family protein [Starkeya novella DSM 506]
          Length = 77

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 46/77 (59%), Positives = 63/77 (81%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M   EIE++I++G+P + V I DLAGDGNHYAA ++SE FRGK+R+QQHQMVY +L  
Sbjct: 1  MAMEAAEIERLIREGLPGASVEIRDLAGDGNHYAATVVSESFRGKSRVQQHQMVYAALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
          +MG  LHAL+++T+VPD
Sbjct: 61 QMGGILHALALQTNVPD 77


>gi|92117187|ref|YP_576916.1| BolA-like protein [Nitrobacter hamburgensis X14]
 gi|91800081|gb|ABE62456.1| transcriptional regulator, BolA protein family [Nitrobacter
          hamburgensis X14]
          Length = 77

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 61/77 (79%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M   +IE MIK+ IP + VTI DLAGDGNHY+A +ISE FRGK+R+QQHQ+VY SL  
Sbjct: 1  MAMEARDIESMIKEAIPDAAVTIQDLAGDGNHYSATVISESFRGKSRVQQHQIVYQSLKG 60

Query: 61 KMGNALHALSIKTSVPD 77
          +MG  LHAL+++T VP+
Sbjct: 61 QMGGVLHALALQTGVPE 77


>gi|75675501|ref|YP_317922.1| BolA-like protein [Nitrobacter winogradskyi Nb-255]
 gi|74420371|gb|ABA04570.1| transcriptional regulator, BolA protein family [Nitrobacter
          winogradskyi Nb-255]
          Length = 77

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 61/77 (79%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M   +IE MIK+ IP + VTI DLAGDGNHY+A +ISE FRGK+R+QQHQ+VY SL  
Sbjct: 1  MAMEARDIESMIKEAIPDARVTIQDLAGDGNHYSATVISESFRGKSRVQQHQLVYQSLKG 60

Query: 61 KMGNALHALSIKTSVPD 77
          +MG  LHAL+++T VP+
Sbjct: 61 QMGGVLHALALQTGVPE 77


>gi|85715183|ref|ZP_01046167.1| BolA-like protein [Nitrobacter sp. Nb-311A]
 gi|85698098|gb|EAQ35971.1| BolA-like protein [Nitrobacter sp. Nb-311A]
          Length = 77

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 61/77 (79%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M   +IE MIK+ IP + VTI DLAGDGNHY+A +ISE FRGK+R+QQHQ+VY SL  
Sbjct: 1  MAMEARDIESMIKEAIPDAQVTIQDLAGDGNHYSATVISESFRGKSRVQQHQLVYQSLKG 60

Query: 61 KMGNALHALSIKTSVPD 77
          +MG  LHAL+++T VP+
Sbjct: 61 QMGGVLHALALQTGVPE 77


>gi|27380826|ref|NP_772355.1| hypothetical protein bsl5715 [Bradyrhizobium japonicum USDA 110]
 gi|27353991|dbj|BAC50980.1| bsl5715 [Bradyrhizobium japonicum USDA 110]
          Length = 78

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 48/78 (61%), Positives = 61/78 (78%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+ H+IE MIK  IP + VTI DLAGDG+HYAA +ISE FRGK+R+QQHQ+VY SL  
Sbjct: 1  MPMDAHDIEAMIKAAIPDAEVTIRDLAGDGDHYAATVISESFRGKSRVQQHQIVYQSLRG 60

Query: 61 KMGNALHALSIKTSVPDS 78
          +MG  LHAL+++T VP +
Sbjct: 61 QMGGVLHALALQTGVPGT 78


>gi|49474338|ref|YP_032380.1| hypothetical protein BQ07510 [Bartonella quintana str. Toulouse]
 gi|49239842|emb|CAF26235.1| hypothetical protein BQ07510 [Bartonella quintana str. Toulouse]
          Length = 77

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 47/76 (61%), Positives = 61/76 (80%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+   IE +I++GIP +IV I DLAGDG HYAAE+ISE F GK+R+QQH+MVYD+L  
Sbjct: 1  MAMSAQAIETLIREGIPDAIVAIRDLAGDGEHYAAEVISESFLGKSRVQQHKMVYDALKG 60

Query: 61 KMGNALHALSIKTSVP 76
           MG+ LHAL +KT+VP
Sbjct: 61 NMGDTLHALVLKTNVP 76


>gi|294084241|ref|YP_003550999.1| bolA protein [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292663814|gb|ADE38915.1| bolA protein [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 79

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 44/79 (55%), Positives = 59/79 (74%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M   EIE +IK   P +++TI DL GDG+HYA +++S  F GKNR+QQHQMVY +LG 
Sbjct: 1  MAMQASEIEALIKAAFPDAVITIEDLRGDGDHYACQVVSSAFEGKNRVQQHQMVYKALGG 60

Query: 61 KMGNALHALSIKTSVPDSQ 79
          +MG  LHAL+++TS P SQ
Sbjct: 61 RMGGELHALALQTSAPTSQ 79


>gi|299131724|ref|ZP_07024919.1| BolA family protein [Afipia sp. 1NLS2]
 gi|298591861|gb|EFI52061.1| BolA family protein [Afipia sp. 1NLS2]
          Length = 77

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 60/77 (77%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+  +IE MIK  IP + VTI DLAGDG+HYAA +ISE FRGK+R+QQHQ+VY SL  
Sbjct: 1  MPMDARDIETMIKAAIPDATVTIRDLAGDGDHYAATVISESFRGKSRVQQHQIVYQSLKG 60

Query: 61 KMGNALHALSIKTSVPD 77
          +MG  LHAL+++T VP+
Sbjct: 61 QMGGVLHALALQTGVPE 77


>gi|49475725|ref|YP_033766.1| hypothetical protein BH09750 [Bartonella henselae str. Houston-1]
 gi|49238532|emb|CAF27768.1| hypothetical protein BH09750 [Bartonella henselae str. Houston-1]
          Length = 77

 Score =  106 bits (265), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 63/76 (82%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+ +EI+ +I++GIP + + I DLAGDG HYAAE+ISE FRGK+R+QQH+MVYD+L  
Sbjct: 1  MAMSANEIKTLIREGIPDATIIIRDLAGDGEHYAAEVISESFRGKSRVQQHKMVYDALKG 60

Query: 61 KMGNALHALSIKTSVP 76
           MGN LHAL ++T++P
Sbjct: 61 NMGNGLHALMLQTNIP 76


>gi|254504538|ref|ZP_05116689.1| BolA-like protein [Labrenzia alexandrii DFL-11]
 gi|222440609|gb|EEE47288.1| BolA-like protein [Labrenzia alexandrii DFL-11]
          Length = 77

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 46/77 (59%), Positives = 61/77 (79%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M MN +EIE +IK+ +P + V I DLAGDG+HYAA ++SE FRGK+R+QQHQMVY++L  
Sbjct: 1  MPMNANEIETLIKEALPDAQVEIRDLAGDGDHYAANVVSESFRGKSRVQQHQMVYEALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG ALHAL+++T  PD
Sbjct: 61 NMGGALHALALQTKAPD 77


>gi|296532416|ref|ZP_06895143.1| regulator of penicillin binding proteins and beta lactamase
          transcription [Roseomonas cervicalis ATCC 49957]
 gi|296267259|gb|EFH13157.1| regulator of penicillin binding proteins and beta lactamase
          transcription [Roseomonas cervicalis ATCC 49957]
          Length = 76

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 60/76 (78%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M   EIE +IK  +P + VTI DLAGDG+HYAA ++SE FRG++R+QQHQMVY +L  
Sbjct: 1  MAMPAAEIEALIKAALPDAQVTIEDLAGDGDHYAATVVSEAFRGRSRVQQHQMVYAALQG 60

Query: 61 KMGNALHALSIKTSVP 76
          +MG ALHAL+++TS P
Sbjct: 61 RMGGALHALALQTSAP 76


>gi|39934670|ref|NP_946946.1| BolA-like protein [Rhodopseudomonas palustris CGA009]
 gi|192290186|ref|YP_001990791.1| BolA family protein [Rhodopseudomonas palustris TIE-1]
 gi|39648520|emb|CAE27041.1| BolA-like protein [Rhodopseudomonas palustris CGA009]
 gi|192283935|gb|ACF00316.1| BolA family protein [Rhodopseudomonas palustris TIE-1]
          Length = 78

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 61/78 (78%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+  +IE MIK  IP + VTI DLAGDG+HYAA +ISE FRGK+R+QQHQ+VY SL  
Sbjct: 1  MPMDARDIEAMIKAAIPDAEVTIRDLAGDGDHYAATVISETFRGKSRVQQHQIVYQSLQG 60

Query: 61 KMGNALHALSIKTSVPDS 78
          +MG  LHAL+++T VP++
Sbjct: 61 QMGGVLHALALQTGVPEA 78


>gi|328543194|ref|YP_004303303.1| regulator of penicillin binding proteins and beta lactamase
          transcription [polymorphum gilvum SL003B-26A1]
 gi|326412940|gb|ADZ70003.1| Regulator of penicillin binding proteins and beta lactamase
          transcription [Polymorphum gilvum SL003B-26A1]
          Length = 77

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 60/77 (77%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+ +EIE +IK  +P + V I DLAGDG+HYAA +ISE FRGK+R+QQHQMVY +L  
Sbjct: 1  MPMDANEIETLIKAALPDAKVEIRDLAGDGDHYAANVISEAFRGKSRVQQHQMVYQALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG ALHAL+++TS PD
Sbjct: 61 NMGGALHALALQTSAPD 77


>gi|90423105|ref|YP_531475.1| BolA-like protein [Rhodopseudomonas palustris BisB18]
 gi|90105119|gb|ABD87156.1| BolA-like protein [Rhodopseudomonas palustris BisB18]
          Length = 78

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/78 (61%), Positives = 60/78 (76%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+  +IE MIK  IP + VTI DLAGD +HYAA +ISE FRGK+R+QQHQ+VY SL  
Sbjct: 1  MPMDARDIESMIKAAIPDAEVTIRDLAGDRDHYAATVISESFRGKSRVQQHQIVYQSLQG 60

Query: 61 KMGNALHALSIKTSVPDS 78
          +MG  LHAL+++T VPDS
Sbjct: 61 QMGGVLHALALQTGVPDS 78


>gi|114704294|ref|ZP_01437202.1| hypothetical protein FP2506_05156 [Fulvimarina pelagi HTCC2506]
 gi|114539079|gb|EAU42199.1| hypothetical protein FP2506_05156 [Fulvimarina pelagi HTCC2506]
          Length = 78

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 47/76 (61%), Positives = 60/76 (78%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M MN  +IE+MIK+ IP + VTI DLAGDG+HYAAEI+SE FRGK R+QQHQ V  +L  
Sbjct: 1  MPMNAGDIERMIKEAIPDATVTIRDLAGDGDHYAAEIVSESFRGKTRVQQHQAVNRALKG 60

Query: 61 KMGNALHALSIKTSVP 76
          K+G+ LHAL+++TS P
Sbjct: 61 KLGDELHALALQTSAP 76


>gi|316935231|ref|YP_004110213.1| BolA family protein [Rhodopseudomonas palustris DX-1]
 gi|315602945|gb|ADU45480.1| BolA family protein [Rhodopseudomonas palustris DX-1]
          Length = 77

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 60/77 (77%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+  +IE MIK  IP + VTI DLAGDG+HYAA +ISE FRGK+R+QQHQ+VY SL  
Sbjct: 1  MPMDARDIEAMIKAAIPDAEVTIRDLAGDGDHYAATVISESFRGKSRVQQHQIVYQSLQG 60

Query: 61 KMGNALHALSIKTSVPD 77
          +MG  LHAL+++T VP+
Sbjct: 61 QMGGVLHALALQTGVPE 77


>gi|91976233|ref|YP_568892.1| BolA-like protein [Rhodopseudomonas palustris BisB5]
 gi|91682689|gb|ABE38991.1| BolA-like protein [Rhodopseudomonas palustris BisB5]
          Length = 78

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 60/77 (77%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+  +IE MIK  IP + VTI DLAGDG+HYAA +ISE FRGK+R+QQHQ+VY SL  
Sbjct: 1  MPMDARDIEAMIKAAIPDAEVTIRDLAGDGDHYAATVISESFRGKSRVQQHQIVYQSLRG 60

Query: 61 KMGNALHALSIKTSVPD 77
          +MG  LHAL+++T VP+
Sbjct: 61 QMGGVLHALALQTGVPE 77


>gi|118588570|ref|ZP_01545978.1| BolA-like protein [Stappia aggregata IAM 12614]
 gi|118438556|gb|EAV45189.1| BolA-like protein [Stappia aggregata IAM 12614]
          Length = 77

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 60/77 (77%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M MN +EIE +IK  +P + V I DLAGDG+HYAA ++SE FRGK+R+QQHQ+VY++L  
Sbjct: 1  MPMNANEIETLIKAALPDAQVEIRDLAGDGDHYAANVVSESFRGKSRVQQHQLVYEALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG ALHAL+++T  PD
Sbjct: 61 NMGGALHALALQTKAPD 77


>gi|86750820|ref|YP_487316.1| BolA-like protein [Rhodopseudomonas palustris HaA2]
 gi|86573848|gb|ABD08405.1| BolA-like protein [Rhodopseudomonas palustris HaA2]
          Length = 78

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 46/77 (59%), Positives = 60/77 (77%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+  +IE MIK  IP + VTI DLAGDG+HYAA ++SE FRGK+R+QQHQ+VY SL  
Sbjct: 1  MPMDARDIEAMIKAAIPDAEVTIRDLAGDGDHYAATVVSESFRGKSRVQQHQIVYQSLQG 60

Query: 61 KMGNALHALSIKTSVPD 77
          +MG  LHAL+++T VP+
Sbjct: 61 QMGGVLHALALQTGVPE 77


>gi|154248010|ref|YP_001418968.1| BolA family protein [Xanthobacter autotrophicus Py2]
 gi|154162095|gb|ABS69311.1| BolA family protein [Xanthobacter autotrophicus Py2]
          Length = 77

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M MN  EIE++IK  +P + V I DLAGDG+HYAA I+S  FRGK+R+QQHQMVY +L  
Sbjct: 1  MPMNAREIEQLIKDALPDATVVIEDLAGDGDHYAARIVSAAFRGKSRVQQHQMVYAALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG  LHAL+++T+ PD
Sbjct: 61 NMGGVLHALALQTAAPD 77


>gi|114328335|ref|YP_745492.1| bolA protein [Granulibacter bethesdensis CGDNIH1]
 gi|114316509|gb|ABI62569.1| bolA protein [Granulibacter bethesdensis CGDNIH1]
          Length = 77

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 60/76 (78%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+  EIE +IK  +P + VTI DLAGDG+HYAA +ISE FRGK+R+QQHQ+VY +L  
Sbjct: 1  MAMSVGEIEALIKAALPDAQVTIEDLAGDGDHYAATVISETFRGKSRVQQHQIVYQALQG 60

Query: 61 KMGNALHALSIKTSVP 76
          +MG  LHAL+++TS P
Sbjct: 61 RMGGVLHALALQTSAP 76


>gi|304391558|ref|ZP_07373500.1| BolA family protein [Ahrensia sp. R2A130]
 gi|303295787|gb|EFL90145.1| BolA family protein [Ahrensia sp. R2A130]
          Length = 77

 Score =  103 bits (257), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 61/76 (80%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+  EIE MIK+ +P + VTI DLAGDG+HYAAE++SE+F GK+R++QHQ+VY +L  
Sbjct: 1  MPMDAREIETMIKEALPDAEVTIRDLAGDGDHYAAEVVSEQFVGKSRVEQHQLVYGALQG 60

Query: 61 KMGNALHALSIKTSVP 76
          KMG  LHAL+++TS P
Sbjct: 61 KMGGVLHALALQTSPP 76


>gi|154253026|ref|YP_001413850.1| BolA family protein [Parvibaculum lavamentivorans DS-1]
 gi|154156976|gb|ABS64193.1| BolA family protein [Parvibaculum lavamentivorans DS-1]
          Length = 78

 Score =  103 bits (257), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 43/76 (56%), Positives = 59/76 (77%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M   EIE++IK+ +P +I+ I DLAGDG+HYAA ++S  F+GK R+QQHQMVY +L  
Sbjct: 1  MAMTASEIERLIKEALPDAIIDIRDLAGDGDHYAANVVSAAFKGKTRVQQHQMVYSALKG 60

Query: 61 KMGNALHALSIKTSVP 76
           MGN LHAL+++TS P
Sbjct: 61 GMGNELHALALQTSAP 76


>gi|158423856|ref|YP_001525148.1| BolA-like protein [Azorhizobium caulinodans ORS 571]
 gi|158330745|dbj|BAF88230.1| BolA-like protein [Azorhizobium caulinodans ORS 571]
          Length = 77

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 44/76 (57%), Positives = 59/76 (77%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+  +IE++IK   P + V+I DLAGDG+HYAA ++SE FRGK+R+QQHQMVY +L  
Sbjct: 1  MAMDAGDIERLIKAAFPDAEVSITDLAGDGDHYAATVVSEAFRGKSRVQQHQMVYAALQG 60

Query: 61 KMGNALHALSIKTSVP 76
           MG  LHAL++KTS P
Sbjct: 61 NMGGVLHALALKTSAP 76


>gi|115523634|ref|YP_780545.1| morphology/transcription regulator BolA family protein
          [Rhodopseudomonas palustris BisA53]
 gi|115517581|gb|ABJ05565.1| BolA family protein [Rhodopseudomonas palustris BisA53]
          Length = 78

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 45/78 (57%), Positives = 60/78 (76%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+  EIE +IK  IP + +TI DLAGD +HYAA ++SE FRGK+R+QQHQ+VY SL  
Sbjct: 1  MPMDAQEIEALIKAAIPDAEITIRDLAGDRDHYAATVVSESFRGKSRVQQHQIVYQSLQG 60

Query: 61 KMGNALHALSIKTSVPDS 78
          +MG  LHAL+++T VP+S
Sbjct: 61 QMGGLLHALALQTGVPES 78


>gi|163793616|ref|ZP_02187591.1| bolA protein [alpha proteobacterium BAL199]
 gi|159181418|gb|EDP65933.1| bolA protein [alpha proteobacterium BAL199]
          Length = 77

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 43/77 (55%), Positives = 59/77 (76%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+  EIE+MIK  +P ++VTI DL GDG+HYA  ++S  F GKNRIQQHQMVY +L  
Sbjct: 1  MAMDAGEIERMIKSALPDALVTIEDLRGDGDHYACHVVSAAFSGKNRIQQHQMVYKALQG 60

Query: 61 KMGNALHALSIKTSVPD 77
          +MG  LHAL+++T+ P+
Sbjct: 61 RMGTELHALALQTATPE 77


>gi|158425061|ref|YP_001526353.1| hypothetical protein AZC_3437 [Azorhizobium caulinodans ORS 571]
 gi|158331950|dbj|BAF89435.1| hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 77

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 46/76 (60%), Positives = 60/76 (78%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M   EIE++IK+  P   V I DLAGDG+HYAA I SE+FRGK+R+QQH+MVYD+L  
Sbjct: 1  MAMVGSEIERLIKEAFPDGQVVIVDLAGDGDHYAARITSEQFRGKSRVQQHKMVYDALKG 60

Query: 61 KMGNALHALSIKTSVP 76
          +MG ALHAL+++T VP
Sbjct: 61 EMGGALHALALETIVP 76


>gi|288957504|ref|YP_003447845.1| BolA protein [Azospirillum sp. B510]
 gi|288909812|dbj|BAI71301.1| BolA protein [Azospirillum sp. B510]
          Length = 79

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 59/77 (76%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M    IEK+IK+GIP ++V I DL GDG+HYAA + S  F+GK+R+QQHQMVY SL  
Sbjct: 1  MAMEAATIEKLIKEGIPDAVVEIADLRGDGDHYAALVTSAAFKGKSRVQQHQMVYASLQG 60

Query: 61 KMGNALHALSIKTSVPD 77
          KMG  LHAL++ T+VP+
Sbjct: 61 KMGGELHALALTTAVPE 77


>gi|254470367|ref|ZP_05083771.1| BolA-like protein [Pseudovibrio sp. JE062]
 gi|211960678|gb|EEA95874.1| BolA-like protein [Pseudovibrio sp. JE062]
          Length = 77

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 62/77 (80%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+  E++ +IK+ +P + V I DLAGDG+HYAA +ISE FRGK+R+QQHQMVY +L  
Sbjct: 1  MAMDAGELQTLIKEALPDAHVEIRDLAGDGDHYAAVVISESFRGKSRVQQHQMVYQALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
          KMG+ LHAL+++TS P+
Sbjct: 61 KMGDDLHALALQTSAPE 77


>gi|148261649|ref|YP_001235776.1| BolA family protein [Acidiphilium cryptum JF-5]
 gi|326405139|ref|YP_004285221.1| BolA family protein [Acidiphilium multivorum AIU301]
 gi|146403330|gb|ABQ31857.1| transcriptional regulator, BolA protein family [Acidiphilium
          cryptum JF-5]
 gi|325052001|dbj|BAJ82339.1| BolA family protein [Acidiphilium multivorum AIU301]
          Length = 77

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 60/77 (77%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+  EIE MIK  +P + +T+ DLAGDG HYAA ++SE+FRG +R++QHQ+VY +L  
Sbjct: 1  MAMSAAEIEDMIKSALPDARITVEDLAGDGEHYAATVVSEQFRGLSRVRQHQLVYAALQG 60

Query: 61 KMGNALHALSIKTSVPD 77
          +MG  LHAL+++TS P+
Sbjct: 61 RMGGVLHALALQTSAPE 77


>gi|148557604|ref|YP_001265186.1| BolA family protein [Sphingomonas wittichii RW1]
 gi|148502794|gb|ABQ71048.1| BolA family protein [Sphingomonas wittichii RW1]
          Length = 77

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 43/77 (55%), Positives = 56/77 (72%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M   EIE MIK  +P + V I DLAGDG+HYAA ++SE FRG NR++Q ++VYD+LG 
Sbjct: 1  MPMAADEIEAMIKAALPDARVEITDLAGDGDHYAARVVSESFRGLNRVKQQRLVYDALGG 60

Query: 61 KMGNALHALSIKTSVPD 77
          +MG  LHAL + T+ PD
Sbjct: 61 RMGGVLHALQLSTATPD 77


>gi|170738373|ref|YP_001767028.1| BolA family protein [Methylobacterium sp. 4-46]
 gi|168192647|gb|ACA14594.1| BolA family protein [Methylobacterium sp. 4-46]
          Length = 78

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 57/76 (75%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+  EIE MI++ +P + V I DLAGDG+HYAA ++S  F+GK+R+QQHQMVY +L  
Sbjct: 1  MPMDAREIETMIREALPDATVEIRDLAGDGDHYAATVVSAAFKGKSRVQQHQMVYGALQG 60

Query: 61 KMGNALHALSIKTSVP 76
          +MG  LHAL++ T VP
Sbjct: 61 RMGGVLHALALTTGVP 76


>gi|307945595|ref|ZP_07660931.1| BolA family protein [Roseibium sp. TrichSKD4]
 gi|307771468|gb|EFO30693.1| BolA family protein [Roseibium sp. TrichSKD4]
          Length = 77

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 42/77 (54%), Positives = 59/77 (76%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M  ++IE++IK  +P + V I DLAGDG+HYAA ++SE FRGK+R+QQHQ+VY++L  
Sbjct: 1  MPMAANQIEELIKAALPDAQVEIRDLAGDGDHYAANVVSEAFRGKSRVQQHQLVYEALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG  LHAL+++T  PD
Sbjct: 61 NMGGELHALALQTKAPD 77


>gi|146342246|ref|YP_001207294.1| BolA-like protein [Bradyrhizobium sp. ORS278]
 gi|148257148|ref|YP_001241733.1| hypothetical protein BBta_5884 [Bradyrhizobium sp. BTAi1]
 gi|146195052|emb|CAL79077.1| conserved hypothetical protein; BolA-like protein [Bradyrhizobium
          sp. ORS278]
 gi|146409321|gb|ABQ37827.1| transcriptional regulator, BolA protein family [Bradyrhizobium
          sp. BTAi1]
          Length = 77

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 40/76 (52%), Positives = 59/76 (77%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M   +IE++IK+  P ++V I DLAGDG+HY+A + S+ F GK+R+QQHQMVY +L  
Sbjct: 1  MAMAATDIERLIKEAFPDAVVVIEDLAGDGDHYSARVTSQAFAGKSRVQQHQMVYSALKG 60

Query: 61 KMGNALHALSIKTSVP 76
          +MG  LHAL+++TS+P
Sbjct: 61 QMGGVLHALALETSLP 76


>gi|220920062|ref|YP_002495363.1| BolA family protein [Methylobacterium nodulans ORS 2060]
 gi|219944668|gb|ACL55060.1| BolA family protein [Methylobacterium nodulans ORS 2060]
          Length = 78

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 41/76 (53%), Positives = 57/76 (75%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+  EIE MI++ +P + + I DLAGDG+HYAA ++S  F+GK+R+QQHQMVY +L  
Sbjct: 1  MPMDAREIEAMIREALPDAKIEIRDLAGDGDHYAATVLSSSFKGKSRVQQHQMVYGALQG 60

Query: 61 KMGNALHALSIKTSVP 76
          +MG  LHAL++ T VP
Sbjct: 61 RMGGVLHALALTTGVP 76


>gi|71083829|ref|YP_266549.1| BolA-like protein [Candidatus Pelagibacter ubique HTCC1062]
 gi|91763135|ref|ZP_01265099.1| BolA-like protein [Candidatus Pelagibacter ubique HTCC1002]
 gi|71062942|gb|AAZ21945.1| BolA-like protein [Candidatus Pelagibacter ubique HTCC1062]
 gi|91717548|gb|EAS84199.1| BolA-like protein [Candidatus Pelagibacter ubique HTCC1002]
          Length = 76

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 43/73 (58%), Positives = 59/73 (80%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+  E+E +IK+ +P +I+ I DLAGD NHY+A I S+EF GK++I+QH+MVY+SL  
Sbjct: 1  MAMDIKEVETLIKEALPDAIIEIQDLAGDSNHYSATITSKEFSGKSKIEQHKMVYNSLKG 60

Query: 61 KMGNALHALSIKT 73
          KMGN LHAL+IKT
Sbjct: 61 KMGNELHALAIKT 73


>gi|154244082|ref|YP_001415040.1| BolA family protein [Xanthobacter autotrophicus Py2]
 gi|154158167|gb|ABS65383.1| BolA family protein [Xanthobacter autotrophicus Py2]
          Length = 77

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 44/76 (57%), Positives = 56/76 (73%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M   EIE+++K+ +P S V I DLAGDG+HYAA I SE FRGK+R+QQHQMVY +L  
Sbjct: 1  MAMAAEEIERLVKEALPDSQVVIIDLAGDGDHYAARITSEAFRGKSRVQQHQMVYAALQG 60

Query: 61 KMGNALHALSIKTSVP 76
           MG  LHAL ++T  P
Sbjct: 61 HMGGTLHALKLETLSP 76


>gi|209964309|ref|YP_002297224.1| stress-induced morphogen BolA-like protein [Rhodospirillum
          centenum SW]
 gi|209957775|gb|ACI98411.1| stress-induced morphogen BolA-like protein [Rhodospirillum
          centenum SW]
          Length = 78

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 58/78 (74%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+  EIE++I+ GIP ++V I DL GDG+HYAA + S  F GK R+QQHQMVY +L  
Sbjct: 1  MAMDAGEIERLIRDGIPDAVVRIDDLRGDGDHYAAYVESPAFAGKTRVQQHQMVYAALRG 60

Query: 61 KMGNALHALSIKTSVPDS 78
          +MGN LHAL++ T VP +
Sbjct: 61 QMGNELHALALTTVVPKA 78


>gi|188579297|ref|YP_001922742.1| BolA family protein [Methylobacterium populi BJ001]
 gi|179342795|gb|ACB78207.1| BolA family protein [Methylobacterium populi BJ001]
          Length = 78

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 55/76 (72%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+  EIE MI++ +P + V I DLAGDG+HYAA +IS  F+GK R+ QHQMVY +L  
Sbjct: 1  MPMDAREIESMIREALPDAQVEIKDLAGDGDHYAATVISSAFKGKTRVAQHQMVYGALQG 60

Query: 61 KMGNALHALSIKTSVP 76
          +MG  LHAL++ T VP
Sbjct: 61 RMGGVLHALALTTGVP 76


>gi|170747558|ref|YP_001753818.1| BolA family protein [Methylobacterium radiotolerans JCM 2831]
 gi|170654080|gb|ACB23135.1| BolA family protein [Methylobacterium radiotolerans JCM 2831]
          Length = 78

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 41/76 (53%), Positives = 56/76 (73%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+  EIE+MI++ +P + V I DLAGDG+HYAA ++S  F+GK R+ QHQMVY +L  
Sbjct: 1  MPMDAGEIERMIREALPDAQVEIRDLAGDGDHYAATVLSAAFKGKTRVAQHQMVYGALQG 60

Query: 61 KMGNALHALSIKTSVP 76
          +MG  LHAL++ T VP
Sbjct: 61 RMGGVLHALALTTGVP 76


>gi|83311215|ref|YP_421479.1| stress-induced morphogen [Magnetospirillum magneticum AMB-1]
 gi|82946056|dbj|BAE50920.1| Stress-induced morphogen [Magnetospirillum magneticum AMB-1]
          Length = 85

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 58/77 (75%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M   EIE +I++GIP + V I DL GDG+HY+A +ISE FRGK+R+ QHQMV+ ++  
Sbjct: 1  MPMEASEIEALIRQGIPDARVIIEDLKGDGDHYSALVISEAFRGKSRVAQHQMVFAAMQG 60

Query: 61 KMGNALHALSIKTSVPD 77
          KMG  LHA++++T+ PD
Sbjct: 61 KMGGQLHAMALQTATPD 77


>gi|163849469|ref|YP_001637512.1| BolA family protein [Methylobacterium extorquens PA1]
 gi|218528095|ref|YP_002418911.1| BolA family protein [Methylobacterium chloromethanicum CM4]
 gi|240136794|ref|YP_002961261.1| BolA-like protein [Methylobacterium extorquens AM1]
 gi|254558665|ref|YP_003065760.1| BolA-like protein [Methylobacterium extorquens DM4]
 gi|163661074|gb|ABY28441.1| BolA family protein [Methylobacterium extorquens PA1]
 gi|218520398|gb|ACK80983.1| BolA family protein [Methylobacterium chloromethanicum CM4]
 gi|240006758|gb|ACS37984.1| BolA-like protein [Methylobacterium extorquens AM1]
 gi|254265943|emb|CAX21692.1| BolA-like protein [Methylobacterium extorquens DM4]
          Length = 78

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 55/76 (72%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+  EIE MI++ +P + V I DLAGDG+HYAA +IS  F+GK R+ QHQMVY +L  
Sbjct: 1  MPMDAREIESMIREALPDAHVEIKDLAGDGDHYAATVISAAFKGKTRVAQHQMVYGALQG 60

Query: 61 KMGNALHALSIKTSVP 76
          +MG  LHAL++ T VP
Sbjct: 61 RMGGVLHALALTTGVP 76


>gi|87200533|ref|YP_497790.1| BolA-like protein [Novosphingobium aromaticivorans DSM 12444]
 gi|87136214|gb|ABD26956.1| transcriptional regulator, BolA protein family [Novosphingobium
          aromaticivorans DSM 12444]
          Length = 77

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 40/77 (51%), Positives = 57/77 (74%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M   EIE MI+  +P + V I DLAGDG+HYAA ++S  F G +R++QH++VYD+LG 
Sbjct: 1  MAMPAAEIEAMIRAALPDADVEITDLAGDGDHYAARVVSAAFAGLSRVKQHKLVYDALGG 60

Query: 61 KMGNALHALSIKTSVPD 77
          +MG  LHAL + T+VP+
Sbjct: 61 RMGGELHALQLTTAVPN 77


>gi|289612807|emb|CBI60016.1| unnamed protein product [Sordaria macrospora]
          Length = 80

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 52/79 (65%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M    IE +I   IP ++V I DLAGDG+HYAA ++SE FRGK RI Q + VY +LG 
Sbjct: 1  MPMEAQAIEALIVAAIPDAVVEITDLAGDGDHYAARVVSESFRGKPRIAQQRAVYAALGG 60

Query: 61 KMGNALHALSIKTSVPDSQ 79
          +MG  LHAL + T VP  Q
Sbjct: 61 RMGGELHALQLTTGVPTPQ 79


>gi|254701601|ref|ZP_05163429.1| hypothetical protein Bsuib55_12190 [Brucella suis bv. 5 str. 513]
          Length = 62

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 39/62 (62%), Positives = 53/62 (85%)

Query: 16 IPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSV 75
          +P + VTI DLAGDG+H+AAE+++E FRGK+R+QQHQMVYD+L   MG  LHAL+++TSV
Sbjct: 1  MPDAKVTIRDLAGDGDHFAAEVVAESFRGKSRVQQHQMVYDALKGNMGGVLHALALQTSV 60

Query: 76 PD 77
          P+
Sbjct: 61 PE 62


>gi|144897480|emb|CAM74344.1| BolA-like protein [Magnetospirillum gryphiswaldense MSR-1]
          Length = 85

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 41/78 (52%), Positives = 57/78 (73%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M    IE+MIK+  P + V I DL GDG+HY+A ++SE F+GK+R+ QHQMVY +L  
Sbjct: 1  MPMEASVIEQMIKEAFPDAKVIIEDLRGDGDHYSAMVVSEAFKGKSRVAQHQMVYGALQG 60

Query: 61 KMGNALHALSIKTSVPDS 78
          KMG  LHAL+++T+ PD+
Sbjct: 61 KMGGELHALALQTATPDT 78


>gi|300023620|ref|YP_003756231.1| BolA family protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525441|gb|ADJ23910.1| BolA family protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 78

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 56/75 (74%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M   EIE++IK   P + + + DLAGD +H+AA ++S  F+GK+R+QQHQMVYD+LG 
Sbjct: 1  MPMPAPEIERLIKARFPDAQIELRDLAGDNDHWAAHVVSAAFKGKSRVQQHQMVYDALGG 60

Query: 61 KMGNALHALSIKTSV 75
          +MG+ LHAL + T+V
Sbjct: 61 RMGDVLHALQLTTAV 75


>gi|114569574|ref|YP_756254.1| BolA family protein [Maricaulis maris MCS10]
 gi|114340036|gb|ABI65316.1| transcriptional regulator, BolA protein family [Maricaulis maris
          MCS10]
          Length = 77

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 56/77 (72%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M   +I  +IK GIP + +T+ DLAGD +H+ A ++SE FRGK R+ QHQMVY +LG+
Sbjct: 1  MPMPADDIIALIKAGIPDADITMTDLAGDNDHWQALVVSESFRGKLRVAQHQMVYAALGD 60

Query: 61 KMGNALHALSIKTSVPD 77
          KMG  LHAL+++T  PD
Sbjct: 61 KMGGELHALALETRTPD 77


>gi|162147745|ref|YP_001602206.1| bolA protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542370|ref|YP_002274599.1| BolA family protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786322|emb|CAP55904.1| putative bolA protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530047|gb|ACI49984.1| BolA family protein [Gluconacetobacter diazotrophicus PAl 5]
          Length = 78

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 57/77 (74%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M   EIE  I+  +P + ++I DLAGDG+HYA  ++SE FRG +R++QHQ+VY +L  
Sbjct: 1  MAMTAQEIETYIRTALPDASISIEDLAGDGDHYACTVVSEAFRGLSRVRQHQVVYAALQG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG  LHAL+++T+VP+
Sbjct: 61 HMGGKLHALALQTNVPE 77


>gi|330814236|ref|YP_004358475.1| YrbA protein [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487331|gb|AEA81736.1| YrbA protein [Candidatus Pelagibacter sp. IMCC9063]
          Length = 76

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/73 (54%), Positives = 56/73 (76%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M++   EIE+++K+G P + + I DLAGD NH++A+IIS  F+GK+R+QQHQMVY SL  
Sbjct: 1  MAIKQQEIEQLLKEGFPDAEIQIQDLAGDDNHFSAKIISSAFKGKSRVQQHQMVYSSLKG 60

Query: 61 KMGNALHALSIKT 73
          KMG  LHAL++ T
Sbjct: 61 KMGTDLHALALTT 73


>gi|58040730|ref|YP_192694.1| hypothetical protein GOX2305 [Gluconobacter oxydans 621H]
 gi|58003144|gb|AAW62038.1| Hypothetical protein GOX2305 [Gluconobacter oxydans 621H]
          Length = 76

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 53/76 (69%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M   EIE+ I   IP + + I DLAGDG+HYA  + SE FRG +R++QH++VYD+ G 
Sbjct: 1  MPMAASEIERTILAAIPDARIEIEDLAGDGDHYACTVTSEAFRGLSRVRQHKLVYDAFGT 60

Query: 61 KMGNALHALSIKTSVP 76
          +MG  LHA+++KT  P
Sbjct: 61 RMGTELHAMALKTLTP 76


>gi|126462365|ref|YP_001043479.1| BolA family protein [Rhodobacter sphaeroides ATCC 17029]
 gi|332558389|ref|ZP_08412711.1| BolA family protein [Rhodobacter sphaeroides WS8N]
 gi|126104029|gb|ABN76707.1| BolA family protein [Rhodobacter sphaeroides ATCC 17029]
 gi|332276101|gb|EGJ21416.1| BolA family protein [Rhodobacter sphaeroides WS8N]
          Length = 80

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/80 (53%), Positives = 56/80 (70%), Gaps = 3/80 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M   +IE +I+   P++ +TI DLAGDGNH+AAE+I E FRG NR+Q  +MVY SL  
Sbjct: 1  MAMEAQDIEDLIRARFPEAKITITDLAGDGNHWAAEVIDESFRGLNRVQAQRMVYASLKG 60

Query: 61 KMGNA---LHALSIKTSVPD 77
          KM  A   LHAL++ T VPD
Sbjct: 61 KMDGAHGELHALALTTKVPD 80


>gi|114766200|ref|ZP_01445200.1| BolA-like protein [Pelagibaca bermudensis HTCC2601]
 gi|114541571|gb|EAU44614.1| BolA-like protein [Roseovarius sp. HTCC2601]
          Length = 80

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/80 (53%), Positives = 56/80 (70%), Gaps = 3/80 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M++   EIE++I+   P + +TI DLAGDGNHYAAE+I E FRGKNR+QQ + VY +L  
Sbjct: 1  MAIEATEIEQLIRAEFPDAQITITDLAGDGNHYAAEVIDESFRGKNRVQQQRAVYAALKG 60

Query: 61 KMGNA---LHALSIKTSVPD 77
          KM  A   LHAL++ T  PD
Sbjct: 61 KMDGAHGELHALALTTKAPD 80


>gi|77463509|ref|YP_353013.1| BolA-like protein [Rhodobacter sphaeroides 2.4.1]
 gi|221639371|ref|YP_002525633.1| BolA family protein [Rhodobacter sphaeroides KD131]
 gi|77387927|gb|ABA79112.1| BolA-like protein [Rhodobacter sphaeroides 2.4.1]
 gi|221160152|gb|ACM01132.1| BolA family protein [Rhodobacter sphaeroides KD131]
          Length = 80

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/80 (53%), Positives = 56/80 (70%), Gaps = 3/80 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M   +IE +I+   P++ +TI DLAGDGNH+AAE+I E FRG NR+Q  +MVY SL  
Sbjct: 1  MAMEAQDIEDLIRARFPEAKITITDLAGDGNHWAAEVIDESFRGLNRVQAQRMVYASLQG 60

Query: 61 KMGNA---LHALSIKTSVPD 77
          KM  A   LHAL++ T VPD
Sbjct: 61 KMDGAHGELHALALTTKVPD 80


>gi|83592046|ref|YP_425798.1| BolA-like protein [Rhodospirillum rubrum ATCC 11170]
 gi|83574960|gb|ABC21511.1| BolA-like protein [Rhodospirillum rubrum ATCC 11170]
          Length = 77

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 55/77 (71%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M   +I+ +I+   P + VTI DL GDG+HYAA++IS  F GK R+QQHQMVYD+L  
Sbjct: 1  MAMEAGQIKTLIQDAFPDAEVTIEDLRGDGDHYAAQVISAAFTGKTRVQQHQMVYDALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
          KMG  LHAL+++T   D
Sbjct: 61 KMGGDLHALALQTKPKD 77


>gi|254456493|ref|ZP_05069922.1| BolA-like protein [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083495|gb|EDZ60921.1| BolA-like protein [Candidatus Pelagibacter sp. HTCC7211]
          Length = 74

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/71 (57%), Positives = 55/71 (77%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+  EIE +IK+ +  + V I DLAGDGNHY+A + S +F GK++I+QH+MVY+SL  KM
Sbjct: 1  MDLKEIESLIKEALSDATVEIQDLAGDGNHYSATVTSSQFSGKSKIEQHKMVYNSLKGKM 60

Query: 63 GNALHALSIKT 73
          GN LHAL+IKT
Sbjct: 61 GNELHALAIKT 71


>gi|146276942|ref|YP_001167101.1| BolA family protein [Rhodobacter sphaeroides ATCC 17025]
 gi|145555183|gb|ABP69796.1| BolA family protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 80

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 55/80 (68%), Gaps = 3/80 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M   +IE +I+   PQ+ +TI DLAGDGNH++AE+I E FRG NR+QQ + VY SL  
Sbjct: 1  MAMEAQDIENLIRASFPQAKITITDLAGDGNHWSAEVIDESFRGMNRVQQQRAVYASLKG 60

Query: 61 KMGNA---LHALSIKTSVPD 77
          KM  A   LHAL++ T  PD
Sbjct: 61 KMDGAHGELHALALTTKAPD 80


>gi|94496965|ref|ZP_01303539.1| BolA-like protein [Sphingomonas sp. SKA58]
 gi|94423641|gb|EAT08668.1| BolA-like protein [Sphingomonas sp. SKA58]
          Length = 77

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 39/77 (50%), Positives = 54/77 (70%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M   +I +MI+  IP + V I DLAGDG+HYAA ++SE FRG +R+ Q + VY +LG 
Sbjct: 1  MPMAADDIAQMIRAAIPDAQVEITDLAGDGDHYAARVVSESFRGMSRVAQQRAVYAALGG 60

Query: 61 KMGNALHALSIKTSVPD 77
          +MG  LHAL + T+VP+
Sbjct: 61 RMGGVLHALQLTTAVPN 77


>gi|126726352|ref|ZP_01742193.1| BolA-like protein [Rhodobacterales bacterium HTCC2150]
 gi|126704215|gb|EBA03307.1| BolA-like protein [Rhodobacterales bacterium HTCC2150]
          Length = 80

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 3/80 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M  +EIE +I+ G P + +TI DLAGDGNHYAAE++ E FR +NR+QQ + VY +L  
Sbjct: 1  MAMQANEIEDLIRAGFPDAKITITDLAGDGNHYAAEVVDESFRNQNRVQQQRAVYAALKG 60

Query: 61 KMGNA---LHALSIKTSVPD 77
          KM  A   LHAL++ T  P+
Sbjct: 61 KMDGANGELHALALTTKAPE 80


>gi|307294004|ref|ZP_07573848.1| BolA family protein [Sphingobium chlorophenolicum L-1]
 gi|306880155|gb|EFN11372.1| BolA family protein [Sphingobium chlorophenolicum L-1]
          Length = 77

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 39/77 (50%), Positives = 53/77 (68%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M   EI  MI+  IP + V I DLAGDG+HYAA +++E FRG +R+ Q + VY +LG 
Sbjct: 1  MPMAADEIADMIRAAIPDAQVEITDLAGDGDHYAARVVAESFRGMSRVAQQRAVYAALGG 60

Query: 61 KMGNALHALSIKTSVPD 77
          +MG  LHAL + T+VP+
Sbjct: 61 RMGGVLHALQLTTAVPN 77


>gi|262277062|ref|ZP_06054855.1| conserved domain protein [alpha proteobacterium HIMB114]
 gi|262224165|gb|EEY74624.1| conserved domain protein [alpha proteobacterium HIMB114]
          Length = 76

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 55/73 (75%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M++   EIEK++K+G P + + I DLAGD NH++A+I S +F+GK R+QQHQMVY +L  
Sbjct: 1  MAIKQEEIEKLLKEGFPDADIEIQDLAGDDNHFSAKIKSSQFKGKTRVQQHQMVYKALKG 60

Query: 61 KMGNALHALSIKT 73
          KMG  LHAL++ T
Sbjct: 61 KMGAELHALALTT 73


>gi|296116202|ref|ZP_06834820.1| BolA family protein [Gluconacetobacter hansenii ATCC 23769]
 gi|295977308|gb|EFG84068.1| BolA family protein [Gluconacetobacter hansenii ATCC 23769]
          Length = 77

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 56/77 (72%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M   EIE  I+  +P + + I DLAGDG+HYA +++S  FRG +R++QHQ+VY++L  
Sbjct: 1  MAMTAQEIETYIRGALPDAQIHIDDLAGDGDHYACKVVSNAFRGLSRVKQHQLVYNALQG 60

Query: 61 KMGNALHALSIKTSVPD 77
           MG  LHAL+++TS PD
Sbjct: 61 HMGGKLHALALQTSTPD 77


>gi|296446809|ref|ZP_06888747.1| BolA family protein [Methylosinus trichosporium OB3b]
 gi|296255684|gb|EFH02773.1| BolA family protein [Methylosinus trichosporium OB3b]
          Length = 76

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 55/73 (75%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M   EIE++IK  IP +++ I  LA DG+H+AAE+ SE FRGK+R+QQHQMV  + G+
Sbjct: 1  MAMERSEIERLIKAAIPDAVIQITALADDGDHWAAEVKSEAFRGKSRVQQHQMVNKAFGD 60

Query: 61 KMGNALHALSIKT 73
          ++G  LHAL++ T
Sbjct: 61 RLGGELHALALTT 73


>gi|261752154|ref|ZP_05995863.1| BolA family protein [Brucella suis bv. 5 str. 513]
 gi|261741907|gb|EEY29833.1| BolA family protein [Brucella suis bv. 5 str. 513]
          Length = 57

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 37/57 (64%), Positives = 50/57 (87%)

Query: 21 VTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          +TI DLAGDG+H+AAE+++E FRGK+R+QQHQMVYD+L   MG  LHAL+++TSVP+
Sbjct: 1  MTIRDLAGDGDHFAAEVVAESFRGKSRVQQHQMVYDALKGNMGGVLHALALQTSVPE 57


>gi|260426056|ref|ZP_05780035.1| BolA family protein [Citreicella sp. SE45]
 gi|260420548|gb|EEX13799.1| BolA family protein [Citreicella sp. SE45]
          Length = 80

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 43/80 (53%), Positives = 57/80 (71%), Gaps = 3/80 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M++   EIE++I+   P + +TI DLAGDGNHYAAE+I E FRGKNR+QQ + VY +L  
Sbjct: 1  MAIEATEIEQLIRAAFPDAKITITDLAGDGNHYAAEVIDESFRGKNRVQQQRAVYAALQG 60

Query: 61 KM-GN--ALHALSIKTSVPD 77
          KM GN   LHAL++ T  P+
Sbjct: 61 KMDGNNGDLHALALTTKAPE 80


>gi|330994573|ref|ZP_08318496.1| hypothetical protein SXCC_04461 [Gluconacetobacter sp. SXCC-1]
 gi|329758214|gb|EGG74735.1| hypothetical protein SXCC_04461 [Gluconacetobacter sp. SXCC-1]
          Length = 75

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 38/75 (50%), Positives = 53/75 (70%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EIE  I++ +P + + I DLAGDG+HYA  ++SE FRG  R++QHQMVY++L   M
Sbjct: 1  MTAQEIETYIREALPDAKIQIDDLAGDGDHYACRVVSEAFRGLPRVRQHQMVYNALQGHM 60

Query: 63 GNALHALSIKTSVPD 77
          G  LHAL+++T  PD
Sbjct: 61 GGKLHALALQTQTPD 75


>gi|258542295|ref|YP_003187728.1| BolA-like protein [Acetobacter pasteurianus IFO 3283-01]
 gi|329113459|ref|ZP_08242240.1| hypothetical protein APO_0228 [Acetobacter pomorum DM001]
 gi|256633373|dbj|BAH99348.1| BolA-like protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256636432|dbj|BAI02401.1| BolA-like protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256639485|dbj|BAI05447.1| BolA-like protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256642541|dbj|BAI08496.1| BolA-like protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256645596|dbj|BAI11544.1| BolA-like protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256648649|dbj|BAI14590.1| BolA-like protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256651702|dbj|BAI17636.1| BolA-like protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654693|dbj|BAI20620.1| BolA-like protein [Acetobacter pasteurianus IFO 3283-12]
 gi|326697284|gb|EGE48944.1| hypothetical protein APO_0228 [Acetobacter pomorum DM001]
          Length = 76

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 37/76 (48%), Positives = 54/76 (71%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+  E+E  I++  P + + I DLAGDG+HYA  ++SE FRG +R++QHQ+VY +L  
Sbjct: 1  MAMSATELETYIRQAFPDAQIKIDDLAGDGDHYACSVVSEAFRGLSRVRQHQLVYQALQG 60

Query: 61 KMGNALHALSIKTSVP 76
           MG  LHAL++ TS P
Sbjct: 61 HMGGKLHALALTTSAP 76


>gi|149914754|ref|ZP_01903284.1| transketolase [Roseobacter sp. AzwK-3b]
 gi|149811547|gb|EDM71382.1| transketolase [Roseobacter sp. AzwK-3b]
          Length = 78

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/78 (52%), Positives = 53/78 (67%), Gaps = 3/78 (3%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P EIE +I+ G P + +TI DLAGDGNHYAAE+I   F+G NR+QQ + VY +L  KM
Sbjct: 1  MQPQEIEDLIRTGFPDAQITITDLAGDGNHYAAEVIDAAFKGMNRVQQQRAVYATLKGKM 60

Query: 63 GNA---LHALSIKTSVPD 77
            +   LHAL++ T  PD
Sbjct: 61 DGSHGELHALALTTKAPD 78


>gi|182680022|ref|YP_001834168.1| BolA family protein [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182635905|gb|ACB96679.1| BolA family protein [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 77

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/76 (53%), Positives = 52/76 (68%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M   EIE++IK GIP + V I DL GD +HY+A +IS EF GK ++QQHQ+VY +LG 
Sbjct: 1  MPMEQSEIERLIKAGIPDAKVQITDLVGDKDHYSAIVISSEFTGKTKLQQHQIVYKALGG 60

Query: 61 KMGNALHALSIKTSVP 76
           MG  LHAL + T  P
Sbjct: 61 NMGGVLHALQLTTYAP 76


>gi|103485851|ref|YP_615412.1| BolA-like protein [Sphingopyxis alaskensis RB2256]
 gi|98975928|gb|ABF52079.1| BolA-like protein [Sphingopyxis alaskensis RB2256]
          Length = 77

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 53/76 (69%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M   E++ MI+   P + VTI DLAGD +HY+A ++SE FRG +R+ QH+ VY +LG 
Sbjct: 1  MGMREDELKAMIEAAFPGAAVTITDLAGDNDHYSAHVVSESFRGMSRVAQHKAVYAALGG 60

Query: 61 KMGNALHALSIKTSVP 76
          +MG  LHAL + T+VP
Sbjct: 61 RMGGELHALQLTTAVP 76


>gi|217977369|ref|YP_002361516.1| BolA family protein [Methylocella silvestris BL2]
 gi|217502745|gb|ACK50154.1| BolA family protein [Methylocella silvestris BL2]
          Length = 77

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 52/76 (68%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M P +IE +IKKGIP + + + DL GD +H++A I S EF GK ++QQHQ+VY +LG 
Sbjct: 1  MPMEPADIETLIKKGIPDAKIELTDLVGDKDHWSATITSAEFVGKTKLQQHQIVYKALGA 60

Query: 61 KMGNALHALSIKTSVP 76
           MG  LHAL + T  P
Sbjct: 61 FMGGPLHALQLNTQAP 76


>gi|312113104|ref|YP_004010700.1| BolA family protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311218233|gb|ADP69601.1| BolA family protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 78

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 54/76 (71%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M  HEIE++IK+ +P + V I  L GDG+HYAA + S  F GK+R+QQHQ+VY +L  
Sbjct: 1  MPMEAHEIERLIKEHLPDAEVQIEALKGDGDHYAALVTSTAFAGKSRVQQHQLVYAALKG 60

Query: 61 KMGNALHALSIKTSVP 76
          +MG  LHAL++ T +P
Sbjct: 61 RMGGELHALALTTRLP 76


>gi|294012811|ref|YP_003546271.1| BolA-like protein [Sphingobium japonicum UT26S]
 gi|292676141|dbj|BAI97659.1| BolA-like protein [Sphingobium japonicum UT26S]
          Length = 77

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 52/77 (67%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M   EI  MI+  IP + V I DLAGDG+HYAA +++E FRG +R+ Q + VY +L  
Sbjct: 1  MPMAAEEIADMIRAAIPDAQVEITDLAGDGDHYAARVVAESFRGMSRVAQQRAVYAALDG 60

Query: 61 KMGNALHALSIKTSVPD 77
          +MG  LHAL + T+VP+
Sbjct: 61 RMGGVLHALQLTTAVPN 77


>gi|260575243|ref|ZP_05843243.1| BolA family protein [Rhodobacter sp. SW2]
 gi|259022503|gb|EEW25799.1| BolA family protein [Rhodobacter sp. SW2]
          Length = 80

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 57/80 (71%), Gaps = 3/80 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M++   +IE +I++  PQ+ +TI DLAGDGNH+AAE+I E F+G+NR+QQ + VY +L  
Sbjct: 1  MAIQAQDIEDLIRERFPQARITITDLAGDGNHWAAEVIDESFKGQNRVQQQRAVYAALKG 60

Query: 61 KMGNA---LHALSIKTSVPD 77
          KM  A   LHAL++ T  P+
Sbjct: 61 KMDGAHGELHALALTTKAPE 80


>gi|85373484|ref|YP_457546.1| hypothetical protein ELI_03285 [Erythrobacter litoralis HTCC2594]
 gi|84786567|gb|ABC62749.1| hypothetical protein ELI_03285 [Erythrobacter litoralis HTCC2594]
          Length = 77

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 37/76 (48%), Positives = 54/76 (71%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+  EI + I   +P + V + DLAGD +H+AA + + +F GKNR+QQH+MVY++LG 
Sbjct: 1  MPMSADEITEAITAALPGAQVEMTDLAGDNDHWAARVTAPQFAGKNRVQQHKMVYEALGG 60

Query: 61 KMGNALHALSIKTSVP 76
          +MG  LHAL + T+VP
Sbjct: 61 RMGGVLHALQLTTAVP 76


>gi|310816548|ref|YP_003964512.1| BolA family protein [Ketogulonicigenium vulgare Y25]
 gi|308755283|gb|ADO43212.1| BolA family protein [Ketogulonicigenium vulgare Y25]
          Length = 80

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 55/80 (68%), Gaps = 3/80 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M++   EIE +I+   P + +TI DLAGDGNH+AAE+I E FRG NR+QQ + VY +L +
Sbjct: 1  MAIEAQEIEDLIRASFPAARITITDLAGDGNHWAAEVIDESFRGLNRVQQQRAVYAALKD 60

Query: 61 KM---GNALHALSIKTSVPD 77
          +M     ALHAL++ T  P+
Sbjct: 61 QMEGANGALHALALTTKAPE 80


>gi|119384132|ref|YP_915188.1| BolA family protein [Paracoccus denitrificans PD1222]
 gi|119373899|gb|ABL69492.1| BolA family protein [Paracoccus denitrificans PD1222]
          Length = 80

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 54/80 (67%), Gaps = 3/80 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M   +IE +I+   P + +TI DLAGDGNHYAAE+I E FRG+NR+QQ + VY +L  
Sbjct: 1  MAMEAQDIEALIRAAFPHAKITITDLAGDGNHYAAEVIDESFRGQNRVQQQRAVYAALQG 60

Query: 61 KM---GNALHALSIKTSVPD 77
           M     ALHAL++ T  P+
Sbjct: 61 HMDGPNGALHALALTTKAPE 80


>gi|83858773|ref|ZP_00952295.1| hypothetical protein OA2633_04701 [Oceanicaulis alexandrii
          HTCC2633]
 gi|83853596|gb|EAP91448.1| hypothetical protein OA2633_04701 [Oceanicaulis alexandrii
          HTCC2633]
          Length = 77

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/77 (50%), Positives = 54/77 (70%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M MN  +I  +IK+G+P + V I DLAGDG+HY A + S+ F G  R++QHQMVY +L  
Sbjct: 1  MPMNAEDIVSLIKEGVPGAEVEITDLAGDGDHYKAVVTSDAFSGMPRVKQHQMVYAALKG 60

Query: 61 KMGNALHALSIKTSVPD 77
          +MG  LHAL+++T  PD
Sbjct: 61 RMGGELHALALETRTPD 77


>gi|296283736|ref|ZP_06861734.1| hypothetical protein CbatJ_08944 [Citromicrobium bathyomarinum
          JL354]
          Length = 77

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 37/76 (48%), Positives = 54/76 (71%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M   EIE MIK  +P + V + DLAGD +H+AA++++ +F GK+R+QQH++VY++L  
Sbjct: 1  MPMAADEIEAMIKDALPGAEVEMRDLAGDNDHWAAKVVAPQFAGKSRVQQHKLVYEALDG 60

Query: 61 KMGNALHALSIKTSVP 76
          KMG  LHAL + T  P
Sbjct: 61 KMGGVLHALQLTTEPP 76


>gi|326387073|ref|ZP_08208683.1| BolA-like protein [Novosphingobium nitrogenifigens DSM 19370]
 gi|326208254|gb|EGD59061.1| BolA-like protein [Novosphingobium nitrogenifigens DSM 19370]
          Length = 80

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 48/66 (72%)

Query: 13 KKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIK 72
          K  +P + VTI DLAGDG+HYAA ++S  FRG +R+ QH+ VY +LG +MG  LHAL + 
Sbjct: 13 KAAMPDAEVTITDLAGDGDHYAAHVVSAAFRGMSRVAQHKAVYSALGGRMGGVLHALQLT 72

Query: 73 TSVPDS 78
          T+VP S
Sbjct: 73 TAVPTS 78


>gi|114799421|ref|YP_760647.1| BolA/YrbA family protein [Hyphomonas neptunium ATCC 15444]
 gi|114739595|gb|ABI77720.1| BolA/YrbA family protein [Hyphomonas neptunium ATCC 15444]
          Length = 77

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 52/76 (68%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+   + K + +  P + +T+ DLAGD NH+ AEI+S +F G  R++QHQMVYD+L  
Sbjct: 1  MGMSRETLTKYLTEAFPDAEITLTDLAGDDNHWQAEIVSAQFAGVPRVRQHQMVYDALKG 60

Query: 61 KMGNALHALSIKTSVP 76
          +MG  LHAL++KT  P
Sbjct: 61 EMGGVLHALALKTRAP 76


>gi|84684737|ref|ZP_01012637.1| BolA-like protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84667072|gb|EAQ13542.1| BolA-like protein [Rhodobacterales bacterium HTCC2654]
          Length = 80

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 40/79 (50%), Positives = 53/79 (67%), Gaps = 3/79 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M   EIE +I++  P + +TI DLAGDGNH+AAE+I E F+G NR+QQ + VY SL  
Sbjct: 1  MAMEGSEIEALIRETFPNAKITITDLAGDGNHWAAEVIDESFKGMNRVQQQRAVYASLKG 60

Query: 61 KMGNA---LHALSIKTSVP 76
          KM      LHAL++ T  P
Sbjct: 61 KMDGPNGDLHALALTTKAP 79


>gi|329891300|ref|ZP_08269643.1| bolA-like family protein [Brevundimonas diminuta ATCC 11568]
 gi|328846601|gb|EGF96165.1| bolA-like family protein [Brevundimonas diminuta ATCC 11568]
          Length = 80

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 37/76 (48%), Positives = 52/76 (68%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+  ++   + +  P + + I DLAGDG+HY A I+SE FRG NR++QHQ VY +L  
Sbjct: 1  MPMSVDDLRAHLVEAFPDADIAIEDLAGDGDHYRARIVSEVFRGMNRVRQHQTVYAALKG 60

Query: 61 KMGNALHALSIKTSVP 76
          KMG  LHAL+++TS P
Sbjct: 61 KMGGELHALALETSAP 76


>gi|197104466|ref|YP_002129843.1| stress-induced morphogen [Phenylobacterium zucineum HLK1]
 gi|196477886|gb|ACG77414.1| stress-induced morphogen [Phenylobacterium zucineum HLK1]
          Length = 77

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 53/76 (69%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M   ++E  +++G P + + I DLAGDG+HY A I+S+ F G  R++QHQ+VY +L  
Sbjct: 1  MPMALEDLEAALREGFPDADIQIQDLAGDGDHYRARIVSKAFAGLPRVRQHQLVYAALKG 60

Query: 61 KMGNALHALSIKTSVP 76
          +MG  LHAL+++TS P
Sbjct: 61 RMGGELHALALETSAP 76


>gi|149185812|ref|ZP_01864127.1| hypothetical protein ED21_23801 [Erythrobacter sp. SD-21]
 gi|148830373|gb|EDL48809.1| hypothetical protein ED21_23801 [Erythrobacter sp. SD-21]
          Length = 77

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 53/77 (68%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M   +I  +I+  +P ++V + DLAGD +H+AA++ + +F GK R+ QH+MVY++LG 
Sbjct: 1  MPMPAEDIVALIEAALPGAVVEMRDLAGDDDHWAAKVTAPQFAGKTRVAQHKMVYEALGE 60

Query: 61 KMGNALHALSIKTSVPD 77
          +MG  LHAL + T  P+
Sbjct: 61 RMGGELHALQLTTQAPN 77


>gi|332187522|ref|ZP_08389259.1| bolA-like family protein [Sphingomonas sp. S17]
 gi|332012451|gb|EGI54519.1| bolA-like family protein [Sphingomonas sp. S17]
          Length = 82

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M   +I  MI+  IP + V I DLAGDG+HYAA + +  F G +R+ + + VY +LG 
Sbjct: 1  MPMAADDIAAMIRAAIPDATVEITDLAGDGDHYAAHVTAASFAGMSRVARTRAVYAALGG 60

Query: 61 KMGNALHALSIKTSVP 76
          +MG  LHAL + T+VP
Sbjct: 61 RMGGELHALQLTTAVP 76


>gi|56696745|ref|YP_167106.1| BolA family protein [Ruegeria pomeroyi DSS-3]
 gi|56678482|gb|AAV95148.1| BolA family protein [Ruegeria pomeroyi DSS-3]
          Length = 78

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 36/77 (46%), Positives = 55/77 (71%), Gaps = 1/77 (1%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M  HEIE +I+   P++ +TI DLAGDGNH+AAE++ E FRG++RIQQ + V  ++  
Sbjct: 1  MAMEAHEIEALIRASFPKAKITITDLAGDGNHWAAEVVDESFRGQSRIQQQRAVNAAVKP 60

Query: 61 KMGNA-LHALSIKTSVP 76
          ++ +  LHAL++ T  P
Sbjct: 61 EIDSGKLHALALTTKAP 77


>gi|323135835|ref|ZP_08070918.1| BolA family protein [Methylocystis sp. ATCC 49242]
 gi|322398926|gb|EFY01445.1| BolA family protein [Methylocystis sp. ATCC 49242]
          Length = 76

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 52/76 (68%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M   EIE++IK+ +P + V +  LA D +H+AA ++SE FRG +R++QHQ+V  + G 
Sbjct: 1  MPMPAAEIERLIKQALPDATVELTALADDNDHWAATVVSESFRGLSRVKQHQLVNAAFGA 60

Query: 61 KMGNALHALSIKTSVP 76
          ++G  LHAL++ T  P
Sbjct: 61 RLGTELHALALTTRTP 76


>gi|45775282|gb|AAS77240.1| putative stress induced morphogen [uncultured bacterium]
          Length = 81

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 50/74 (67%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+P EIE MI +GIP + V + D  G G+H+ A ++S  F GK  I++HQ+VY +LG+ M
Sbjct: 1  MDPKEIETMIARGIPDATVEVRDYTGGGDHFEALVVSPSFEGKGLIERHQLVYQALGDAM 60

Query: 63 GNALHALSIKTSVP 76
             +HAL++KT  P
Sbjct: 61 RVQVHALTLKTLTP 74


>gi|167647426|ref|YP_001685089.1| BolA family protein [Caulobacter sp. K31]
 gi|167349856|gb|ABZ72591.1| BolA family protein [Caulobacter sp. K31]
          Length = 78

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 34/76 (44%), Positives = 52/76 (68%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+  ++E  +    P + + + DLAGDG+HY A I+S  FRG NR++QHQMV  +L +
Sbjct: 1  MPMSFPDLEARLHDAFPDAEIVLTDLAGDGDHYKARIVSPAFRGLNRVKQHQMVNRALAD 60

Query: 61 KMGNALHALSIKTSVP 76
           +G ALHAL+++T+ P
Sbjct: 61 VLGGALHALALETAAP 76


>gi|85710561|ref|ZP_01041625.1| hypothetical protein NAP1_09127 [Erythrobacter sp. NAP1]
 gi|85687739|gb|EAQ27744.1| hypothetical protein NAP1_09127 [Erythrobacter sp. NAP1]
          Length = 75

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 50/74 (67%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+  +IE  I   +P + V + DLAGD +H+AA + + +F GK R+QQH+MVY +LG +M
Sbjct: 1  MSGPDIEAAILAALPGASVELTDLAGDNDHWAAVVTAPQFVGKTRVQQHKMVYAALGGRM 60

Query: 63 GNALHALSIKTSVP 76
          G  LHAL + T VP
Sbjct: 61 GGELHALQVTTVVP 74


>gi|254292972|ref|YP_003058995.1| BolA family protein [Hirschia baltica ATCC 49814]
 gi|254041503|gb|ACT58298.1| BolA family protein [Hirschia baltica ATCC 49814]
          Length = 80

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/79 (46%), Positives = 53/79 (67%), Gaps = 3/79 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M+  ++   ++ G P + + + DLAGD NH+ AEI+SE+F+GK R+ QHQMVY SL  
Sbjct: 1  MAMSHDDLLSHLRDGFPDAEIILTDLAGDNNHWQAEIVSEQFKGKTRVAQHQMVYASLKG 60

Query: 61 KMGNA---LHALSIKTSVP 76
           M  A   LHAL++KT  P
Sbjct: 61 AMDGADGQLHALALKTRAP 79


>gi|300863588|ref|ZP_07108533.1| BolA-like protein [Oscillatoria sp. PCC 6506]
 gi|300338411|emb|CBN53675.1| BolA-like protein [Oscillatoria sp. PCC 6506]
          Length = 83

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 52/75 (69%), Gaps = 1/75 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          +NP ++  MI+ G+P + V I DL G G+HY A ++S EF GK+R++QHQ+VY +L   M
Sbjct: 2  VNPSQVVAMIQAGLPDAKVQIDDLTGGGDHYQAIVVSSEFEGKSRVKQHQLVYSTLKEAM 61

Query: 63 GN-ALHALSIKTSVP 76
           + A+HAL +KT  P
Sbjct: 62 ASEAIHALGLKTYTP 76


>gi|45775286|gb|AAS77243.1| putative stress induced morphogen [uncultured bacterium]
          Length = 82

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 50/74 (67%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+P EIE MI +GIP + V + D  G G+H+ A ++S  F GK  I++HQ+VY +LG+ M
Sbjct: 2  MDPKEIETMIARGIPDAQVEVRDYTGGGDHFEALVVSPSFEGKGLIERHQLVYQALGDAM 61

Query: 63 GNALHALSIKTSVP 76
             +HAL++KT  P
Sbjct: 62 RVQVHALTLKTLTP 75


>gi|186684040|ref|YP_001867236.1| BolA family protein [Nostoc punctiforme PCC 73102]
 gi|186466492|gb|ACC82293.1| BolA family protein [Nostoc punctiforme PCC 73102]
          Length = 85

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 51/77 (66%), Gaps = 1/77 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          ++P ++E MIK  +P + V + DL G G+HY   ++S  F GK  +QQHQ+VY +LG  M
Sbjct: 2  ISPQQVETMIKAELPDAQVQVQDLTGGGDHYQVTVVSSHFAGKGLVQQHQLVYGALGQAM 61

Query: 63 GN-ALHALSIKTSVPDS 78
             A+HAL++KT  P++
Sbjct: 62 STEAIHALAVKTYTPEA 78


>gi|300113023|ref|YP_003759598.1| BolA family protein [Nitrosococcus watsonii C-113]
 gi|299538960|gb|ADJ27277.1| BolA family protein [Nitrosococcus watsonii C-113]
          Length = 75

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 57/74 (77%), Gaps = 2/74 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MN  EI++MI+ G+P++ V +H  + DG+H+ A ++ E FRGK+ +++H+MVY++LG+  
Sbjct: 1  MNASEIKRMIETGLPEAEVAVH--SEDGHHFEALVVYEGFRGKSLLERHRMVYEALGDSF 58

Query: 63 GNALHALSIKTSVP 76
           +ALHAL+I+T +P
Sbjct: 59 KSALHALAIRTRLP 72


>gi|158338007|ref|YP_001519183.1| BolA family protein [Acaryochloris marina MBIC11017]
 gi|158308248|gb|ABW29865.1| BolA family protein [Acaryochloris marina MBIC11017]
          Length = 90

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 51/76 (67%), Gaps = 1/76 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          +NP ++  MI+ G+P + V + DL G G+HY A IIS EF GK  +QQHQ+VY S+   M
Sbjct: 2  INPDDLTAMIQAGLPGAEVFVQDLTGGGDHYQATIISAEFEGKTLVQQHQLVYRSVNQVM 61

Query: 63 GN-ALHALSIKTSVPD 77
           +  LHAL++KT  P+
Sbjct: 62 ASEQLHALALKTFTPE 77


>gi|282899010|ref|ZP_06306992.1| BolA-like protein [Cylindrospermopsis raciborskii CS-505]
 gi|281196150|gb|EFA71065.1| BolA-like protein [Cylindrospermopsis raciborskii CS-505]
          Length = 76

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 51/75 (68%), Gaps = 1/75 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P ++E+MIK  +P + V + DL G G+HY   ++S +F GK  +QQH++VYD+L   M
Sbjct: 2  ITPQQVEQMIKGELPDAQVQVQDLTGGGDHYQVTVVSSQFAGKGLVQQHRIVYDALKQAM 61

Query: 63 GN-ALHALSIKTSVP 76
             A+HAL++KTS P
Sbjct: 62 STEAIHALALKTSAP 76


>gi|77166233|ref|YP_344758.1| BolA-like protein [Nitrosococcus oceani ATCC 19707]
 gi|254435694|ref|ZP_05049201.1| BolA-like protein [Nitrosococcus oceani AFC27]
 gi|76884547|gb|ABA59228.1| transcriptional regulator, BolA protein family [Nitrosococcus
          oceani ATCC 19707]
 gi|207088805|gb|EDZ66077.1| BolA-like protein [Nitrosococcus oceani AFC27]
          Length = 75

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 56/74 (75%), Gaps = 2/74 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MN  EI++MI+ G+P+S V +H  + DG+H+ A ++ E FRGK+ +++H+MVY++LG+  
Sbjct: 1  MNASEIKRMIETGLPESEVAVH--SEDGHHFEALVVYEGFRGKSLLERHRMVYEALGDSF 58

Query: 63 GNALHALSIKTSVP 76
           + LHAL+I+T +P
Sbjct: 59 KSTLHALAIRTQLP 72


>gi|56552770|ref|YP_163609.1| BolA family protein [Zymomonas mobilis subsp. mobilis ZM4]
 gi|260753500|ref|YP_003226393.1| BolA family protein [Zymomonas mobilis subsp. mobilis NCIMB
          11163]
 gi|56544344|gb|AAV90498.1| BolA family protein [Zymomonas mobilis subsp. mobilis ZM4]
 gi|258552863|gb|ACV75809.1| BolA family protein [Zymomonas mobilis subsp. mobilis NCIMB
          11163]
          Length = 77

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 52/77 (67%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M   EIE+ I K +P + V + DL G+G+H++A + +  F+G +R+ QH+ VYD+ G 
Sbjct: 1  MAMTIEEIEQYIIKAVPDADVEVVDLNGNGDHFSAIVTAASFKGLSRLAQHRRVYDAFGG 60

Query: 61 KMGNALHALSIKTSVPD 77
          +MG  LHAL + T +P+
Sbjct: 61 RMGEELHALKLTTRIPE 77


>gi|304321366|ref|YP_003855009.1| phosphoribosylformylglycinamidine synthase II [Parvularcula
           bermudensis HTCC2503]
 gi|303300268|gb|ADM09867.1| phosphoribosylformylglycinamidine synthase II [Parvularcula
           bermudensis HTCC2503]
          Length = 911

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 53/79 (67%), Gaps = 1/79 (1%)

Query: 1   MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
           M M   E+  MIK+ +P + + +  LAGD +H+ A IIS  F G NR+QQHQ+VY +L  
Sbjct: 833 MPMAKDELTTMIKEALPDAEIELTALAGDDDHWQARIISSAFDGLNRVQQHQLVYRALKG 892

Query: 61  KMGNALHALSIKTSVPDSQ 79
           KMG  LHAL+++T VP S+
Sbjct: 893 KMGGTLHALALET-VPLSK 910


>gi|17228293|ref|NP_484841.1| hypothetical protein asr0798 [Nostoc sp. PCC 7120]
 gi|17130143|dbj|BAB72755.1| asr0798 [Nostoc sp. PCC 7120]
          Length = 80

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 51/77 (66%), Gaps = 1/77 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P ++E+MIK  +P + V + DL G G+HY   ++S +F GK  +QQHQ+VY +L   M
Sbjct: 2  ITPQQVEEMIKAELPDAQVQVQDLTGGGDHYQVTVVSSQFAGKRLVQQHQLVYGALRQAM 61

Query: 63 GN-ALHALSIKTSVPDS 78
             A+HAL++KT  P++
Sbjct: 62 STEAIHALALKTYTPET 78


>gi|298491583|ref|YP_003721760.1| BolA family protein ['Nostoc azollae' 0708]
 gi|298233501|gb|ADI64637.1| BolA family protein ['Nostoc azollae' 0708]
          Length = 78

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 52/77 (67%), Gaps = 1/77 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P ++E+MIK  +P + V + DL G G+HY   ++S +F GK  ++QHQ+VY +L   M
Sbjct: 2  ITPQQVEEMIKAELPDAQVQVQDLTGGGDHYQVTVVSSQFAGKGLVKQHQLVYVALQQAM 61

Query: 63 GN-ALHALSIKTSVPDS 78
             A+HAL++KTS P++
Sbjct: 62 STEAIHALALKTSTPEA 78


>gi|282897522|ref|ZP_06305523.1| BolA-like protein [Raphidiopsis brookii D9]
 gi|281197617|gb|EFA72512.1| BolA-like protein [Raphidiopsis brookii D9]
          Length = 76

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P ++E+MIK  +P + V + DL G G+HY   ++S +F GK  +QQH++VYD+L   M
Sbjct: 2  ITPQQVEQMIKGELPDAQVQVQDLTGGGDHYQVTVVSSQFAGKGLVQQHRIVYDALKQAM 61

Query: 63 GN-ALHALSIKTSVP 76
             A+HAL++KT  P
Sbjct: 62 STEAIHALALKTCAP 76


>gi|325560509|gb|ADZ31228.1| BolA family protein [Fremyella diplosiphon Fd33]
          Length = 85

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 52/77 (67%), Gaps = 1/77 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          ++P ++E+MIK  +P + + + DL G G+HY   ++S +F GK  +QQHQ+VY +L   M
Sbjct: 2  ISPQQVEEMIKAELPDAQIQVQDLTGGGDHYQVTVVSSQFAGKRLVQQHQLVYGALRQAM 61

Query: 63 GN-ALHALSIKTSVPDS 78
             A+HAL++KT  P++
Sbjct: 62 STEAIHALALKTYTPEA 78


>gi|75906813|ref|YP_321109.1| BolA-like protein [Anabaena variabilis ATCC 29413]
 gi|75700538|gb|ABA20214.1| transcriptional regulator, BolA protein family [Anabaena
          variabilis ATCC 29413]
          Length = 80

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 50/77 (64%), Gaps = 1/77 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P ++E MIK  +P + V + DL G G+HY   ++S +F GK  +QQHQ+VY +L   M
Sbjct: 2  ITPQQVEAMIKAELPDAQVQVQDLTGGGDHYQVTVVSSQFAGKRLVQQHQLVYGALRQAM 61

Query: 63 GN-ALHALSIKTSVPDS 78
             A+HAL++KT  P++
Sbjct: 62 STEAIHALALKTYTPET 78


>gi|241762490|ref|ZP_04760567.1| BolA family protein [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|241372992|gb|EER62659.1| BolA family protein [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 77

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 52/77 (67%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M   EIE+ I K +P + + + DL G+G+H++A + +  F+G +R+ QH+ VYD+ G 
Sbjct: 1  MAMTIEEIEQYIIKAVPDADIEVVDLNGNGDHFSAIVTAASFKGLSRLAQHRRVYDAFGG 60

Query: 61 KMGNALHALSIKTSVPD 77
          +MG  LHAL + T +P+
Sbjct: 61 RMGEELHALKLTTRIPE 77


>gi|159030803|emb|CAO88482.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 83

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/77 (46%), Positives = 53/77 (68%), Gaps = 1/77 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          ++  ++E MI++ IP + V I DL G G+H  A +IS EF GK R++QHQMVY +L + +
Sbjct: 2  VDFRQVEAMIQEQIPDAQVMIRDLTGGGDHLEAVVISGEFAGKTRVKQHQMVYGALQSAL 61

Query: 63 GN-ALHALSIKTSVPDS 78
             A+HAL++KT  PDS
Sbjct: 62 ATEAIHALALKTYTPDS 78


>gi|302384221|ref|YP_003820044.1| BolA family protein [Brevundimonas subvibrioides ATCC 15264]
 gi|302194849|gb|ADL02421.1| BolA family protein [Brevundimonas subvibrioides ATCC 15264]
          Length = 80

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 49/78 (62%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M    +   + +  P + + I DLAGDG+HY A I+S  F G  R++QHQ+VY +L  
Sbjct: 1  MPMPVETLHAYLIQAFPDAEIAIDDLAGDGDHYRARIVSTAFAGLPRVKQHQLVYAALKG 60

Query: 61 KMGNALHALSIKTSVPDS 78
           MG ALHAL+++TS P +
Sbjct: 61 HMGGALHALALETSAPPT 78


>gi|22298418|ref|NP_681665.1| hypothetical protein tsl0875 [Thermosynechococcus elongatus BP-1]
 gi|22294597|dbj|BAC08427.1| tsl0875 [Thermosynechococcus elongatus BP-1]
          Length = 83

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 1/76 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P ++  +I+  +P + V + DL G G+HY A ++S  F GK  +QQHQ+VY SL + M
Sbjct: 2  VTPEQLTTLIQSRLPDAFVQVQDLTGGGDHYEAVVVSAAFEGKRLVQQHQLVYSSLKDLM 61

Query: 63 G-NALHALSIKTSVPD 77
            N LHAL++KT  P+
Sbjct: 62 ASNELHALALKTYTPE 77


>gi|116072439|ref|ZP_01469706.1| BolA family protein [Synechococcus sp. BL107]
 gi|116064961|gb|EAU70720.1| BolA family protein [Synechococcus sp. BL107]
          Length = 77

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P  +E  I++ IP + VT+ DL G G+H    ++S  F G  RI+QHQMVY +L  ++
Sbjct: 2  VQPSAVESAIQRAIPDATVTVEDLTGGGDHLQVSVVSSAFSGLTRIRQHQMVYGALQQEL 61

Query: 63 GN-ALHALSIKTSVP 76
           + A+HAL++ TSVP
Sbjct: 62 ASEAIHALALSTSVP 76


>gi|78184990|ref|YP_377425.1| BolA family protein [Synechococcus sp. CC9902]
 gi|78169284|gb|ABB26381.1| BolA family protein [Synechococcus sp. CC9902]
          Length = 77

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P  +E  I++ IP + VT+ DL G G+H    ++S  F G +RI+QHQMVY +L  ++
Sbjct: 2  VQPSAVESAIQRAIPDATVTVEDLTGGGDHLQVSVVSTAFSGLSRIRQHQMVYGALQQEL 61

Query: 63 GN-ALHALSIKTSVP 76
           + A+HAL++ TSVP
Sbjct: 62 ASEAIHALALSTSVP 76


>gi|326385908|ref|ZP_08207533.1| hypothetical protein Y88_0020 [Novosphingobium nitrogenifigens
          DSM 19370]
 gi|326209580|gb|EGD60372.1| hypothetical protein Y88_0020 [Novosphingobium nitrogenifigens
          DSM 19370]
          Length = 86

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 48/64 (75%)

Query: 16 IPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSV 75
          +P + V + D+AGDG+H+AA + S  F GK+RI QH++VY ++G  MG ALHAL+++T V
Sbjct: 16 LPDAQVMMIDMAGDGDHWAARVTSAAFAGKSRIAQHKLVYAAIGPDMGGALHALALQTFV 75

Query: 76 PDSQ 79
          P+ +
Sbjct: 76 PEGK 79


>gi|294676105|ref|YP_003576720.1| BolA family protein [Rhodobacter capsulatus SB 1003]
 gi|294474925|gb|ADE84313.1| BolA family protein [Rhodobacter capsulatus SB 1003]
          Length = 79

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (65%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M   +IE +I+ G P + +TI DLAGDGNH+ AE+I   F+G NR+QQ + V+ +L  
Sbjct: 1  MPMEASDIEALIRAGFPDAKITITDLAGDGNHWGAEVIDASFKGLNRVQQQRAVFATLKG 60

Query: 61 KMG--NA-LHALSIKT 73
           M   NA LHAL++ T
Sbjct: 61 AMDGPNAPLHALALTT 76


>gi|254419864|ref|ZP_05033588.1| BolA-like protein [Brevundimonas sp. BAL3]
 gi|196186041|gb|EDX81017.1| BolA-like protein [Brevundimonas sp. BAL3]
          Length = 91

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 51/79 (64%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+   + + + +  P + + I DLAGDG+HY A I+S  F G  R++QHQ+VY +L  
Sbjct: 12 MPMSVETLRQHLVEAFPDAEIAIDDLAGDGDHYRARIVSSAFAGMPRVRQHQLVYAALKG 71

Query: 61 KMGNALHALSIKTSVPDSQ 79
          +MG  LHAL+++T+ P  +
Sbjct: 72 QMGGELHALALETAAPPKE 90


>gi|166367410|ref|YP_001659683.1| BolA-like protein [Microcystis aeruginosa NIES-843]
 gi|166089783|dbj|BAG04491.1| BolA-like protein [Microcystis aeruginosa NIES-843]
          Length = 83

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 52/76 (68%), Gaps = 1/76 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          ++  ++E MI++ IP + V I DL G G+H  A +IS EF GK R++QHQMVY +L + +
Sbjct: 2  VDFRQVEAMIQEQIPDAQVMIRDLTGGGDHLEAVVISGEFAGKTRVKQHQMVYGALQSAL 61

Query: 63 GN-ALHALSIKTSVPD 77
             A+HAL++KT  PD
Sbjct: 62 ATEAIHALALKTYTPD 77


>gi|119509447|ref|ZP_01628595.1| BolA-like protein [Nodularia spumigena CCY9414]
 gi|119465853|gb|EAW46742.1| BolA-like protein [Nodularia spumigena CCY9414]
          Length = 123

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 50/77 (64%), Gaps = 1/77 (1%)

Query: 3   MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
           +NP ++E MIK  +P + + + DL G G+HY   ++S +F  K  +QQHQ+VY +L   M
Sbjct: 40  INPQQVEAMIKAEMPDAQIQVQDLTGGGDHYQVTVVSSQFADKGLVQQHQLVYGALRQAM 99

Query: 63  GN-ALHALSIKTSVPDS 78
              A+HAL++KT  P++
Sbjct: 100 STEAIHALAVKTYTPEA 116


>gi|126735634|ref|ZP_01751379.1| BolA family protein, putative [Roseobacter sp. CCS2]
 gi|126714821|gb|EBA11687.1| BolA family protein, putative [Roseobacter sp. CCS2]
          Length = 78

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 53/80 (66%), Gaps = 5/80 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          MS+  H+IE ++++  P +I+ +     DG H+AAE+I E FRGKNR+QQ + VY +L  
Sbjct: 1  MSITAHDIETLLRETFPDAIINVQ--GDDGAHFAAEVIDESFRGKNRLQQQRAVYAALKG 58

Query: 61 KM-GN--ALHALSIKTSVPD 77
          KM GN   LHAL++ T  P+
Sbjct: 59 KMDGNNGELHALALTTKAPE 78


>gi|220910084|ref|YP_002485395.1| BolA family protein [Cyanothece sp. PCC 7425]
 gi|219866695|gb|ACL47034.1| BolA family protein [Cyanothece sp. PCC 7425]
          Length = 85

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          ++P ++  MI+ G+P + V + DL G G+HY A ++S  F GK R+QQHQ+VY +L + M
Sbjct: 2  ISPDQLMTMIQSGLPDAQVQVQDLTGGGDHYQAVVVSSLFVGKKRLQQHQLVYQALQSAM 61

Query: 63 GN-ALHALSIKTSVP 76
              +HAL++KT  P
Sbjct: 62 ATEQIHALALKTYTP 76


>gi|262193588|ref|YP_003264797.1| BolA family protein [Haliangium ochraceum DSM 14365]
 gi|262076935|gb|ACY12904.1| BolA family protein [Haliangium ochraceum DSM 14365]
          Length = 80

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (62%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P  I   I++ +P + V + DL G  +H+ A I+SE FRGK  IQ+H++V+D+L  +M
Sbjct: 1  MKPEAITAKIRESLPDAKVELRDLTGTEDHWEAVIVSESFRGKTPIQRHRLVFDALAEEM 60

Query: 63 GNALHALSIKTSVPD 77
             +HA ++K   PD
Sbjct: 61 KGPIHAFTMKAWTPD 75


>gi|198284726|ref|YP_002221047.1| BolA family protein [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218665916|ref|YP_002427404.1| BolA family protein [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198249247|gb|ACH84840.1| BolA family protein [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218518129|gb|ACK78715.1| BolA family protein [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 110

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 52/75 (69%), Gaps = 2/75 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MNP  I+ +I++ +P ++V +  L  DG H+ A I+S  F G + I+QHQMVYD+LG++M
Sbjct: 27 MNPDTIKSLIQQRLPDALVEV--LGEDGTHFEALIVSPAFVGLSLIKQHQMVYDALGDRM 84

Query: 63 GNALHALSIKTSVPD 77
             +HALS++T  P+
Sbjct: 85 REEIHALSLRTLTPE 99


>gi|15838015|ref|NP_298703.1| hypothetical protein XF1414 [Xylella fastidiosa 9a5c]
 gi|9106426|gb|AAF84223.1|AE003972_8 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 75

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 49/77 (63%), Gaps = 2/77 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+   I K+I+ G+PQ+   +     DG H+ A +I E FRGK  + +H+MVY S+G+ M
Sbjct: 1  MDAETIRKLIESGLPQARADVR--GEDGVHFEATVICEAFRGKGPLARHRMVYASIGDLM 58

Query: 63 GNALHALSIKTSVPDSQ 79
          G A+HAL +KT  PD +
Sbjct: 59 GRAVHALQLKTLTPDEE 75


>gi|254410525|ref|ZP_05024304.1| BolA-like protein [Microcoleus chthonoplastes PCC 7420]
 gi|196182731|gb|EDX77716.1| BolA-like protein [Microcoleus chthonoplastes PCC 7420]
          Length = 88

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 52/77 (67%), Gaps = 1/77 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          ++P ++E MIK  +P + V + DL G G+H  A ++S +F GK+ ++QHQ+VY +L   M
Sbjct: 4  ISPEQVETMIKAELPDAQVQVQDLTGGGDHLQAIVVSSQFEGKSLVKQHQLVYGALQQAM 63

Query: 63 GN-ALHALSIKTSVPDS 78
           + A+HAL++KT  P S
Sbjct: 64 ASEAIHALALKTYTPAS 80


>gi|28198551|ref|NP_778865.1| hypothetical protein PD0643 [Xylella fastidiosa Temecula1]
 gi|71897591|ref|ZP_00679836.1| BolA-like protein [Xylella fastidiosa Ann-1]
 gi|182681231|ref|YP_001829391.1| BolA family protein [Xylella fastidiosa M23]
 gi|28056635|gb|AAO28514.1| conserved hypothetical protein [Xylella fastidiosa Temecula1]
 gi|71732494|gb|EAO34547.1| BolA-like protein [Xylella fastidiosa Ann-1]
 gi|182631341|gb|ACB92117.1| BolA family protein [Xylella fastidiosa M23]
 gi|307579678|gb|ADN63647.1| BolA family protein [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 75

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 49/77 (63%), Gaps = 2/77 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+   I K+I+ G+PQ+   +     DG H+ A +I E FRGK  + +H+MVY S+G+ M
Sbjct: 1  MDAETIRKLIESGLPQARADVR--GEDGVHFEATVICEAFRGKGPLARHRMVYASIGDLM 58

Query: 63 GNALHALSIKTSVPDSQ 79
          G A+HAL +KT  PD +
Sbjct: 59 GGAVHALQLKTLTPDEE 75


>gi|84515574|ref|ZP_01002936.1| BolA-like protein [Loktanella vestfoldensis SKA53]
 gi|84510857|gb|EAQ07312.1| BolA-like protein [Loktanella vestfoldensis SKA53]
          Length = 78

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 51/80 (63%), Gaps = 5/80 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M +  HEIE ++++  PQ+ +++     DG H+AAE+I E FRG NR+QQ + VY +L  
Sbjct: 1  MPITAHEIETLLRESFPQARISVQ--GDDGAHFAAEVIDESFRGLNRVQQQRAVYAALKG 58

Query: 61 KMGNA---LHALSIKTSVPD 77
          +M  +   LHAL++ T  PD
Sbjct: 59 RMDGSQGELHALALTTKAPD 78


>gi|113474527|ref|YP_720588.1| BolA-like protein [Trichodesmium erythraeum IMS101]
 gi|110165575|gb|ABG50115.1| BolA-like protein [Trichodesmium erythraeum IMS101]
          Length = 85

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (65%), Gaps = 1/76 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MN  ++E MIK  +P + V + DL G G+H  A ++S EF GK  ++QHQMVY ++   M
Sbjct: 1  MNLEQVESMIKAKLPDAQVEVQDLTGGGDHLQAIVVSSEFEGKTLVKQHQMVYAAVKEPM 60

Query: 63 GN-ALHALSIKTSVPD 77
           + A+HAL++KT  P+
Sbjct: 61 ASEAIHALALKTYTPE 76


>gi|74317910|ref|YP_315650.1| hypothetical protein Tbd_1892 [Thiobacillus denitrificans ATCC
          25259]
 gi|74057405|gb|AAZ97845.1| conserved hypothetical protein [Thiobacillus denitrificans ATCC
          25259]
          Length = 88

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 49/75 (65%), Gaps = 3/75 (4%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P +I+  I + +P   +   +L GDG H+ A I+S  F GKN IQQH++VYD+LG +M
Sbjct: 12 VTPEDIKSWITEKLPCDYI---ELDGDGQHFQAVIVSPAFAGKNTIQQHRLVYDALGTRM 68

Query: 63 GNALHALSIKTSVPD 77
             +HALS+KT  P+
Sbjct: 69 HAQIHALSMKTYTPE 83


>gi|295688628|ref|YP_003592321.1| bolA family protein [Caulobacter segnis ATCC 21756]
 gi|295430531|gb|ADG09703.1| BolA family protein [Caulobacter segnis ATCC 21756]
          Length = 78

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 49/76 (64%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+  E+E  +    P S + + DLAGD +H+ A I+S  F+G  R++QHQ+V  +L +
Sbjct: 1  MPMSHAELEARLTAAFPDSEIVLTDLAGDNDHWKARIVSPAFKGLPRVRQHQLVNRALAD 60

Query: 61 KMGNALHALSIKTSVP 76
           +G  LHAL+++T+ P
Sbjct: 61 VLGGTLHALALETAAP 76


>gi|218442153|ref|YP_002380482.1| BolA family protein [Cyanothece sp. PCC 7424]
 gi|218174881|gb|ACK73614.1| BolA family protein [Cyanothece sp. PCC 7424]
          Length = 86

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 51/73 (69%), Gaps = 1/73 (1%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-A 65
          ++E MI+  +P + V I DL G G+H  A ++S EF GK ++ QHQMVYD++ + M + +
Sbjct: 6  QVETMIQTKLPDAHVVIRDLTGGGDHLEAIVVSSEFAGKTKVIQHQMVYDAVASAMADES 65

Query: 66 LHALSIKTSVPDS 78
          +HAL++KT  P++
Sbjct: 66 IHALALKTYTPEA 78


>gi|110680176|ref|YP_683183.1| BolA family protein, putative [Roseobacter denitrificans OCh 114]
 gi|109456292|gb|ABG32497.1| BolA family protein, putative [Roseobacter denitrificans OCh 114]
          Length = 78

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 49/80 (61%), Gaps = 5/80 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M  HEIE ++++  P + + +H    DG H AA ++ E FRGKNR+QQ + VY +L  
Sbjct: 1  MPMQAHEIEDLLRQSFPDATIQVH--GDDGVHMAAMVVDESFRGKNRVQQQRAVYAALKG 58

Query: 61 KMGNA---LHALSIKTSVPD 77
          KM  +   LHAL++ T  PD
Sbjct: 59 KMDGSQGELHALALTTKAPD 78


>gi|114330864|ref|YP_747086.1| BolA family protein [Nitrosomonas eutropha C91]
 gi|114307878|gb|ABI59121.1| transcriptional regulator, BolA protein family [Nitrosomonas
          eutropha C91]
          Length = 84

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 51/70 (72%), Gaps = 2/70 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALH 67
          IE  IK  +P + + +  +  DG+H++A I+SE+F+GKN ++QHQ+VY +LG++M   +H
Sbjct: 7  IEHSIKTALPCTWIKV--VGDDGHHFSAVIVSEQFQGKNIVKQHQLVYQALGDRMREEIH 64

Query: 68 ALSIKTSVPD 77
          ALS+KT  P+
Sbjct: 65 ALSMKTYTPE 74


>gi|67459677|ref|YP_247301.1| morphology/transcriptional regulatory  protein BolA [Rickettsia
          felis URRWXCal2]
 gi|67005210|gb|AAY62136.1| BolA protein homolog [Rickettsia felis URRWXCal2]
          Length = 79

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 53/78 (67%), Gaps = 1/78 (1%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+++  E+EK++KK  P SI+ I DL GD +HYA EI   +F G + I QH++V ++L  
Sbjct: 1  MAISAEELEKILKKSFPNSIIKITDLVGDQDHYALEISDVQFNGLSLINQHKLVKNALSE 60

Query: 61 KMGNALHALSIKT-SVPD 77
           +   LHA++IKT +VP+
Sbjct: 61 ILNKKLHAITIKTIAVPE 78


>gi|15604644|ref|NP_221162.1| hypothetical protein RP812 [Rickettsia prowazekii str. Madrid E]
 gi|6686139|sp|Q9ZCE4|Y812_RICPR RecName: Full=Uncharacterized protein RP812
 gi|3861339|emb|CAA15238.1| unknown [Rickettsia prowazekii]
 gi|292572463|gb|ADE30378.1| BolA-like protein [Rickettsia prowazekii Rp22]
          Length = 77

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 52/77 (67%), Gaps = 1/77 (1%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+++  E+EK++KK  P S++ I DL GD +HYA EI   +F G + I QH++V ++L  
Sbjct: 1  MAISAEELEKILKKSFPSSVIKITDLVGDQDHYALEISDAQFNGLSLINQHKLVKNALSE 60

Query: 61 KMGNALHALSIKT-SVP 76
           +   LH++SIKT S+P
Sbjct: 61 ILNKKLHSISIKTISIP 77


>gi|329851034|ref|ZP_08265791.1| bolA-like family protein [Asticcacaulis biprosthecum C19]
 gi|328839880|gb|EGF89452.1| bolA-like family protein [Asticcacaulis biprosthecum C19]
          Length = 83

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 50/78 (64%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M++   E++  I+   P + VTI DLAGDG+HY A I+S  F G  R++QHQ+V  +L +
Sbjct: 1  MAIAQSELQARIEAAFPDAEVTITDLAGDGDHYKARIVSGAFNGLARVRQHQLVNRALAD 60

Query: 61 KMGNALHALSIKTSVPDS 78
           +   LHAL+++T   D+
Sbjct: 61 LLSGPLHALALETVALDT 78


>gi|254421435|ref|ZP_05035153.1| BolA-like protein [Synechococcus sp. PCC 7335]
 gi|196188924|gb|EDX83888.1| BolA-like protein [Synechococcus sp. PCC 7335]
          Length = 81

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          ++P ++E MIK G+P + V + DL G G+HY   ++S+ F G + +++HQ+VY ++   M
Sbjct: 2  ISPDQVEAMIKAGLPDANVAVQDLTGGGDHYQVAVVSDAFEGLSLVKRHQLVYQAVNTAM 61

Query: 63 GN-ALHALSIKTSVP 76
           + A+HALS+ T  P
Sbjct: 62 TSEAIHALSLDTKTP 76


>gi|222480613|ref|YP_002566850.1| BolA family protein [Halorubrum lacusprofundi ATCC 49239]
 gi|222453515|gb|ACM57780.1| BolA family protein [Halorubrum lacusprofundi ATCC 49239]
          Length = 107

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 52/83 (62%), Gaps = 5/83 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTI-----HDLAGDGNHYAAEIISEEFRGKNRIQQHQMVY 55
          M+++P EI  +I+ GIP ++  +     HD   +  H+AA ++S  F G++ + QHQ VY
Sbjct: 1  MTIDPAEIADLIEDGIPDAVARVTTPRVHDDEDEDAHFAAWVVSPAFEGESLVDQHQRVY 60

Query: 56 DSLGNKMGNALHALSIKTSVPDS 78
          D++G+ M  ++HAL IKT  P+ 
Sbjct: 61 DAVGDHMTRSVHALEIKTYTPED 83


>gi|157826272|ref|YP_001493992.1| hypothetical protein A1C_06285 [Rickettsia akari str. Hartford]
 gi|157800230|gb|ABV75484.1| hypothetical protein A1C_06285 [Rickettsia akari str. Hartford]
          Length = 79

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 53/78 (67%), Gaps = 1/78 (1%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+++  E+EK++K+  P SI+ I DL GD +HYA EI   +F G + I QH++V ++L  
Sbjct: 1  MAISAKELEKILKEAFPNSIIKITDLVGDQDHYAVEISDVQFNGLSLINQHKLVKNALSE 60

Query: 61 KMGNALHALSIKT-SVPD 77
           +   LHA++IKT +VP+
Sbjct: 61 ILNKKLHAITIKTIAVPE 78


>gi|83952319|ref|ZP_00961051.1| BolA-like protein [Roseovarius nubinhibens ISM]
 gi|83837325|gb|EAP76622.1| BolA-like protein [Roseovarius nubinhibens ISM]
          Length = 92

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 51/80 (63%), Gaps = 5/80 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M++   +IE +I++  P + +++     DG H+AAE+I E FRGKNR+QQ + VY +L  
Sbjct: 15 MAILASDIEALIRESFPNARISVQ--GDDGAHFAAEVIDESFRGKNRVQQQRAVYAALKG 72

Query: 61 KMGNA---LHALSIKTSVPD 77
          KM  +   LHAL++ T  PD
Sbjct: 73 KMDGSNGELHALALTTKAPD 92


>gi|42520358|ref|NP_966273.1| hypothetical protein WD0490 [Wolbachia endosymbiont of Drosophila
          melanogaster]
 gi|225677408|ref|ZP_03788375.1| hypothetical protein WUni_009270 [Wolbachia endosymbiont of
          Muscidifurax uniraptor]
 gi|42410096|gb|AAS14207.1| conserved hypothetical protein [Wolbachia endosymbiont of
          Drosophila melanogaster]
 gi|225590552|gb|EEH11812.1| hypothetical protein WUni_009270 [Wolbachia endosymbiont of
          Muscidifurax uniraptor]
          Length = 72

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 53/75 (70%), Gaps = 3/75 (4%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M++  HE+E++IK+  P + + IHDLAGD +HY  +I S+ F GK +I+QH+MVY +L  
Sbjct: 1  MTIAIHELERIIKQSFPDADIKIHDLAGDDDHYHLKINSKCFLGKTKIEQHKMVYKALE- 59

Query: 61 KMGNALHALSIKTSV 75
            G ++HAL ++T+ 
Sbjct: 60 --GQSIHALQLETNT 72


>gi|312795849|ref|YP_004028771.1| BolA protein [Burkholderia rhizoxinica HKI 454]
 gi|312167624|emb|CBW74627.1| BolA protein [Burkholderia rhizoxinica HKI 454]
          Length = 79

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (61%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P +++  I+ G+P   V   D+ GDG H+ A I+S  F GK RI +HQ+VY +LG 
Sbjct: 1  MLPTPEQVKGYIEAGLPCERV---DIEGDGQHFFATIVSSAFEGKQRIARHQLVYAALGE 57

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS+KT  P
Sbjct: 58 RMREEIHALSMKTLTP 73


>gi|163731392|ref|ZP_02138839.1| BolA family protein, putative [Roseobacter litoralis Och 149]
 gi|161394846|gb|EDQ19168.1| BolA family protein, putative [Roseobacter litoralis Och 149]
          Length = 118

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 49/80 (61%), Gaps = 5/80 (6%)

Query: 1   MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
           M M  HEIE+++++  P + + +     DG H AA ++ E FRGKNR+QQ + VY +L  
Sbjct: 41  MPMQAHEIEELLRQSFPDATIQVD--GDDGVHMAAMVVDESFRGKNRVQQQRAVYAALKG 98

Query: 61  KMGNA---LHALSIKTSVPD 77
           KM  +   LHAL++ T  PD
Sbjct: 99  KMDGSQGELHALALTTKAPD 118


>gi|307151978|ref|YP_003887362.1| BolA family protein [Cyanothece sp. PCC 7822]
 gi|306982206|gb|ADN14087.1| BolA family protein [Cyanothece sp. PCC 7822]
          Length = 86

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 50/73 (68%), Gaps = 1/73 (1%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-A 65
          ++E MI+  +P + V + DL G G+H  A ++S EF GK ++ QHQMVY ++ + M + +
Sbjct: 6  QVETMIQAKLPDAQVFVKDLTGGGDHLEATVVSSEFEGKTKVIQHQMVYGAVASAMADES 65

Query: 66 LHALSIKTSVPDS 78
          +HAL++KT  P++
Sbjct: 66 IHALALKTYTPET 78


>gi|91204834|ref|YP_537189.1| BolA-like protein [Rickettsia bellii RML369-C]
 gi|157826403|ref|YP_001495467.1| BolA-like protein [Rickettsia bellii OSU 85-389]
 gi|91068378|gb|ABE04100.1| BolA-like protein [Rickettsia bellii RML369-C]
 gi|157801707|gb|ABV78430.1| BolA-like protein [Rickettsia bellii OSU 85-389]
          Length = 76

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 49/75 (65%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+++  E+EK++KK  P  ++ I DL GD +HYA E+   +FRG   I QH++V ++L  
Sbjct: 1  MAISVEELEKILKKSFPNGVIKITDLVGDQDHYALELSDIQFRGLTLINQHKLVKNALSE 60

Query: 61 KMGNALHALSIKTSV 75
           +   LHA++IKT V
Sbjct: 61 VLNKKLHAITIKTIV 75


>gi|325919988|ref|ZP_08181970.1| transcriptional regulator, BolA protein family [Xanthomonas
          gardneri ATCC 19865]
 gi|325549531|gb|EGD20403.1| transcriptional regulator, BolA protein family [Xanthomonas
          gardneri ATCC 19865]
          Length = 80

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 48/75 (64%), Gaps = 2/75 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          ++   I K+I+ G+P++ V +H    DG H+ A +IS  F GK  + +H+MVY +LG  M
Sbjct: 6  LDAETIRKLIESGLPEARVDVH--GDDGVHFEATVISPAFAGKAPLARHRMVYATLGELM 63

Query: 63 GNALHALSIKTSVPD 77
          G A+HAL +KT  PD
Sbjct: 64 GGAIHALQLKTLTPD 78


>gi|51473981|ref|YP_067738.1| hypothetical protein RT0800 [Rickettsia typhi str. Wilmington]
 gi|51460293|gb|AAU04256.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 83

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 53/77 (68%), Gaps = 1/77 (1%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+++  E+EK++KK  P S++ I DL GD +HYA EI  ++F G + I QH++V +++  
Sbjct: 1  MAISAEELEKILKKSFPSSVIKITDLVGDQDHYALEISDDQFNGLSLINQHKLVKNAISE 60

Query: 61 KMGNALHALSIKT-SVP 76
           +   LH++SIKT ++P
Sbjct: 61 ILNKKLHSISIKTIAIP 77


>gi|239946790|ref|ZP_04698543.1| conserved domain protein [Rickettsia endosymbiont of Ixodes
          scapularis]
 gi|239921066|gb|EER21090.1| conserved domain protein [Rickettsia endosymbiont of Ixodes
          scapularis]
          Length = 79

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 53/78 (67%), Gaps = 1/78 (1%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+++  E+EK++K+  P SI+ I DL GD +HYA EI   +F G + I QH++V ++L  
Sbjct: 1  MAISAEELEKILKESFPNSIIKITDLIGDQDHYALEISDVQFNGLSLINQHKLVKNALSE 60

Query: 61 KMGNALHALSIKT-SVPD 77
           +   LHA++IKT +VP+
Sbjct: 61 ILNTKLHAITIKTIAVPE 78


>gi|33240536|ref|NP_875478.1| BolA-like protein [Prochlorococcus marinus subsp. marinus str.
          CCMP1375]
 gi|33238064|gb|AAQ00131.1| BolA-like protein [Prochlorococcus marinus subsp. marinus str.
          CCMP1375]
          Length = 76

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 52/75 (69%), Gaps = 1/75 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          ++P E++ +IK  +P ++V + D+ G G+H    ++S  F G +R+QQHQ++Y +L  ++
Sbjct: 2  VHPEEVKALIKSSLPDAMVNVEDINGGGDHLNVNVVSSTFAGLSRVQQHQLIYRALAKEL 61

Query: 63 GN-ALHALSIKTSVP 76
           + ++HAL++KTS P
Sbjct: 62 ASESIHALALKTSTP 76


>gi|71274802|ref|ZP_00651090.1| BolA-like protein [Xylella fastidiosa Dixon]
 gi|71900944|ref|ZP_00683058.1| BolA-like protein [Xylella fastidiosa Ann-1]
 gi|170729950|ref|YP_001775383.1| hypothetical protein Xfasm12_0762 [Xylella fastidiosa M12]
 gi|71164534|gb|EAO14248.1| BolA-like protein [Xylella fastidiosa Dixon]
 gi|71729303|gb|EAO31420.1| BolA-like protein [Xylella fastidiosa Ann-1]
 gi|167964743|gb|ACA11753.1| conserved hypothetical protein [Xylella fastidiosa M12]
          Length = 75

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 48/77 (62%), Gaps = 2/77 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+   I K+I+ G+ Q+   +     DG H+ A +I E FRGK  + +H+MVY S+G+ M
Sbjct: 1  MDAETIRKLIESGLSQARADVR--GEDGVHFEATVICEAFRGKGPLARHRMVYASIGDLM 58

Query: 63 GNALHALSIKTSVPDSQ 79
          G A+HAL +KT  PD +
Sbjct: 59 GGAVHALQLKTLTPDEE 75


>gi|159903618|ref|YP_001550962.1| BolA-like protein [Prochlorococcus marinus str. MIT 9211]
 gi|159888794|gb|ABX09008.1| BolA-like protein [Prochlorococcus marinus str. MIT 9211]
          Length = 77

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 52/76 (68%), Gaps = 1/76 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P ++   IKK +P + VT+ DL+G G+H+   +IS  F G + I+QHQ+VY +L  ++
Sbjct: 2  LKPAQVVASIKKALPDAEVTVEDLSGGGDHFQVNVISTSFMGLSLIKQHQLVYGALQKEL 61

Query: 63 GN-ALHALSIKTSVPD 77
           + A+HAL++ TS+P+
Sbjct: 62 ASEAIHALALNTSIPN 77


>gi|254462111|ref|ZP_05075527.1| BolA family protein [Rhodobacterales bacterium HTCC2083]
 gi|206678700|gb|EDZ43187.1| BolA family protein [Rhodobacteraceae bacterium HTCC2083]
          Length = 78

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 48/79 (60%), Gaps = 5/79 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M++   EIE ++K   P+  VT+     DG H+AAE+I   F+GKNR+QQ + VY +L  
Sbjct: 1  MAITAQEIETLLKDAFPEGQVTVQ--GDDGQHFAAEVIDASFKGKNRVQQQRSVYAALKG 58

Query: 61 KMGNA---LHALSIKTSVP 76
          KM  +   LHAL++ T  P
Sbjct: 59 KMDGSNGELHALALTTKAP 77


>gi|315500057|ref|YP_004088860.1| bola family protein [Asticcacaulis excentricus CB 48]
 gi|315418069|gb|ADU14709.1| BolA family protein [Asticcacaulis excentricus CB 48]
          Length = 76

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (60%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M +   ++E  +K   P + + + DLAGDG+HY A I    F G  R++QHQ VY +L +
Sbjct: 1  MPIAQSDLEARLKAAFPDAEIVVEDLAGDGDHYKAYITDAGFAGMPRVRQHQKVYAALSD 60

Query: 61 KMGNALHALSIKTSVP 76
           M   LHAL+++T +P
Sbjct: 61 LMSGPLHALALETRIP 76


>gi|126659871|ref|ZP_01730996.1| hypothetical protein CY0110_08426 [Cyanothece sp. CCY0110]
 gi|126618834|gb|EAZ89578.1| hypothetical protein CY0110_08426 [Cyanothece sp. CCY0110]
          Length = 84

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 48/73 (65%), Gaps = 1/73 (1%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNA 65
          ++E MIK  +P + V + DL G G+H  A ++S EF GK  I+QHQ+VY +L + M   A
Sbjct: 6  QVEDMIKAQLPDAQVVVRDLTGGGDHLEAIVVSAEFEGKTMIKQHQIVYGALQDAMDSEA 65

Query: 66 LHALSIKTSVPDS 78
          +HAL++KT  P +
Sbjct: 66 IHALALKTYTPQA 78


>gi|67924896|ref|ZP_00518289.1| BolA-like protein [Crocosphaera watsonii WH 8501]
 gi|67853263|gb|EAM48629.1| BolA-like protein [Crocosphaera watsonii WH 8501]
          Length = 83

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 48/73 (65%), Gaps = 1/73 (1%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NA 65
          ++E MIK  +P + V + DL G G+H  A ++S EF GK  ++QHQ+VY ++ + M  N 
Sbjct: 6  QVEDMIKAQLPDAQVVVRDLTGGGDHLEAIVVSAEFEGKTMVKQHQLVYGAVQDAMASNV 65

Query: 66 LHALSIKTSVPDS 78
          +HAL++KT  P +
Sbjct: 66 IHALALKTYTPQA 78


>gi|171462924|ref|YP_001797037.1| BolA family protein [Polynucleobacter necessarius subsp.
          necessarius STIR1]
 gi|171192462|gb|ACB43423.1| BolA family protein [Polynucleobacter necessarius subsp.
          necessarius STIR1]
          Length = 79

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 49/77 (63%), Gaps = 3/77 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P +IE  IK+GI  + + +    GDG H+ A I+S EF GK  +Q+HQ+VY ++G+
Sbjct: 1  MLPTPEQIEGYIKQGIQCTHIQVE---GDGQHFFATIVSPEFEGKRLVQRHQLVYGAMGD 57

Query: 61 KMGNALHALSIKTSVPD 77
          +M   +HALSIK   P+
Sbjct: 58 RMKAEVHALSIKAFTPE 74


>gi|157804190|ref|YP_001492739.1| hypothetical protein A1E_05190 [Rickettsia canadensis str.
          McKiel]
 gi|157785453|gb|ABV73954.1| hypothetical protein A1E_05190 [Rickettsia canadensis str.
          McKiel]
          Length = 83

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 51/77 (66%), Gaps = 1/77 (1%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+++  E+EK++K+  P SI+ I DL GD  HYA EI   +F G + I QH++V ++L  
Sbjct: 1  MAISAEELEKILKESFPNSIIKITDLVGDQEHYALEISDVQFNGLSLINQHKLVKNALSE 60

Query: 61 KMGNALHALSIKT-SVP 76
           +   LHA++IKT +VP
Sbjct: 61 ILNKKLHAITIKTITVP 77


>gi|33865441|ref|NP_897000.1| BolA family protein [Synechococcus sp. WH 8102]
 gi|33632610|emb|CAE07422.1| BolA family protein [Synechococcus sp. WH 8102]
          Length = 82

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P  +E  I++ IP + VT+ DL G G+H    ++S  F+G +RI+QHQ+VY +L  ++
Sbjct: 2  VQPDAVEAAIQRSIPDAKVTVEDLTGGGDHLQVSVVSVAFQGLSRIRQHQLVYGALQQEL 61

Query: 63 GN-ALHALSIKTSVP 76
           + A+HAL++ T+ P
Sbjct: 62 ASEAIHALALTTATP 76


>gi|332711056|ref|ZP_08430991.1| transcriptional regulator, BolA protein family [Lyngbya majuscula
          3L]
 gi|332350182|gb|EGJ29787.1| transcriptional regulator, BolA protein family [Lyngbya majuscula
          3L]
          Length = 84

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 54/80 (67%), Gaps = 5/80 (6%)

Query: 3  MNP---HEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          M+P    ++E+ IK+ IP + V + DL G GNH  A ++S EF GK+ ++QHQ+VY +L 
Sbjct: 1  MDPISTQQVEEKIKESIPDAQVKVEDLGG-GNHLQATVVSSEFEGKSLVKQHQLVYGALS 59

Query: 60 NKMGN-ALHALSIKTSVPDS 78
           ++   A+HAL++KT  P++
Sbjct: 60 EELATEAIHALALKTYTPEA 79


>gi|300702845|ref|YP_003744446.1| bola family transcriptional regulator [Ralstonia solanacearum
          CFBP2957]
 gi|299070507|emb|CBJ41802.1| putative transcriptional regulator, BolA family [Ralstonia
          solanacearum CFBP2957]
          Length = 78

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 51/76 (67%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P ++++ I+ G+P + +   ++ GDG H+ A I+S +F GK  IQ+HQ+VY +LG+
Sbjct: 1  MLPTPEQVKQYIEAGLPCAHL---EVEGDGQHFFATIVSAQFEGKRLIQRHQLVYAALGD 57

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS+KT  P
Sbjct: 58 RMRAEIHALSMKTLTP 73


>gi|166711217|ref|ZP_02242424.1| hypothetical protein Xoryp_07035 [Xanthomonas oryzae pv.
          oryzicola BLS256]
          Length = 75

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 49/75 (65%), Gaps = 2/75 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+   I K+I+ G+P++ V +H    DG H+ A ++S  F GK  + +H+MVY +LG+ M
Sbjct: 1  MDAETIRKLIESGLPEARVDVH--GDDGVHFEATVVSPAFVGKAPLARHRMVYATLGDLM 58

Query: 63 GNALHALSIKTSVPD 77
          G A+HAL +KT  P+
Sbjct: 59 GGAIHALQLKTLTPE 73


>gi|56750413|ref|YP_171114.1| hypothetical protein syc0404_d [Synechococcus elongatus PCC 6301]
 gi|56685372|dbj|BAD78594.1| hypothetical protein [Synechococcus elongatus PCC 6301]
          Length = 85

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 48/76 (63%), Gaps = 1/76 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P ++E MI   IP + V ++DL G G+H    ++S  F GK+ I+QHQ+VY ++   M
Sbjct: 2  VTPEQVESMICAQIPDAQVMVNDLTGGGDHLQVTVVSSAFAGKSLIKQHQLVYGAVQAAM 61

Query: 63 GN-ALHALSIKTSVPD 77
             A+HAL++KT  PD
Sbjct: 62 STEAIHALALKTYTPD 77


>gi|260434519|ref|ZP_05788489.1| BolA family protein [Synechococcus sp. WH 8109]
 gi|260412393|gb|EEX05689.1| BolA family protein [Synechococcus sp. WH 8109]
          Length = 82

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P  +E  I+  IP + VT+ DL G G+H    ++S  F G +RI+QHQMVY +L  ++
Sbjct: 2  VQPDAVEAAIQHVIPDANVTVEDLTGGGDHLQVTVVSSAFAGLSRIRQHQMVYGALQQEL 61

Query: 63 GN-ALHALSIKTSVP 76
           + A+HAL++ TS+P
Sbjct: 62 ASEAIHALALNTSIP 76


>gi|119897105|ref|YP_932318.1| BolA-like protein [Azoarcus sp. BH72]
 gi|119669518|emb|CAL93431.1| conserved hypothetical BolA-like protein [Azoarcus sp. BH72]
          Length = 85

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 47/74 (63%), Gaps = 2/74 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
           +P+E++++I++G+P   V I     DG H+   ++S  F GK  ++QHQ VY +LG  M
Sbjct: 2  FDPNEVKRLIEQGLPCEFVAIE--GDDGTHFTGIVVSAAFEGKLPVRQHQAVYATLGTLM 59

Query: 63 GNALHALSIKTSVP 76
          GN +HAL ++T  P
Sbjct: 60 GNEIHALQLQTYTP 73


>gi|319786677|ref|YP_004146152.1| BolA family protein [Pseudoxanthomonas suwonensis 11-1]
 gi|317465189|gb|ADV26921.1| BolA family protein [Pseudoxanthomonas suwonensis 11-1]
          Length = 76

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 49/75 (65%), Gaps = 2/75 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+   I ++I++G+P S    H    DG H+ A ++ E FRGK  + +H+MVY +LG+ M
Sbjct: 1  MDADTIARLIEQGLPGS--KAHVQGDDGVHFEALVVCEAFRGKLPLARHRMVYATLGDLM 58

Query: 63 GNALHALSIKTSVPD 77
          G A+HAL+++T  PD
Sbjct: 59 GGAIHALALRTVTPD 73


>gi|81299955|ref|YP_400163.1| hypothetical protein Synpcc7942_1146 [Synechococcus elongatus PCC
          7942]
 gi|81168836|gb|ABB57176.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
          Length = 88

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 48/76 (63%), Gaps = 1/76 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P ++E MI   IP + V ++DL G G+H    ++S  F GK+ I+QHQ+VY ++   M
Sbjct: 5  VTPEQVESMICAQIPDAQVMVNDLTGGGDHLQVTVVSSAFAGKSLIKQHQLVYGAVQAAM 64

Query: 63 GN-ALHALSIKTSVPD 77
             A+HAL++KT  PD
Sbjct: 65 STEAIHALALKTYTPD 80


>gi|58698880|ref|ZP_00373748.1| BolA protein [Wolbachia endosymbiont of Drosophila ananassae]
 gi|225630079|ref|YP_002726870.1| hypothetical protein WRi_002560 [Wolbachia sp. wRi]
 gi|58534603|gb|EAL58734.1| BolA protein [Wolbachia endosymbiont of Drosophila ananassae]
 gi|225592060|gb|ACN95079.1| hypothetical protein WRi_002560 [Wolbachia sp. wRi]
          Length = 72

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 52/75 (69%), Gaps = 3/75 (4%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M +  HE+E+++K+  P + + IHDLAGD +HY  +I S+ F GK +I+QH+MVY +L  
Sbjct: 1  MVIAIHELERIVKQSFPDADIKIHDLAGDDDHYHLKINSKCFLGKTKIEQHKMVYKALE- 59

Query: 61 KMGNALHALSIKTSV 75
            G ++HAL ++T+ 
Sbjct: 60 --GQSIHALQLETNT 72


>gi|218248131|ref|YP_002373502.1| BolA family protein [Cyanothece sp. PCC 8801]
 gi|257060539|ref|YP_003138427.1| BolA family protein [Cyanothece sp. PCC 8802]
 gi|218168609|gb|ACK67346.1| BolA family protein [Cyanothece sp. PCC 8801]
 gi|256590705|gb|ACV01592.1| BolA family protein [Cyanothece sp. PCC 8802]
          Length = 85

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   ++E MIK+ +P + V + D+ G G+H  A ++S EF GK R++QHQ+VY ++   +
Sbjct: 1  MGLEQVEAMIKRQLPDAQVVVRDMKGGGDHLEAIVVSAEFEGKTRVKQHQLVYSAIQESL 60

Query: 63 -GNALHALSIKTSVP 76
              +HAL++KT  P
Sbjct: 61 DSGVIHALALKTYTP 75


>gi|121632061|ref|YP_001001422.1| hypothetical protein XOO4752 [Xanthomonas oryzae pv. oryzae
          KACC10331]
 gi|188578108|ref|YP_001915037.1| BolA superfamily transcriptional regulator [Xanthomonas oryzae
          pv. oryzae PXO99A]
 gi|116246974|gb|ABJ89900.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
          KACC10331]
 gi|188522560|gb|ACD60505.1| BolA superfamily transcriptional regulator [Xanthomonas oryzae
          pv. oryzae PXO99A]
          Length = 75

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 48/75 (64%), Gaps = 2/75 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+   I K+I+ G+P++ V +H    DG H+ A ++S  F GK  + +H+MVY +LG  M
Sbjct: 1  MDAETIRKLIESGVPEARVDVH--GDDGVHFEATVVSPAFVGKAPLARHRMVYATLGELM 58

Query: 63 GNALHALSIKTSVPD 77
          G A+HAL +KT  P+
Sbjct: 59 GGAIHALQLKTLTPE 73


>gi|17547673|ref|NP_521075.1| hypothetical protein RSc2954 [Ralstonia solanacearum GMI1000]
 gi|17429977|emb|CAD16661.1| probable transcription regulator protein [Ralstonia solanacearum
          GMI1000]
          Length = 78

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 50/76 (65%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P +I++ I+ G+P   +   ++ GDG H+ A I+S +F GK  IQ+HQ+VY +LG+
Sbjct: 1  MLPTPEQIKQYIEAGLPCEHL---EVEGDGQHFFATIVSAQFEGKRLIQRHQLVYAALGD 57

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS+KT  P
Sbjct: 58 RMRAEIHALSMKTLTP 73


>gi|82703855|ref|YP_413421.1| BolA-like protein [Nitrosospira multiformis ATCC 25196]
 gi|82411920|gb|ABB76029.1| transcriptional regulator, BolA protein family [Nitrosospira
          multiformis ATCC 25196]
          Length = 83

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 42/59 (71%)

Query: 19 SIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          S   +H    DG H++A I+S EFRGKN +QQHQ+VY +LG++M   +HALS+KT  P+
Sbjct: 16 SCELVHVEGDDGYHFSALIVSPEFRGKNMVQQHQLVYRALGDRMKQEIHALSMKTMTPE 74


>gi|88808743|ref|ZP_01124253.1| BolA family protein [Synechococcus sp. WH 7805]
 gi|88787731|gb|EAR18888.1| BolA family protein [Synechococcus sp. WH 7805]
          Length = 77

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 48/76 (63%), Gaps = 1/76 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P  +   I+  +P + V++ DL G G+H    ++SE F G NRI+QHQ+VY +L  ++
Sbjct: 2  VQPDAVGAAIRSALPDAKVSVEDLTGGGDHLQVSVVSEAFEGLNRIRQHQLVYKALKEEL 61

Query: 63 -GNALHALSIKTSVPD 77
             A+HAL++ TS P+
Sbjct: 62 KSEAIHALALNTSTPE 77


>gi|289664527|ref|ZP_06486108.1| BolA superfamily transcriptional regulator [Xanthomonas
          campestris pv. vasculorum NCPPB702]
 gi|289667908|ref|ZP_06488983.1| BolA superfamily transcriptional regulator [Xanthomonas
          campestris pv. musacearum NCPPB4381]
          Length = 75

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 48/75 (64%), Gaps = 2/75 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+   I K+I+ G+P++ V +H    DG H+ A ++S  F GK  + +H+MVY +LG  M
Sbjct: 1  MDAETIRKLIESGLPEARVDVH--GDDGVHFEATVVSPAFVGKAPLARHRMVYATLGGLM 58

Query: 63 GNALHALSIKTSVPD 77
          G A+HAL +KT  P+
Sbjct: 59 GGAIHALQLKTLTPE 73


>gi|85705364|ref|ZP_01036463.1| BolA-like protein [Roseovarius sp. 217]
 gi|85670237|gb|EAQ25099.1| BolA-like protein [Roseovarius sp. 217]
          Length = 78

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 51/80 (63%), Gaps = 5/80 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M   ++E +I++ +P + +T+     DG H+AAE+I E FRG NR+QQ + VY ++  
Sbjct: 1  MAMLASDLEALIRQALPNAKITVD--GEDGVHFAAEVIDESFRGMNRVQQQRAVYAAIKG 58

Query: 61 KM---GNALHALSIKTSVPD 77
          KM     A+HAL++ T  PD
Sbjct: 59 KMDGPNGAVHALALTTKAPD 78


>gi|292490491|ref|YP_003525930.1| BolA family protein [Nitrosococcus halophilus Nc4]
 gi|291579086|gb|ADE13543.1| BolA family protein [Nitrosococcus halophilus Nc4]
          Length = 75

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 53/74 (71%), Gaps = 2/74 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+  EI+ MI+ G+P++ V +H  + DG+H+ A ++ E F+ K+ +++H+MVY++LG+  
Sbjct: 1  MDASEIKHMIEAGLPEAEVAVH--SEDGHHFEALVVYEGFKDKSLLERHRMVYETLGDSF 58

Query: 63 GNALHALSIKTSVP 76
           + LHAL+I+T  P
Sbjct: 59 KSTLHALAIRTRAP 72


>gi|149204009|ref|ZP_01880977.1| BolA-like protein [Roseovarius sp. TM1035]
 gi|149142451|gb|EDM30496.1| BolA-like protein [Roseovarius sp. TM1035]
          Length = 78

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 50/79 (63%), Gaps = 5/79 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+M   ++E +I++ +P + +T+     DG H+AAE+I E FRG NR+QQ + VY +L  
Sbjct: 1  MAMLASDLEALIRQALPNAKITVE--GDDGVHFAAEVIDESFRGMNRVQQQRAVYAALKG 58

Query: 61 KM---GNALHALSIKTSVP 76
          KM     A+HAL++ T  P
Sbjct: 59 KMDGPNGAVHALALTTKAP 77


>gi|83748213|ref|ZP_00945240.1| BolA protein [Ralstonia solanacearum UW551]
 gi|207721833|ref|YP_002252271.1| hypothetical protein RSMK02113 [Ralstonia solanacearum MolK2]
 gi|207744511|ref|YP_002260903.1| hypothetical protein RSIPO_02721 [Ralstonia solanacearum IPO1609]
 gi|83725181|gb|EAP72332.1| BolA protein [Ralstonia solanacearum UW551]
 gi|206587000|emb|CAQ17584.1| hypothetical protein RSMK02113 [Ralstonia solanacearum MolK2]
 gi|206595917|emb|CAQ62844.1| hypothetical protein RSIPO_02721 [Ralstonia solanacearum IPO1609]
          Length = 78

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 50/76 (65%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P ++++ I+ G+P   +   ++ GDG H+ A I+S +F GK  IQ+HQ+VY +LG+
Sbjct: 1  MLPTPEQVKQYIEAGLPCDHL---EVEGDGQHFFATIVSAQFEGKRLIQRHQLVYAALGD 57

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS+KT  P
Sbjct: 58 RMRAEIHALSMKTLTP 73


>gi|300690225|ref|YP_003751220.1| transcriptional regulator, BolA family [Ralstonia solanacearum
          PSI07]
 gi|299077285|emb|CBJ49911.1| putative transcriptional regulator, BolA family [Ralstonia
          solanacearum PSI07]
          Length = 78

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 50/76 (65%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P ++++ I+ G+P   +   ++ GDG H+ A I+S +F GK  IQ+HQ+VY +LG+
Sbjct: 1  MLPTPEQVKQYIEAGLPCEHL---EVEGDGQHFFATIVSAQFEGKRLIQRHQLVYAALGD 57

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS+KT  P
Sbjct: 58 RMRAEIHALSMKTLTP 73


>gi|145588293|ref|YP_001154890.1| BolA family protein [Polynucleobacter necessarius subsp.
          asymbioticus QLW-P1DMWA-1]
 gi|145046699|gb|ABP33326.1| transcriptional regulator, BolA protein family [Polynucleobacter
          necessarius subsp. asymbioticus QLW-P1DMWA-1]
          Length = 82

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 49/77 (63%), Gaps = 3/77 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P +I+  IK+GI  + + +    GDG H+ A I+S EF GK  IQ+HQ+VY ++G+
Sbjct: 1  MLPTPEQIKGYIKQGIECTHIQVE---GDGQHFFATIVSPEFEGKRLIQRHQLVYAAMGD 57

Query: 61 KMGNALHALSIKTSVPD 77
          +M   +HALSIK   P+
Sbjct: 58 RMKAEVHALSIKAFTPE 74


>gi|78213185|ref|YP_381964.1| BolA family protein [Synechococcus sp. CC9605]
 gi|78197644|gb|ABB35409.1| BolA family protein [Synechococcus sp. CC9605]
          Length = 82

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P  +E  I++ IP + V++ DL G G+H    ++S  F G +RI+QHQMVY +L  ++
Sbjct: 2  VQPDAVEAAIQQVIPDANVSVEDLTGGGDHLQVTVVSSAFAGLSRIRQHQMVYGALQQEL 61

Query: 63 GN-ALHALSIKTSVP 76
           + A+HAL++ TS P
Sbjct: 62 ASEAIHALALNTSTP 76


>gi|238026002|ref|YP_002910233.1| putative transcriptional regulator, BolA superfamily protein
          [Burkholderia glumae BGR1]
 gi|237875196|gb|ACR27529.1| Predicted transcriptional regulator, BolA superfamily protein
          [Burkholderia glumae BGR1]
          Length = 79

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P ++++ I  G+     T  ++ GDG H+ A I+SE+F GK  IQ+HQ+VY +LG+
Sbjct: 1  MLPTPEQVKQYIAGGL---ACTHLEVEGDGQHFFATIVSEQFEGKRPIQRHQLVYAALGD 57

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS+KT  P
Sbjct: 58 RMKQEIHALSMKTLTP 73


>gi|187930299|ref|YP_001900786.1| BolA family protein [Ralstonia pickettii 12J]
 gi|187727189|gb|ACD28354.1| BolA family protein [Ralstonia pickettii 12J]
          Length = 80

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 49/76 (64%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P ++++ I+ G+P   +   ++ GDG H+ A I+S +F GK  IQ+HQ+VY +LG 
Sbjct: 3  MLPTPEQVKQYIETGLPCEHL---EVEGDGQHFFATIVSAQFEGKRLIQRHQLVYAALGE 59

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS+KT  P
Sbjct: 60 RMRAEIHALSMKTLTP 75


>gi|241664467|ref|YP_002982827.1| BolA family protein [Ralstonia pickettii 12D]
 gi|309782899|ref|ZP_07677619.1| undecaprenyl-phosphate galactosephosphotransferase [Ralstonia sp.
          5_7_47FAA]
 gi|240866494|gb|ACS64155.1| BolA family protein [Ralstonia pickettii 12D]
 gi|308918323|gb|EFP64000.1| undecaprenyl-phosphate galactosephosphotransferase [Ralstonia sp.
          5_7_47FAA]
          Length = 78

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 49/76 (64%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P ++++ I+ G+P   +   ++ GDG H+ A I+S +F GK  IQ+HQ+VY +LG 
Sbjct: 1  MLPTPEQVKQYIETGLPCEHL---EVEGDGQHFFATIVSAQFEGKRLIQRHQLVYAALGE 57

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS+KT  P
Sbjct: 58 RMRAEIHALSMKTLTP 73


>gi|299065481|emb|CBJ36650.1| putative transcriptional regulator, BolA family [Ralstonia
          solanacearum CMR15]
          Length = 78

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P +I++ I+ G+P   + I    GDG H+ A I+S +F GK  IQ+HQ+VY  LG+
Sbjct: 1  MLPTPEQIKQYIEAGLPCEHLEIE---GDGQHFFATIVSAQFEGKRLIQRHQLVYAVLGD 57

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS+KT  P
Sbjct: 58 RMRAEIHALSMKTLTP 73


>gi|172036726|ref|YP_001803227.1| putative BolA-like protein [Cyanothece sp. ATCC 51142]
 gi|171698180|gb|ACB51161.1| putative BolA-like protein [Cyanothece sp. ATCC 51142]
          Length = 84

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-A 65
          ++E MIK  +P + V + DL G G+H  A ++S  F GK  I+QHQ+VY +L + M + A
Sbjct: 6  QVEDMIKAQLPDAQVVVRDLTGGGDHLEAIVVSAAFEGKTMIKQHQIVYGALQDAMASEA 65

Query: 66 LHALSIKTSVP 76
          +HAL++KT  P
Sbjct: 66 IHALALKTYTP 76


>gi|221235525|ref|YP_002517962.1| bolA-like transcriptional regulator [Caulobacter crescentus
          NA1000]
 gi|220964698|gb|ACL96054.1| bolA-related transcriptional regulator [Caulobacter crescentus
          NA1000]
          Length = 78

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 47/76 (61%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+   +E  +    P S + + DL GD +H+ A I+S  F+G  R++QHQ+V  +L +
Sbjct: 1  MPMSHAALEARLVAAFPDSEIVLTDLVGDNDHWKARIVSPAFKGLPRVRQHQLVNRALAD 60

Query: 61 KMGNALHALSIKTSVP 76
           +G  LHAL+++T+ P
Sbjct: 61 VLGGTLHALALETAAP 76


>gi|253997975|ref|YP_003050038.1| BolA family protein [Methylovorus sp. SIP3-4]
 gi|313200042|ref|YP_004038700.1| bola family protein [Methylovorus sp. MP688]
 gi|253984654|gb|ACT49511.1| BolA family protein [Methylovorus sp. SIP3-4]
 gi|312439358|gb|ADQ83464.1| BolA family protein [Methylovorus sp. MP688]
          Length = 82

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 49/76 (64%), Gaps = 2/76 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          ++  +++  I +G+    V +  L  DG H+ A I+S  F GKN +QQHQ+VY +LG++M
Sbjct: 2  LSADDVKTYITQGLACDYVQV--LGNDGQHFEAVIVSAAFTGKNMVQQHQLVYQALGDRM 59

Query: 63 GNALHALSIKTSVPDS 78
             +HALS++T  P++
Sbjct: 60 RQEIHALSMRTFTPET 75


>gi|254489697|ref|ZP_05102893.1| BolA-like protein [Methylophaga thiooxidans DMS010]
 gi|224465106|gb|EEF81359.1| BolA-like protein [Methylophaga thiooxydans DMS010]
          Length = 74

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 3/75 (4%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   +I+ MI+ G+P + V +  L  DG H+ A +IS  F GK  +QQH+MV ++LG+K 
Sbjct: 1  MKASDIKHMIEAGMPDAEVEV--LGDDGQHFDARVISPSFAGKTLVQQHKMVKETLGDKF 58

Query: 63 GNA-LHALSIKTSVP 76
           +  LHALS+KTS P
Sbjct: 59 ASGELHALSLKTSAP 73


>gi|254430820|ref|ZP_05044523.1| BolA family protein [Cyanobium sp. PCC 7001]
 gi|197625273|gb|EDY37832.1| BolA family protein [Cyanobium sp. PCC 7001]
          Length = 77

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P +++  I++ +P +++ + DL G G+H    ++S  F G  RI+QHQ+VY +L  ++
Sbjct: 2  VQPDQVKAAIQRAMPDALIDVEDLTGGGDHLQVTVVSSAFAGLTRIRQHQLVYGALRQEL 61

Query: 63 GN-ALHALSIKTSVP 76
           + A+HAL+++TS P
Sbjct: 62 ASEAIHALALQTSTP 76


>gi|56476137|ref|YP_157726.1| BolA-like putative cell cycle protein [Aromatoleum aromaticum
          EbN1]
 gi|56312180|emb|CAI06825.1| BolA-like putative cell cycle protein [Aromatoleum aromaticum
          EbN1]
          Length = 85

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 46/70 (65%), Gaps = 2/70 (2%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          EI+++I++G+P   V I     DG H+   ++S EF GK +++QHQ VY +LG  MGN +
Sbjct: 6  EIKRLIEQGLPCEFVEIQ--GDDGVHFTGIVVSAEFEGKLKVRQHQAVYATLGKLMGNEI 63

Query: 67 HALSIKTSVP 76
          HAL ++T  P
Sbjct: 64 HALQLQTFTP 73


>gi|255262445|ref|ZP_05341787.1| conserved domain protein [Thalassiobium sp. R2A62]
 gi|255104780|gb|EET47454.1| conserved domain protein [Thalassiobium sp. R2A62]
          Length = 78

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (58%), Gaps = 5/80 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M  HEIE++++   P + + +     DG H AA +  E FRGKNR+QQ + VY +L  
Sbjct: 1  MPMQAHEIEELLRATFPDAEIVVQ--GDDGVHMAAMVADESFRGKNRVQQQRAVYAALKG 58

Query: 61 KM---GNALHALSIKTSVPD 77
          KM      LHAL++ T +PD
Sbjct: 59 KMDGPAGELHALALTTKIPD 78


>gi|325916427|ref|ZP_08178699.1| transcriptional regulator, BolA protein family [Xanthomonas
          vesicatoria ATCC 35937]
 gi|325537347|gb|EGD09071.1| transcriptional regulator, BolA protein family [Xanthomonas
          vesicatoria ATCC 35937]
          Length = 80

 Score = 67.4 bits (163), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (65%), Gaps = 2/70 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALH 67
          I K+I+ G+P++ V +H    DG H+ A +IS  F GK  + +H+MVY +LG  MG A+H
Sbjct: 11 IRKLIESGLPEARVDVH--GDDGVHFEATVISPAFAGKAPLARHRMVYATLGELMGGAIH 68

Query: 68 ALSIKTSVPD 77
          AL +KT  P+
Sbjct: 69 ALQLKTLAPE 78


>gi|116073009|ref|ZP_01470271.1| BolA family protein [Synechococcus sp. RS9916]
 gi|116068314|gb|EAU74066.1| BolA family protein [Synechococcus sp. RS9916]
          Length = 77

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 49/76 (64%), Gaps = 1/76 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P  +   I++ +P + V I DL G G+H    ++S  F G +RI+QHQ+VY +L +++
Sbjct: 2  VQPDAVAAAIRQALPDAKVDIEDLTGGGDHLQVTVVSSGFSGLSRIKQHQLVYGALRDQL 61

Query: 63 GN-ALHALSIKTSVPD 77
           + A+HAL++ TS PD
Sbjct: 62 ASEAIHALALNTSTPD 77


>gi|21232227|ref|NP_638144.1| hypothetical protein XCC2796 [Xanthomonas campestris pv.
          campestris str. ATCC 33913]
 gi|66767644|ref|YP_242406.1| hypothetical protein XC_1317 [Xanthomonas campestris pv.
          campestris str. 8004]
 gi|21113986|gb|AAM42068.1| conserved hypothetical protein [Xanthomonas campestris pv.
          campestris str. ATCC 33913]
 gi|66572976|gb|AAY48386.1| conserved hypothetical protein [Xanthomonas campestris pv.
          campestris str. 8004]
          Length = 75

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 2/75 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+   I K+I+ G+P++ V +     DG H+ A ++S  F GK  + +H+MVY +LG  M
Sbjct: 1  MDAETIRKLIESGLPEARVDVQ--GEDGVHFEATVVSPAFVGKAPLARHRMVYATLGELM 58

Query: 63 GNALHALSIKTSVPD 77
          G A+HAL +KT  PD
Sbjct: 59 GGAIHALQLKTLTPD 73


>gi|148239710|ref|YP_001225097.1| BolA-like protein [Synechococcus sp. WH 7803]
 gi|147848249|emb|CAK23800.1| BolA-like protein [Synechococcus sp. WH 7803]
          Length = 77

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P  +   I++ +P + V++ DL G G+H    ++S  F G NRI+QHQ+VY +L +++
Sbjct: 2  VQPDAVGAAIRRALPDAQVSVEDLTGGGDHLQVSVVSSAFNGLNRIRQHQLVYKALKDEL 61

Query: 63 -GNALHALSIKTSVP 76
             A+HAL++ TS P
Sbjct: 62 ESEAIHALALNTSTP 76


>gi|190571586|ref|YP_001975944.1| BolA-like protein [Wolbachia endosymbiont of Culex
          quinquefasciatus Pel]
 gi|213018988|ref|ZP_03334795.1| BolA-like protein [Wolbachia endosymbiont of Culex
          quinquefasciatus JHB]
 gi|190357858|emb|CAQ55315.1| BolA-like protein [Wolbachia endosymbiont of Culex
          quinquefasciatus Pel]
 gi|212995097|gb|EEB55738.1| BolA-like protein [Wolbachia endosymbiont of Culex
          quinquefasciatus JHB]
          Length = 72

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 50/73 (68%), Gaps = 3/73 (4%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M +  HE+EK+IK+  P + + I DLAGD +HY  +I S+ F G+ +I+QH+MVY +L  
Sbjct: 1  MVVAVHELEKIIKQSFPGADIKIKDLAGDDDHYHLKITSQCFSGRTKIEQHRMVYKALE- 59

Query: 61 KMGNALHALSIKT 73
            G ++HAL ++T
Sbjct: 60 --GQSIHALQLET 70


>gi|86605679|ref|YP_474442.1| BolA/YrbA family protein [Synechococcus sp. JA-3-3Ab]
 gi|86554221|gb|ABC99179.1| BolA/YrbA family protein [Synechococcus sp. JA-3-3Ab]
          Length = 89

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 51/75 (68%), Gaps = 1/75 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+P EIE +I+  +P + V + D  GDGNH+ A +++E+F+G   I+QH++V ++L   +
Sbjct: 1  MDPREIEALIQAALPGAKVQVEDTVGDGNHFQAVVVAEQFQGLPLIKQHRLVNEALKPYL 60

Query: 63 GNA-LHALSIKTSVP 76
           +  LHAL+++T  P
Sbjct: 61 QDGRLHALALRTFTP 75


>gi|84622846|ref|YP_450218.1| hypothetical protein XOO_1189 [Xanthomonas oryzae pv. oryzae MAFF
          311018]
 gi|84366786|dbj|BAE67944.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
          MAFF 311018]
          Length = 85

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 46/70 (65%), Gaps = 2/70 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALH 67
          I K+I+ G+P++ V +H    DG H+ A ++S  F GK  + +H+MVY +LG  MG A+H
Sbjct: 16 IRKLIESGVPEARVDVH--GDDGVHFEATVVSPAFVGKAPLARHRMVYATLGELMGGAIH 73

Query: 68 ALSIKTSVPD 77
          AL +KT  P+
Sbjct: 74 ALQLKTLTPE 83


>gi|120609715|ref|YP_969393.1| BolA family protein [Acidovorax citrulli AAC00-1]
 gi|326315810|ref|YP_004233482.1| BolA family protein [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|120588179|gb|ABM31619.1| BolA family protein [Acidovorax citrulli AAC00-1]
 gi|323372646|gb|ADX44915.1| BolA family protein [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 82

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 49/75 (65%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   +++ +I+ G+P   +T   L GDG H+ A I+S EF GK  IQ+HQ VY +LG++M
Sbjct: 1  MTADQLKDLIRAGLPCEHLT---LEGDGRHWYATIVSAEFEGKRAIQRHQRVYATLGSRM 57

Query: 63 -GNALHALSIKTSVP 76
            + +HALS+KT  P
Sbjct: 58 HTDEVHALSMKTFTP 72


>gi|113869366|ref|YP_727855.1| BolA family transcriptional regulator [Ralstonia eutropha H16]
 gi|113528142|emb|CAJ94487.1| predicted transcriptional regulator, BolA superfamily [Ralstonia
          eutropha H16]
          Length = 82

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (60%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P ++   I +G+P   + +    GDG H+ A I+S EF GK  IQ+HQ VY +LG+
Sbjct: 1  MLPTPEQVRDYIAQGLPCEHLQVE---GDGQHFFATIVSAEFEGKRLIQRHQRVYAALGD 57

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS+KT  P
Sbjct: 58 RMRAEIHALSMKTLTP 73


>gi|330815318|ref|YP_004359023.1| BolA-like protein [Burkholderia gladioli BSR3]
 gi|327367711|gb|AEA59067.1| BolA-like protein [Burkholderia gladioli BSR3]
          Length = 79

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P ++++ I  G+     T  ++ GDG H+ A I+S EF GK  IQ+HQ+VY +LG+
Sbjct: 1  MLPTPEQVKQYIAGGL---ACTHLEVEGDGQHFFATIVSAEFEGKRPIQRHQLVYAALGD 57

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS+KT  P
Sbjct: 58 RMKQEIHALSMKTLTP 73


>gi|73542798|ref|YP_297318.1| BolA-like protein [Ralstonia eutropha JMP134]
 gi|72120211|gb|AAZ62474.1| BolA-like protein [Ralstonia eutropha JMP134]
          Length = 82

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (61%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P ++ + I +G+P   + +    GDG H+ A I+S EF GK  IQ+HQ VY +LG+
Sbjct: 1  MLPTPEQVREYIAQGLPCEHLEVE---GDGQHFFATIVSAEFDGKRLIQRHQRVYAALGD 57

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS+KT  P
Sbjct: 58 RMRAEIHALSMKTLTP 73


>gi|78048668|ref|YP_364843.1| transcription regulator BolA [Xanthomonas campestris pv.
          vesicatoria str. 85-10]
 gi|78037098|emb|CAJ24843.1| BolA superfamily transcriptional regulator [Xanthomonas
          campestris pv. vesicatoria str. 85-10]
          Length = 85

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 48/75 (64%), Gaps = 2/75 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          ++   I K+I+ G+P++ V +H    DG H+ A ++S  F GK  + +H+MVY +LG  M
Sbjct: 11 LDAETIRKLIESGLPEARVDVH--GDDGVHFEATVVSPAFVGKPPLARHRMVYATLGELM 68

Query: 63 GNALHALSIKTSVPD 77
          G A+HAL +KT  P+
Sbjct: 69 GGAIHALQLKTLTPE 83


>gi|89071188|ref|ZP_01158379.1| BolA-like protein [Oceanicola granulosus HTCC2516]
 gi|89043284|gb|EAR49510.1| BolA-like protein [Oceanicola granulosus HTCC2516]
          Length = 78

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 49/79 (62%), Gaps = 5/79 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M +  HEIE ++++  P + +++     DG H+AA+++ E FRG NR+QQ + VY +L  
Sbjct: 1  MPITAHEIETLLRESFPDAEISVE--GDDGAHFAAQVVDESFRGLNRVQQQRAVYAALKG 58

Query: 61 KMGNA---LHALSIKTSVP 76
          KM  +   LHAL++ T  P
Sbjct: 59 KMDGSNGELHALALTTRAP 77


>gi|325926071|ref|ZP_08187434.1| transcriptional regulator, BolA protein family [Xanthomonas
          perforans 91-118]
 gi|325543529|gb|EGD14949.1| transcriptional regulator, BolA protein family [Xanthomonas
          perforans 91-118]
          Length = 80

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 48/75 (64%), Gaps = 2/75 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          ++   I K+I+ G+P++ V +H    DG H+ A ++S  F GK  + +H+MVY +LG  M
Sbjct: 6  LDAETIRKLIESGLPEARVDVH--GDDGVHFEATVVSPAFVGKPPLARHRMVYATLGELM 63

Query: 63 GNALHALSIKTSVPD 77
          G A+HAL +KT  P+
Sbjct: 64 GGAIHALQLKTLTPE 78


>gi|296135341|ref|YP_003642583.1| BolA family protein [Thiomonas intermedia K12]
 gi|294339446|emb|CAZ87805.1| putative BolA-like protein [Thiomonas sp. 3As]
 gi|295795463|gb|ADG30253.1| BolA family protein [Thiomonas intermedia K12]
          Length = 83

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 46/73 (63%), Gaps = 3/73 (4%)

Query: 4  NPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG 63
           P ++ + I  G+  S + +    GDG H+ A I+S  F G+NR+Q+HQ+VY +LG +M 
Sbjct: 5  TPQDLHRYIAAGLECSHLHVE---GDGQHFYATIVSAAFEGRNRVQRHQLVYGALGERMR 61

Query: 64 NALHALSIKTSVP 76
            +HALS+KT  P
Sbjct: 62 AEIHALSMKTLTP 74


>gi|194290957|ref|YP_002006864.1| BolA family transcriptional regulator [Cupriavidus taiwanensis
          LMG 19424]
 gi|193224792|emb|CAQ70803.1| putative transcriptional regulator, BolA family [Cupriavidus
          taiwanensis LMG 19424]
          Length = 82

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (60%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P ++   I +G+P   + +    GDG H+ A I+S EF GK  IQ+HQ VY +LG+
Sbjct: 1  MLPTPEQVRDYIAQGLPCEHLQVE---GDGQHFFATIVSNEFEGKRLIQRHQRVYAALGD 57

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS+KT  P
Sbjct: 58 RMRAEIHALSMKTLTP 73


>gi|148242649|ref|YP_001227806.1| BolA-like protein [Synechococcus sp. RCC307]
 gi|147850959|emb|CAK28453.1| BolA-like protein [Synechococcus sp. RCC307]
          Length = 77

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P  +   I++ +P + V + DL G G+H    ++SE FR   R++QHQ+VY +L  ++
Sbjct: 2  VQPDAVAAAIRQALPDAQVQVEDLTGGGDHLQVTVVSEGFRDLTRVKQHQLVYGALSQEL 61

Query: 63 GN-ALHALSIKTSVP 76
           + A+HAL++ TS P
Sbjct: 62 ASEAIHALALSTSCP 76


>gi|157829088|ref|YP_001495330.1| hypothetical protein A1G_06880 [Rickettsia rickettsii str.
          'Sheila Smith']
 gi|165933812|ref|YP_001650601.1| BolA [Rickettsia rickettsii str. Iowa]
 gi|238650854|ref|YP_002916709.1| BolA [Rickettsia peacockii str. Rustic]
 gi|157801569|gb|ABV76822.1| hypothetical protein A1G_06880 [Rickettsia rickettsii str.
          'Sheila Smith']
 gi|165908899|gb|ABY73195.1| BolA [Rickettsia rickettsii str. Iowa]
 gi|238624952|gb|ACR47658.1| BolA [Rickettsia peacockii str. Rustic]
          Length = 79

 Score = 66.6 bits (161), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 52/78 (66%), Gaps = 1/78 (1%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+++  E+EK++K+  P S + I DL GD +HYA EI   +F G + I QH++V ++L  
Sbjct: 1  MAISVEELEKILKESFPNSTMKITDLVGDQDHYALEISDVQFNGLSLINQHKLVKNALSE 60

Query: 61 KMGNALHALSIKT-SVPD 77
           +   LHA++IKT +VP+
Sbjct: 61 ILNKKLHAITIKTIAVPE 78


>gi|84503070|ref|ZP_01001166.1| BolA-like protein [Oceanicola batsensis HTCC2597]
 gi|84388614|gb|EAQ01486.1| BolA-like protein [Oceanicola batsensis HTCC2597]
          Length = 77

 Score = 66.6 bits (161), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 5/79 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M +   +IE +I++  P + + +     DG H+AA +I E FRGKNR+QQ + VY +L  
Sbjct: 1  MPIQAQDIEDLIRESFPDATIEVQ--GDDGQHFAATVIDESFRGKNRVQQQRAVYAALKG 58

Query: 61 KM---GNALHALSIKTSVP 76
          KM      LHAL++ T  P
Sbjct: 59 KMDGPAGELHALALTTRAP 77


>gi|254439549|ref|ZP_05053043.1| BolA-like protein [Octadecabacter antarcticus 307]
 gi|198254995|gb|EDY79309.1| BolA-like protein [Octadecabacter antarcticus 307]
          Length = 78

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 49/80 (61%), Gaps = 5/80 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M ++  EIE +++   P + +T+     DG H+AAE+I   F+GKNR+QQ + VY +L  
Sbjct: 1  MPISAPEIESLLRDAFPDAKITVQ--GDDGAHFAAEVIDASFKGKNRVQQQRAVYGALKG 58

Query: 61 KMGNA---LHALSIKTSVPD 77
          KM  +   LHAL++ T  P+
Sbjct: 59 KMDGSNGDLHALALTTKAPE 78


>gi|114778511|ref|ZP_01453355.1| hypothetical protein SPV1_10194 [Mariprofundus ferrooxydans PV-1]
 gi|114551236|gb|EAU53795.1| hypothetical protein SPV1_10194 [Mariprofundus ferrooxydans PV-1]
          Length = 77

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 1/76 (1%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+  P +I  MI+  +P + V +   +G+ +H+   ++S  F GK R+ QHQMVY +LG 
Sbjct: 1  MTPTPEQIADMIRTHLPDADVEVRLYSGN-DHFEMTVVSSAFIGKTRVAQHQMVYAALGE 59

Query: 61 KMGNALHALSIKTSVP 76
           M  A+HAL++KT+ P
Sbjct: 60 HMKQAIHALALKTAAP 75


>gi|157964960|ref|YP_001499784.1| BolA-like protein [Rickettsia massiliae MTU5]
 gi|157844736|gb|ABV85237.1| BolA-like protein [Rickettsia massiliae MTU5]
          Length = 85

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 52/78 (66%), Gaps = 1/78 (1%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+++  E+EK++K+  P S + I DL GD +HYA EI   +F G + I QH++V ++L  
Sbjct: 7  MAISIEELEKILKESFPNSTMKITDLVGDQDHYALEISDVQFNGLSLINQHKLVKNALSE 66

Query: 61 KMGNALHALSIKT-SVPD 77
           +   LHA++IKT +VP+
Sbjct: 67 ILNKKLHAITIKTIAVPE 84


>gi|83943226|ref|ZP_00955686.1| BolA-like protein [Sulfitobacter sp. EE-36]
 gi|83954361|ref|ZP_00963081.1| BolA-like protein [Sulfitobacter sp. NAS-14.1]
 gi|83841398|gb|EAP80568.1| BolA-like protein [Sulfitobacter sp. NAS-14.1]
 gi|83846234|gb|EAP84111.1| BolA-like protein [Sulfitobacter sp. EE-36]
          Length = 78

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 5/80 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M   EIE ++++  P + +T+     DG H AA II E FRG+NR+QQ + VY +L  
Sbjct: 1  MPMQAREIEDLLRETFPNAKITVE--GNDGVHMAAMIIDESFRGQNRVQQQRAVYAALKG 58

Query: 61 KMGNA---LHALSIKTSVPD 77
          +M  +   LHAL++ T  PD
Sbjct: 59 RMDGSNGDLHALALTTKAPD 78


>gi|186477510|ref|YP_001858980.1| BolA family protein [Burkholderia phymatum STM815]
 gi|184193969|gb|ACC71934.1| BolA family protein [Burkholderia phymatum STM815]
          Length = 79

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 47/76 (61%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P +++  I  G+P   +   ++ GDG H+ A I+S  F GK  IQ+HQ+VY +LG+
Sbjct: 1  MLPTPEQVKNYIAAGLPCEHL---EVEGDGQHFFATIVSTNFEGKRLIQRHQLVYAALGD 57

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS+KT  P
Sbjct: 58 RMREEIHALSMKTLTP 73


>gi|311103415|ref|YP_003976268.1| bolA-like family protein 1 [Achromobacter xylosoxidans A8]
 gi|310758104|gb|ADP13553.1| bolA-like family protein 1 [Achromobacter xylosoxidans A8]
          Length = 81

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 48/76 (63%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P ++ + I  G+P   +   D+ GDG+H+ A I+S  F GK  IQ+HQ+VY +LG+
Sbjct: 1  MLPTPAQVRQYIADGLPCEHL---DVQGDGSHFDAVIVSTAFEGKRLIQRHQLVYAALGD 57

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS++T  P
Sbjct: 58 RMKAEIHALSMRTLTP 73


>gi|91774600|ref|YP_544356.1| BolA-like protein [Methylobacillus flagellatus KT]
 gi|91708587|gb|ABE48515.1| transcriptional regulator, BolA protein family [Methylobacillus
          flagellatus KT]
          Length = 83

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 49/76 (64%), Gaps = 2/76 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          ++   ++  I +G+P   V +  L  DG H+ A I+S  F GKN +QQHQ+VY +LG++M
Sbjct: 2  LSAEALKNYIAQGLPCDHVQV--LGDDGQHFEAVIVSPLFAGKNMVQQHQLVYQALGDRM 59

Query: 63 GNALHALSIKTSVPDS 78
             +HALS++T  P++
Sbjct: 60 KEEIHALSMRTFTPEA 75


>gi|188990760|ref|YP_001902770.1| hypothetical protein xccb100_1364 [Xanthomonas campestris pv.
          campestris str. B100]
 gi|167732520|emb|CAP50714.1| conserved hypothetical protein [Xanthomonas campestris pv.
          campestris]
          Length = 85

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAG-DGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNK 61
          ++   I K+I+ G+P++ V   D+ G DG H+ A ++S  F GK  + +H+MVY +LG  
Sbjct: 11 LDAETIRKLIESGLPEARV---DVQGEDGVHFEATVVSPAFVGKAPLARHRMVYATLGEL 67

Query: 62 MGNALHALSIKTSVPD 77
          MG A+HAL +KT  PD
Sbjct: 68 MGGAIHALQLKTLTPD 83


>gi|62738509|pdb|1XS3|A Chain A, Solution Structure Analysis Of The Xc975 Protein
          Length = 80

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (62%), Gaps = 2/75 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          ++   I K+I+ G+P++ V +     DG H+ A ++S  F GK  + +H+MVY +LG  M
Sbjct: 6  LDAETIRKLIESGLPEARVDVQ--GEDGVHFEATVVSPAFVGKAPLARHRMVYATLGELM 63

Query: 63 GNALHALSIKTSVPD 77
          G A+HAL +KT  PD
Sbjct: 64 GGAIHALQLKTLTPD 78


>gi|332529541|ref|ZP_08405499.1| bola family protein [Hylemonella gracilis ATCC 19624]
 gi|332041061|gb|EGI77429.1| bola family protein [Hylemonella gracilis ATCC 19624]
          Length = 80

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 49/75 (65%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M  H+++ +I+ G+    +T+    GDG H++A I+S EF GK  IQ+HQ VY +LG +M
Sbjct: 1  MQAHDLQALIQAGLRCEHITVE---GDGRHWSAVIVSPEFEGKRLIQRHQRVYATLGQRM 57

Query: 63 -GNALHALSIKTSVP 76
            + +HALS+KT  P
Sbjct: 58 HTDEVHALSMKTYTP 72


>gi|317403196|gb|EFV83718.1| BolA-like protein [Achromobacter xylosoxidans C54]
          Length = 81

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 48/76 (63%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P ++ + I  G+P   +   D+ GDG+H+ A I+S  F GK  IQ+HQ+VY +LG+
Sbjct: 1  MLPTPAQVRQYIADGLPCEHL---DVQGDGSHFDAVIVSAAFEGKRLIQRHQLVYAALGD 57

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS++T  P
Sbjct: 58 RMKAEIHALSMRTLTP 73


>gi|16126742|ref|NP_421306.1| BolA/YrbA family protein [Caulobacter crescentus CB15]
 gi|13424060|gb|AAK24474.1| BolA/YrbA family protein [Caulobacter crescentus CB15]
          Length = 98

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 44/69 (63%)

Query: 8  IEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALH 67
          +E  +    P S + + DL GD +H+ A I+S  F+G  R++QHQ+V  +L + +G  LH
Sbjct: 28 LEARLVAAFPDSEIVLTDLVGDNDHWKARIVSPAFKGLPRVRQHQLVNRALADVLGGTLH 87

Query: 68 ALSIKTSVP 76
          AL+++T+ P
Sbjct: 88 ALALETAAP 96


>gi|163746615|ref|ZP_02153973.1| BolA family protein, putative [Oceanibulbus indolifex HEL-45]
 gi|161380500|gb|EDQ04911.1| BolA family protein, putative [Oceanibulbus indolifex HEL-45]
          Length = 78

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 46/80 (57%), Gaps = 5/80 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M   EIE +I+   P + +T+     DG H AA +I E FRG NR+QQ + VY +L  
Sbjct: 1  MPMQASEIEDLIRASFPDAKITVE--GNDGVHMAAMVIDESFRGMNRVQQQRAVYAALKG 58

Query: 61 KMGNA---LHALSIKTSVPD 77
          KM  +   LHAL++ T  PD
Sbjct: 59 KMDGSNGDLHALALTTRTPD 78


>gi|302877783|ref|YP_003846347.1| BolA family protein [Gallionella capsiferriformans ES-2]
 gi|302580572|gb|ADL54583.1| BolA family protein [Gallionella capsiferriformans ES-2]
          Length = 80

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 47/67 (70%), Gaps = 1/67 (1%)

Query: 12 IKKGIPQSIVTIH-DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALS 70
          I++ I  ++ T H  + GDG H+ A ++S+EF GK+RI + Q+VY +LG++M   +HALS
Sbjct: 7  IQQDIASNMATTHLTVTGDGQHFEAIVVSQEFSGKSRIGRQQLVYKTLGDRMKGEIHALS 66

Query: 71 IKTSVPD 77
          +KT  P+
Sbjct: 67 MKTYTPE 73


>gi|317970353|ref|ZP_07971743.1| BolA family protein [Synechococcus sp. CB0205]
          Length = 77

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 51/75 (68%), Gaps = 1/75 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          ++P +++  I   +P + V + DL G G+H   +++S  F G +RI+QHQ+VY +L +++
Sbjct: 2  VHPDQVKAAIGVALPDACVEVEDLTGGGDHLQVKVVSSAFEGLSRIKQHQLVYGALRSEL 61

Query: 63 GN-ALHALSIKTSVP 76
           + A+HAL+++TS P
Sbjct: 62 ASEAIHALALQTSTP 76


>gi|88607008|ref|YP_504765.1| BolA family protein [Anaplasma phagocytophilum HZ]
 gi|88598071|gb|ABD43541.1| BolA family protein [Anaplasma phagocytophilum HZ]
          Length = 78

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 51/79 (64%), Gaps = 3/79 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+++  ++ +++    P  IV +  LA D +HY+  I+S+ F GK++++QH+MVYD+L  
Sbjct: 1  MAVDLLKLRELLCNSFPDGIVDVTSLADDNDHYSVRIVSKRFAGKSKLEQHRMVYDALS- 59

Query: 61 KMGNALHALSIKTSVPDSQ 79
            G  +HAL I+TSV   Q
Sbjct: 60 --GVVVHALQIQTSVGSKQ 76


>gi|15893177|ref|NP_360891.1| hypothetical protein RC1254 [Rickettsia conorii str. Malish 7]
 gi|34581154|ref|ZP_00142634.1| hypothetical protein [Rickettsia sibirica 246]
 gi|15620389|gb|AAL03792.1| unknown [Rickettsia conorii str. Malish 7]
 gi|28262539|gb|EAA26043.1| unknown [Rickettsia sibirica 246]
          Length = 79

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 51/78 (65%), Gaps = 1/78 (1%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+++  E+EK++K+  P S + I DL GD +HYA EI   +F G + I QH++V + L  
Sbjct: 1  MAISVEELEKILKESFPNSTMKITDLVGDQDHYALEISDVQFNGLSLINQHKLVKNVLSE 60

Query: 61 KMGNALHALSIKT-SVPD 77
           +   LHA++IKT +VP+
Sbjct: 61 ILNKKLHAITIKTIAVPE 78


>gi|241762830|ref|ZP_04760893.1| BolA family protein [Acidovorax delafieldii 2AN]
 gi|241368005|gb|EER62210.1| BolA family protein [Acidovorax delafieldii 2AN]
          Length = 80

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   +++ +I  G+    +T   L GDG H+ A I+S EF GK  IQ+HQ VY +LG K+
Sbjct: 1  MTADQLKDIISAGMACEYIT---LEGDGRHWYATIVSAEFEGKRAIQRHQRVYATLGAKL 57

Query: 63 GN-ALHALSIKTSVP 76
           N  +HALS+KT  P
Sbjct: 58 ANDEVHALSMKTFTP 72


>gi|30250302|ref|NP_842372.1| BolA-like protein [Nitrosomonas europaea ATCC 19718]
 gi|30181097|emb|CAD86289.1| BolA-like protein [Nitrosomonas europaea ATCC 19718]
          Length = 83

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 47/70 (67%), Gaps = 2/70 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALH 67
          IE  IK  +P + + +     DG+H++A I+SE F+GK+ + QHQ+VY +LG +M   +H
Sbjct: 7  IEHSIKATLPCTWIRVE--GDDGHHFSAVIVSESFQGKSIVGQHQLVYQALGERMREEIH 64

Query: 68 ALSIKTSVPD 77
          ALS+KT  P+
Sbjct: 65 ALSMKTYTPE 74


>gi|167740460|ref|ZP_02413234.1| BolA/YrbA family protein [Burkholderia pseudomallei 14]
 gi|167896153|ref|ZP_02483555.1| BolA/YrbA family protein [Burkholderia pseudomallei 7894]
 gi|167912800|ref|ZP_02499891.1| BolA/YrbA family protein [Burkholderia pseudomallei 112]
 gi|167920759|ref|ZP_02507850.1| BolA/YrbA family protein [Burkholderia pseudomallei BCC215]
          Length = 79

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 45/68 (66%), Gaps = 1/68 (1%)

Query: 10 KMIKKGIPQSIVTIH-DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHA 68
          +++K+ I   +   H ++ GDG H+ A I+S  F GK  IQ+HQ+VY +LG++M   +HA
Sbjct: 6  ELVKQYIEAGVACTHLEVEGDGQHFFATIVSSAFEGKRPIQRHQLVYAALGDRMKQEIHA 65

Query: 69 LSIKTSVP 76
          LS+KT  P
Sbjct: 66 LSMKTLTP 73


>gi|319778661|ref|YP_004129574.1| YrbA protein [Taylorella equigenitalis MCE9]
 gi|317108685|gb|ADU91431.1| YrbA protein [Taylorella equigenitalis MCE9]
          Length = 84

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 49/75 (65%), Gaps = 5/75 (6%)

Query: 5  PHE--IEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          PH+  I++ I   IP   +   ++ GDG H+ A I+SE F GK  IQ+HQMVY +LG++M
Sbjct: 4  PHQDQIKEYISNQIPCDYL---EVEGDGAHFFATIVSESFNGKRLIQRHQMVYAALGDRM 60

Query: 63 GNALHALSIKTSVPD 77
           + +HALS+ T  P+
Sbjct: 61 KDEIHALSMTTLTPE 75


>gi|254509768|ref|ZP_05121835.1| BolA family protein [Rhodobacteraceae bacterium KLH11]
 gi|221533479|gb|EEE36467.1| BolA family protein [Rhodobacteraceae bacterium KLH11]
          Length = 78

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 5/80 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+ HEIE ++++  P + + +     DG H +A ++ E FRGKNR+QQ + VY +L  
Sbjct: 1  MPMSAHEIEALLRESFPNAEIQVG--GSDGVHMSAMVVDESFRGKNRVQQQRAVYAALKG 58

Query: 61 KMGNA---LHALSIKTSVPD 77
          KM      LHAL++ T VP+
Sbjct: 59 KMDGPDGDLHALALTTKVPE 78


>gi|300711016|ref|YP_003736830.1| hypothetical protein HacjB3_08275 [Halalkalicoccus jeotgali B3]
 gi|299124699|gb|ADJ15038.1| hypothetical protein HacjB3_08275 [Halalkalicoccus jeotgali B3]
          Length = 82

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 2/77 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAG--DGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+  ++E +I+ GI     T+    G  D +H AA ++S  F GK+ + QHQ+VYD+LG+
Sbjct: 1  MDAEDVEALIEAGIEDCEATVTHPRGTHDEDHLAAVVVSPAFEGKSLVAQHQLVYDALGD 60

Query: 61 KMGNALHALSIKTSVPD 77
           M   +HAL +KT  PD
Sbjct: 61 HMTTDIHALELKTYTPD 77


>gi|94312182|ref|YP_585392.1| BolA-like protein [Cupriavidus metallidurans CH34]
 gi|93356034|gb|ABF10123.1| putative DNA-binding transcriptional regulator (BolA-like
          protein) [Cupriavidus metallidurans CH34]
          Length = 81

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P ++   I +G+P   + +    GDG H+ A I+S EF GK  IQ+HQ VY +LG 
Sbjct: 1  MLPTPEQVRDYIAQGLPCEHLEVD---GDGQHFFATIVSAEFDGKRLIQRHQRVYAALGE 57

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS+KT  P
Sbjct: 58 RMRAEIHALSMKTLTP 73


>gi|239814169|ref|YP_002943079.1| BolA family protein [Variovorax paradoxus S110]
 gi|239800746|gb|ACS17813.1| BolA family protein [Variovorax paradoxus S110]
          Length = 80

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 47/75 (62%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   +++ +I+  +P   +T   L GDG H+ A I+S EF GK  IQ+HQ VY +LG KM
Sbjct: 1  MTAEQLQALIQSHLPCEHIT---LEGDGRHWYATIVSAEFEGKRAIQRHQRVYATLGAKM 57

Query: 63 -GNALHALSIKTSVP 76
            + +HALS+KT  P
Sbjct: 58 HTDEVHALSMKTYTP 72


>gi|254454247|ref|ZP_05067684.1| BolA family protein [Octadecabacter antarcticus 238]
 gi|198268653|gb|EDY92923.1| BolA family protein [Octadecabacter antarcticus 238]
          Length = 78

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 48/80 (60%), Gaps = 5/80 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M +   EIE +++   P + + +     DG+H+AAE+I   F+GKNR+QQ + VY +L  
Sbjct: 1  MPITASEIETLLRDAFPDAQIKVQ--GDDGSHFAAEVIDTSFKGKNRVQQQRAVYGALKG 58

Query: 61 KMGNA---LHALSIKTSVPD 77
          KM  +   LHAL++ T  P+
Sbjct: 59 KMDGSNGDLHALALTTKAPE 78


>gi|152981871|ref|YP_001354981.1| BolA family transcriptional regulator [Janthinobacterium sp.
          Marseille]
 gi|151281948|gb|ABR90358.1| transcriptional regulator, BolA superfamily [Janthinobacterium
          sp. Marseille]
          Length = 78

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 48/74 (64%), Gaps = 3/74 (4%)

Query: 4  NPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG 63
           P  ++  I  G+  S +   +++GDG H+ A I+SE F GK  IQ+HQ+VY +LG++M 
Sbjct: 4  TPELVKSYIAAGLDCSHL---EVSGDGAHFEAVIVSEAFAGKRLIQRHQLVYAALGDRMR 60

Query: 64 NALHALSIKTSVPD 77
            +HALS+KT  P+
Sbjct: 61 EEIHALSMKTLTPE 74


>gi|254198531|ref|ZP_04904952.1| BolA/YrbA family protein [Burkholderia pseudomallei S13]
 gi|254300649|ref|ZP_04968094.1| BolA/YrbA family protein [Burkholderia pseudomallei 406e]
 gi|157810486|gb|EDO87656.1| BolA/YrbA family protein [Burkholderia pseudomallei 406e]
 gi|169655271|gb|EDS87964.1| BolA/YrbA family protein [Burkholderia pseudomallei S13]
          Length = 78

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 45/68 (66%), Gaps = 1/68 (1%)

Query: 10 KMIKKGIPQSIVTIH-DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHA 68
          +++K+ I   +   H ++ GDG H+ A I+S  F GK  IQ+HQ+VY +LG++M   +HA
Sbjct: 5  ELVKQYIEAGLACTHLEVEGDGQHFFATIVSSAFEGKRPIQRHQLVYAALGDRMKQEIHA 64

Query: 69 LSIKTSVP 76
          LS+KT  P
Sbjct: 65 LSMKTLTP 72


>gi|217969325|ref|YP_002354559.1| BolA family protein [Thauera sp. MZ1T]
 gi|217506652|gb|ACK53663.1| BolA family protein [Thauera sp. MZ1T]
          Length = 85

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 46/70 (65%), Gaps = 2/70 (2%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          E++++I++G+P  +V I     DG H+   ++S  F GK +++QHQ VY +LG  MGN +
Sbjct: 6  EVKRLIEQGLPCELVVIE--GEDGVHFRGIVVSAAFEGKMKVRQHQAVYATLGRLMGNEI 63

Query: 67 HALSIKTSVP 76
          HAL ++T  P
Sbjct: 64 HALQLQTFTP 73


>gi|53720749|ref|YP_109735.1| BolA-like protein [Burkholderia pseudomallei K96243]
 gi|53724269|ref|YP_104238.1| BolA/YrbA family protein [Burkholderia mallei ATCC 23344]
 gi|67641597|ref|ZP_00440373.1| conserved domain protein [Burkholderia mallei GB8 horse 4]
 gi|76811887|ref|YP_335060.1| BolA-like protein [Burkholderia pseudomallei 1710b]
 gi|83720499|ref|YP_443500.1| BolA/YrbA family protein-like protein [Burkholderia thailandensis
          E264]
 gi|121598797|ref|YP_994519.1| BolA/YrbA family protein [Burkholderia mallei SAVP1]
 gi|124386412|ref|YP_001027764.1| BolA/YrbA family protein [Burkholderia mallei NCTC 10229]
 gi|126440758|ref|YP_001060673.1| BolA/YrbA family protein [Burkholderia pseudomallei 668]
 gi|126448679|ref|YP_001082289.1| BolA/YrbA family protein [Burkholderia mallei NCTC 10247]
 gi|126451457|ref|YP_001067957.1| BolA/YrbA family protein [Burkholderia pseudomallei 1106a]
 gi|134283217|ref|ZP_01769918.1| BolA/YrbA family protein [Burkholderia pseudomallei 305]
 gi|167001591|ref|ZP_02267385.1| BolA/YrbA family protein [Burkholderia mallei PRL-20]
 gi|167582543|ref|ZP_02375417.1| BolA/YrbA family protein [Burkholderia thailandensis TXDOH]
 gi|167620658|ref|ZP_02389289.1| BolA/YrbA family protein [Burkholderia thailandensis Bt4]
 gi|167721490|ref|ZP_02404726.1| BolA/YrbA family protein [Burkholderia pseudomallei DM98]
 gi|167817673|ref|ZP_02449353.1| BolA/YrbA family protein [Burkholderia pseudomallei 91]
 gi|167826071|ref|ZP_02457542.1| BolA/YrbA family protein [Burkholderia pseudomallei 9]
 gi|167847577|ref|ZP_02473085.1| BolA/YrbA family protein [Burkholderia pseudomallei B7210]
 gi|167904538|ref|ZP_02491743.1| BolA/YrbA family protein [Burkholderia pseudomallei NCTC 13177]
 gi|217424878|ref|ZP_03456375.1| BolA/YrbA family protein [Burkholderia pseudomallei 576]
 gi|226198230|ref|ZP_03793801.1| BolA/YrbA family protein [Burkholderia pseudomallei Pakistan 9]
 gi|237814069|ref|YP_002898520.1| hypothetical protein GBP346_A3854 [Burkholderia pseudomallei
          MSHR346]
 gi|242317753|ref|ZP_04816769.1| BolA/YrbA family protein [Burkholderia pseudomallei 1106b]
 gi|254175168|ref|ZP_04881829.1| BolA/YrbA family protein [Burkholderia mallei ATCC 10399]
 gi|254180413|ref|ZP_04887011.1| BolA/YrbA family protein [Burkholderia pseudomallei 1655]
 gi|254190376|ref|ZP_04896884.1| BolA/YrbA family protein [Burkholderia pseudomallei Pasteur
          52237]
 gi|254201312|ref|ZP_04907676.1| BolA/YrbA family protein [Burkholderia mallei FMH]
 gi|254206654|ref|ZP_04913005.1| BolA/YrbA family protein [Burkholderia mallei JHU]
 gi|254260403|ref|ZP_04951457.1| BolA/YrbA family protein [Burkholderia pseudomallei 1710a]
 gi|254357279|ref|ZP_04973553.1| BolA/YrbA family protein [Burkholderia mallei 2002721280]
 gi|257137715|ref|ZP_05585977.1| hypothetical protein BthaA_00582 [Burkholderia thailandensis
          E264]
 gi|52211163|emb|CAH37152.1| BolA-like protein [Burkholderia pseudomallei K96243]
 gi|52427692|gb|AAU48285.1| BolA/YrbA family protein [Burkholderia mallei ATCC 23344]
 gi|76581340|gb|ABA50815.1| BolA-like protein [Burkholderia pseudomallei 1710b]
 gi|83654324|gb|ABC38387.1| BolA/YrbA family protein-related protein [Burkholderia
          thailandensis E264]
 gi|121227607|gb|ABM50125.1| BolA/YrbA family protein [Burkholderia mallei SAVP1]
 gi|124294432|gb|ABN03701.1| BolA/YrbA family protein [Burkholderia mallei NCTC 10229]
 gi|126220251|gb|ABN83757.1| BolA/YrbA family protein [Burkholderia pseudomallei 668]
 gi|126225099|gb|ABN88639.1| BolA/YrbA family protein [Burkholderia pseudomallei 1106a]
 gi|126241549|gb|ABO04642.1| BolA/YrbA family protein [Burkholderia mallei NCTC 10247]
 gi|134245412|gb|EBA45505.1| BolA/YrbA family protein [Burkholderia pseudomallei 305]
 gi|147747206|gb|EDK54282.1| BolA/YrbA family protein [Burkholderia mallei FMH]
 gi|147752196|gb|EDK59262.1| BolA/YrbA family protein [Burkholderia mallei JHU]
 gi|148026343|gb|EDK84428.1| BolA/YrbA family protein [Burkholderia mallei 2002721280]
 gi|157938052|gb|EDO93722.1| BolA/YrbA family protein [Burkholderia pseudomallei Pasteur
          52237]
 gi|160696213|gb|EDP86183.1| BolA/YrbA family protein [Burkholderia mallei ATCC 10399]
 gi|184210952|gb|EDU07995.1| BolA/YrbA family protein [Burkholderia pseudomallei 1655]
 gi|217392334|gb|EEC32359.1| BolA/YrbA family protein [Burkholderia pseudomallei 576]
 gi|225929750|gb|EEH25766.1| BolA/YrbA family protein [Burkholderia pseudomallei Pakistan 9]
 gi|237506687|gb|ACQ99005.1| conserved domain protein [Burkholderia pseudomallei MSHR346]
 gi|238522550|gb|EEP85994.1| conserved domain protein [Burkholderia mallei GB8 horse 4]
 gi|242140992|gb|EES27394.1| BolA/YrbA family protein [Burkholderia pseudomallei 1106b]
 gi|243062600|gb|EES44786.1| BolA/YrbA family protein [Burkholderia mallei PRL-20]
 gi|254219092|gb|EET08476.1| BolA/YrbA family protein [Burkholderia pseudomallei 1710a]
          Length = 79

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 45/68 (66%), Gaps = 1/68 (1%)

Query: 10 KMIKKGIPQSIVTIH-DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHA 68
          +++K+ I   +   H ++ GDG H+ A I+S  F GK  IQ+HQ+VY +LG++M   +HA
Sbjct: 6  ELVKQYIEAGLACTHLEVEGDGQHFFATIVSSAFEGKRPIQRHQLVYAALGDRMKQEIHA 65

Query: 69 LSIKTSVP 76
          LS+KT  P
Sbjct: 66 LSMKTLTP 73


>gi|21243693|ref|NP_643275.1| hypothetical protein XAC2966 [Xanthomonas axonopodis pv. citri
          str. 306]
 gi|21109274|gb|AAM37811.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
          str. 306]
          Length = 75

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (62%), Gaps = 2/75 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+   I K+I+ G+P++ V +H    DG H+ A ++S  F  K  + +H+MVY +LG  M
Sbjct: 1  MDAETIRKLIESGLPEARVDVH--GDDGVHFEATVVSPAFIDKAPLARHRMVYATLGELM 58

Query: 63 GNALHALSIKTSVPD 77
          G A+HAL +KT  P+
Sbjct: 59 GGAIHALQLKTLTPE 73


>gi|33594622|ref|NP_882266.1| BolA-like protein [Bordetella pertussis Tohama I]
 gi|33598750|ref|NP_886393.1| BolA-like protein [Bordetella parapertussis 12822]
 gi|33603824|ref|NP_891384.1| BolA-like protein [Bordetella bronchiseptica RB50]
 gi|33564698|emb|CAE44021.1| BolA-like protein [Bordetella pertussis Tohama I]
 gi|33574880|emb|CAE39543.1| BolA-like protein [Bordetella parapertussis]
 gi|33577949|emb|CAE35214.1| BolA-like protein [Bordetella bronchiseptica RB50]
 gi|332384033|gb|AEE68880.1| BolA-like protein [Bordetella pertussis CS]
          Length = 83

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 49/78 (62%), Gaps = 5/78 (6%)

Query: 1  MSM--NPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSL 58
          MSM   P ++ + I  G+P   +   D+ GDG+H+ A I+S  F GK  I +HQ+VY +L
Sbjct: 1  MSMLPTPEQVRQYIADGLPCEHL---DVQGDGSHFDAVIVSAAFEGKRLIARHQLVYAAL 57

Query: 59 GNKMGNALHALSIKTSVP 76
          G++M   +HALS++T  P
Sbjct: 58 GDRMKAEIHALSMRTLTP 75


>gi|221213420|ref|ZP_03586395.1| BolA/YrbA family protein [Burkholderia multivorans CGD1]
 gi|221166872|gb|EED99343.1| BolA/YrbA family protein [Burkholderia multivorans CGD1]
          Length = 94

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 47/76 (61%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P ++++ I  G+     T  ++ GDG H+ A I+S  F GK  IQ+HQ+VY +LG+
Sbjct: 16 MLPTPEQVKQYIAGGL---ACTHLEVEGDGQHFFATIVSPAFEGKRPIQRHQLVYAALGD 72

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS+KT  P
Sbjct: 73 RMKQEIHALSMKTLTP 88


>gi|318040189|ref|ZP_07972145.1| BolA family protein [Synechococcus sp. CB0101]
          Length = 78

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 51/77 (66%), Gaps = 1/77 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          ++P ++   I + +P + V + DL G G+H    ++S  F G +R++QHQ+VY +L +++
Sbjct: 2  VHPDQVRAAITQALPDARVEVEDLTGGGDHLQVTVVSTAFDGLSRVKQHQLVYGALRSEL 61

Query: 63 GN-ALHALSIKTSVPDS 78
           + A+HAL+++TS P +
Sbjct: 62 ASEAIHALALQTSTPTA 78


>gi|325983131|ref|YP_004295533.1| BolA family protein [Nitrosomonas sp. AL212]
 gi|325532650|gb|ADZ27371.1| BolA family protein [Nitrosomonas sp. AL212]
          Length = 81

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 44/69 (63%), Gaps = 2/69 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALH 67
          I+  I+  +P   V +     DG H+ A I+S EF GKN +QQHQ+VY SLG+KM   +H
Sbjct: 7  IKTYIESSLPCEHVQVE--GDDGVHFHALIVSPEFNGKNVVQQHQLVYKSLGDKMKQEIH 64

Query: 68 ALSIKTSVP 76
          ALS+KT  P
Sbjct: 65 ALSMKTLTP 73


>gi|167564334|ref|ZP_02357250.1| BolA/YrbA family protein [Burkholderia oklahomensis EO147]
 gi|167571483|ref|ZP_02364357.1| BolA/YrbA family protein [Burkholderia oklahomensis C6786]
 gi|167838129|ref|ZP_02464988.1| BolA/YrbA family protein [Burkholderia thailandensis MSMB43]
          Length = 79

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 45/68 (66%), Gaps = 1/68 (1%)

Query: 10 KMIKKGIPQSIVTIH-DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHA 68
          +++K+ I   +   H ++ GDG H+ A I+S  F GK  IQ+HQ+VY +LG++M   +HA
Sbjct: 6  ELVKQYIEAGLACTHLEVEGDGQHFFATIVSPAFEGKRPIQRHQLVYAALGDRMKQEIHA 65

Query: 69 LSIKTSVP 76
          LS+KT  P
Sbjct: 66 LSMKTLTP 73


>gi|293602874|ref|ZP_06685313.1| undecaprenyl-phosphate galactosephosphotransferase [Achromobacter
          piechaudii ATCC 43553]
 gi|292818668|gb|EFF77710.1| undecaprenyl-phosphate galactosephosphotransferase [Achromobacter
          piechaudii ATCC 43553]
          Length = 81

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 3/77 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P ++ + I  G+    +   D+ GDG+H+ A I+S  F GK  IQ+HQ+VY +LG+
Sbjct: 1  MLPTPAQVRQYIADGLSCEHL---DVQGDGSHFDAVIVSAAFEGKRLIQRHQLVYAALGD 57

Query: 61 KMGNALHALSIKTSVPD 77
          +M   +HALS++T  PD
Sbjct: 58 RMKAEIHALSMRTLTPD 74


>gi|325523474|gb|EGD01794.1| BolA superfamily transcriptional regulator [Burkholderia sp.
          TJI49]
          Length = 79

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 47/76 (61%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P ++++ I  G+     T  ++ GDG H+ A I+S  F GK  IQ+HQ+VY +LG+
Sbjct: 1  MLPTPEQVKQYISGGL---ACTHLEVEGDGQHFFATIVSPAFEGKRPIQRHQLVYAALGD 57

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS+KT  P
Sbjct: 58 RMKQEIHALSMKTLTP 73


>gi|161523505|ref|YP_001578517.1| BolA family protein [Burkholderia multivorans ATCC 17616]
 gi|167587700|ref|ZP_02380088.1| BolA family protein [Burkholderia ubonensis Bu]
 gi|189351722|ref|YP_001947350.1| BolA superfamily transcriptional regulator [Burkholderia
          multivorans ATCC 17616]
 gi|221201643|ref|ZP_03574681.1| BolA/YrbA family protein [Burkholderia multivorans CGD2M]
 gi|221207282|ref|ZP_03580292.1| BolA/YrbA family protein [Burkholderia multivorans CGD2]
 gi|254253454|ref|ZP_04946772.1| hypothetical protein BDAG_02717 [Burkholderia dolosa AUO158]
 gi|124896063|gb|EAY69943.1| hypothetical protein BDAG_02717 [Burkholderia dolosa AUO158]
 gi|160340934|gb|ABX14020.1| BolA family protein [Burkholderia multivorans ATCC 17616]
 gi|189335744|dbj|BAG44814.1| BolA superfamily transcriptional regulator [Burkholderia
          multivorans ATCC 17616]
 gi|221172870|gb|EEE05307.1| BolA/YrbA family protein [Burkholderia multivorans CGD2]
 gi|221178459|gb|EEE10868.1| BolA/YrbA family protein [Burkholderia multivorans CGD2M]
          Length = 79

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 47/76 (61%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P ++++ I  G+     T  ++ GDG H+ A I+S  F GK  IQ+HQ+VY +LG+
Sbjct: 1  MLPTPEQVKQYIAGGL---ACTHLEVEGDGQHFFATIVSPAFEGKRPIQRHQLVYAALGD 57

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS+KT  P
Sbjct: 58 RMKQEIHALSMKTLTP 73


>gi|209523352|ref|ZP_03271907.1| BolA family protein [Arthrospira maxima CS-328]
 gi|209496094|gb|EDZ96394.1| BolA family protein [Arthrospira maxima CS-328]
          Length = 85

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 46/71 (64%), Gaps = 2/71 (2%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-A 65
          ++E MIK  +P ++V + DL G G+H  A ++S  F GK  ++QHQMVY ++   M   A
Sbjct: 6  QVEAMIKSELPDAVVKVEDLGG-GDHLQAVVVSPLFEGKTLVKQHQMVYKAVKQAMATEA 64

Query: 66 LHALSIKTSVP 76
          +HAL++KT  P
Sbjct: 65 IHALALKTYTP 75


>gi|313126175|ref|YP_004036445.1| transcriptional regulator, bola protein family [Halogeometricum
          borinquense DSM 11551]
 gi|312292540|gb|ADQ67000.1| transcriptional regulator, BolA protein family [Halogeometricum
          borinquense DSM 11551]
          Length = 87

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 48/80 (60%), Gaps = 5/80 (6%)

Query: 3  MNPHEIEKMIKKGIPQ-----SIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDS 57
          M   E+E++I+ GI       S+  + D   +  H+AA ++S  F GK+ +QQHQMVYD+
Sbjct: 1  METSEVERLIEDGIEDADASVSLPRVPDEDHEDAHFAAVVVSPAFEGKSLVQQHQMVYDA 60

Query: 58 LGNKMGNALHALSIKTSVPD 77
          LG  M   +HA+ +KT  P+
Sbjct: 61 LGESMTTDIHAMELKTYTPE 80


>gi|78064997|ref|YP_367766.1| BolA-like protein [Burkholderia sp. 383]
 gi|107024229|ref|YP_622556.1| BolA-like protein [Burkholderia cenocepacia AU 1054]
 gi|115350395|ref|YP_772234.1| BolA family protein [Burkholderia ambifaria AMMD]
 gi|116688446|ref|YP_834069.1| BolA family protein [Burkholderia cenocepacia HI2424]
 gi|134294513|ref|YP_001118248.1| BolA family protein [Burkholderia vietnamiensis G4]
 gi|170699515|ref|ZP_02890557.1| BolA family protein [Burkholderia ambifaria IOP40-10]
 gi|170731756|ref|YP_001763703.1| BolA family protein [Burkholderia cenocepacia MC0-3]
 gi|171316479|ref|ZP_02905696.1| BolA family protein [Burkholderia ambifaria MEX-5]
 gi|172059414|ref|YP_001807066.1| BolA family protein [Burkholderia ambifaria MC40-6]
 gi|206558715|ref|YP_002229475.1| BolA-like protein [Burkholderia cenocepacia J2315]
 gi|254246532|ref|ZP_04939853.1| BolA protein [Burkholderia cenocepacia PC184]
 gi|77965742|gb|ABB07122.1| transcriptional regulator, BolA protein family [Burkholderia sp.
          383]
 gi|105894418|gb|ABF77583.1| transcriptional regulator, BolA protein family [Burkholderia
          cenocepacia AU 1054]
 gi|115280383|gb|ABI85900.1| transcriptional regulator, BolA protein family [Burkholderia
          ambifaria AMMD]
 gi|116646535|gb|ABK07176.1| transcriptional regulator, BolA protein family [Burkholderia
          cenocepacia HI2424]
 gi|124871308|gb|EAY63024.1| BolA protein [Burkholderia cenocepacia PC184]
 gi|134137670|gb|ABO53413.1| transcriptional regulator, BolA protein family [Burkholderia
          vietnamiensis G4]
 gi|169814998|gb|ACA89581.1| BolA family protein [Burkholderia cenocepacia MC0-3]
 gi|170135602|gb|EDT03888.1| BolA family protein [Burkholderia ambifaria IOP40-10]
 gi|171098313|gb|EDT43118.1| BolA family protein [Burkholderia ambifaria MEX-5]
 gi|171991931|gb|ACB62850.1| BolA family protein [Burkholderia ambifaria MC40-6]
 gi|198034752|emb|CAR50619.1| BolA-like protein [Burkholderia cenocepacia J2315]
          Length = 79

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 47/76 (61%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P ++++ I  G+     T  ++ GDG H+ A I+S  F GK  IQ+HQ+VY +LG+
Sbjct: 1  MLPTPEQVKQYIAGGL---ACTHLEVEGDGQHFFATIVSAAFEGKRPIQRHQLVYAALGD 57

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS+KT  P
Sbjct: 58 RMKQEIHALSMKTLTP 73


>gi|284928610|ref|YP_003421132.1| BolA family transcriptional repressor [cyanobacterium UCYN-A]
 gi|284809069|gb|ADB94774.1| transcriptional regulator, BolA protein family [cyanobacterium
          UCYN-A]
          Length = 89

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 46/73 (63%), Gaps = 1/73 (1%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNA 65
          ++E MIK  +P + + I DL G G+H+   +IS EF GK  I+QHQ+VY +L + +   +
Sbjct: 6  QVEDMIKTKLPGAQIIIKDLTGGGDHFEVIVISTEFEGKTMIKQHQLVYSTLQDAIVSKS 65

Query: 66 LHALSIKTSVPDS 78
          +H L +KT  P +
Sbjct: 66 IHTLGLKTYTPKT 78


>gi|86610140|ref|YP_478902.1| BolA/YrbA family protein [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558682|gb|ABD03639.1| BolA/YrbA family protein [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 91

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 51/75 (68%), Gaps = 1/75 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+P EIE +++  +P + V + D  GDG+H+ A +++E+F+G   I+QH++V ++L   +
Sbjct: 1  MDPREIEALVRAALPGARVQVEDTVGDGHHFQAIVVAEQFQGLPLIKQHRLVNEALKAYL 60

Query: 63 GNA-LHALSIKTSVP 76
           +  LHAL+++T  P
Sbjct: 61 QDGRLHALALRTFTP 75


>gi|229587175|ref|YP_002845676.1| BolA-like protein [Rickettsia africae ESF-5]
 gi|228022225|gb|ACP53933.1| BolA-like protein [Rickettsia africae ESF-5]
          Length = 79

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 47/73 (64%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+++  E+EK++K+  P S + I DL GD +HYA EI   +F G + I QH++V + L  
Sbjct: 1  MAISVEELEKILKESFPNSTMKITDLVGDQDHYALEISDVQFNGLSLINQHKLVKNVLSE 60

Query: 61 KMGNALHALSIKT 73
           +   LHA++IKT
Sbjct: 61 ILNKKLHAITIKT 73


>gi|121603604|ref|YP_980933.1| BolA family protein [Polaromonas naphthalenivorans CJ2]
 gi|120592573|gb|ABM36012.1| BolA family protein [Polaromonas naphthalenivorans CJ2]
          Length = 81

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 48/75 (64%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   E++ +I  G+P S +   +L+GDG H+ A I+S  F G+  IQ+HQ VY +LG ++
Sbjct: 1  MTSEELQTIIAAGLPCSHL---ELSGDGRHWYATIVSSAFEGQRLIQRHQRVYATLGGRL 57

Query: 63 -GNALHALSIKTSVP 76
            + +HALS+KT  P
Sbjct: 58 QSDEVHALSMKTYTP 72


>gi|284050366|ref|ZP_06380576.1| BolA-like protein [Arthrospira platensis str. Paraca]
 gi|291566195|dbj|BAI88467.1| BolA family protein [Arthrospira platensis NIES-39]
          Length = 85

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 46/71 (64%), Gaps = 2/71 (2%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-A 65
          ++E MIK  +P ++V + DL G G+H  A ++S  F GK  ++QHQMVY ++   M   A
Sbjct: 6  QVEAMIKSELPDAVVKVEDLGG-GDHLQAVVVSPLFEGKTLVKQHQMVYKAVREAMATEA 64

Query: 66 LHALSIKTSVP 76
          +HAL++KT  P
Sbjct: 65 IHALALKTYTP 75


>gi|110668386|ref|YP_658197.1| morphology/transcription regulator BolA family protein
          [Haloquadratum walsbyi DSM 16790]
 gi|109626133|emb|CAJ52587.1| probable BolA-like protein [Haloquadratum walsbyi DSM 16790]
          Length = 89

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 48/80 (60%), Gaps = 5/80 (6%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIH-----DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDS 57
          M+  E+E  I+  IP +  T+      D   + +H+AA I+S  F  K+ ++QH++VYD+
Sbjct: 1  MDSAEVEAQIESEIPDATATVSLPRTPDENHEDSHFAAVIVSPAFENKSLVEQHELVYDA 60

Query: 58 LGNKMGNALHALSIKTSVPD 77
          LG+ M   +HAL +KT  PD
Sbjct: 61 LGDAMTTEIHALEMKTYTPD 80


>gi|33863365|ref|NP_894925.1| BolA-like protein [Prochlorococcus marinus str. MIT 9313]
 gi|33640814|emb|CAE21269.1| BolA-like protein [Prochlorococcus marinus str. MIT 9313]
          Length = 77

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 47/72 (65%), Gaps = 1/72 (1%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-A 65
          E+   I+  +P + VT+ DL G G+H    +IS  F G +RI+QHQ+VY +L +++ +  
Sbjct: 6  EVGAAIRLALPDAQVTVEDLTGGGDHLQVSVISNAFAGLSRIRQHQLVYGALKDQLASEV 65

Query: 66 LHALSIKTSVPD 77
          +HAL++ TS P+
Sbjct: 66 IHALALSTSTPN 77


>gi|319945418|ref|ZP_08019678.1| undecaprenyl-phosphate galactosephosphotransferase [Lautropia
          mirabilis ATCC 51599]
 gi|319741204|gb|EFV93631.1| undecaprenyl-phosphate galactosephosphotransferase [Lautropia
          mirabilis ATCC 51599]
          Length = 81

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%), Gaps = 3/73 (4%)

Query: 4  NPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG 63
          +P  ++  I  GI  S + +    GDG H+ A I+S+ F GK  +Q+HQ+VY  LG++M 
Sbjct: 3  SPEVVQSYIAAGIACSFLQVE---GDGRHFDAIIVSDAFEGKRPVQRHQLVYGVLGDRMK 59

Query: 64 NALHALSIKTSVP 76
            +HALSIK   P
Sbjct: 60 EEIHALSIKALTP 72


>gi|291613711|ref|YP_003523868.1| BolA family protein [Sideroxydans lithotrophicus ES-1]
 gi|291583823|gb|ADE11481.1| BolA family protein [Sideroxydans lithotrophicus ES-1]
          Length = 78

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 50/75 (66%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P  ++  I++G+  + +++    GDG H+ A I+S  F GK  +QQHQ+VY +LG+KM
Sbjct: 2  VTPENVKTYIQQGLDCAHISVE---GDGRHFEAVIVSPAFEGKGMLQQHQLVYRALGDKM 58

Query: 63 GNALHALSIKTSVPD 77
           + +HALS+KT  P+
Sbjct: 59 -DVIHALSMKTFTPE 72


>gi|87124714|ref|ZP_01080562.1| BolA family protein [Synechococcus sp. RS9917]
 gi|86167593|gb|EAQ68852.1| BolA family protein [Synechococcus sp. RS9917]
          Length = 77

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P  +   I+  +P + V + DL G G+H    ++S  F G NR++QHQ+VY +L +++
Sbjct: 2  VQPDAVVAAIRHALPDAQVEVEDLTGGGDHLQVTVVSSGFSGLNRVRQHQLVYKALRDEL 61

Query: 63 GN-ALHALSIKTSVP 76
           + A+HAL++ TS P
Sbjct: 62 ASEAIHALALNTSTP 76


>gi|124022662|ref|YP_001016969.1| BolA-like protein [Prochlorococcus marinus str. MIT 9303]
 gi|123962948|gb|ABM77704.1| BolA-like protein [Prochlorococcus marinus str. MIT 9303]
          Length = 77

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 47/72 (65%), Gaps = 1/72 (1%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-A 65
          E+   I+  +P + VT+ DL G G+H    +IS  F G +RI+QHQ+VY +L +++ +  
Sbjct: 6  EVGAAIRLALPDAQVTVEDLTGGGDHLQVNVISNAFAGLSRIRQHQLVYGALKDQLASEV 65

Query: 66 LHALSIKTSVPD 77
          +HAL++ TS P+
Sbjct: 66 IHALALSTSTPN 77


>gi|329916007|ref|ZP_08276323.1| Cell division protein BolA [Oxalobacteraceae bacterium IMCC9480]
 gi|327544819|gb|EGF30207.1| Cell division protein BolA [Oxalobacteraceae bacterium IMCC9480]
          Length = 80

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 47/77 (61%), Gaps = 3/77 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P  ++  I  G+  S V +    GDG H+ A I+S+ F GK  IQ+HQ+VY +LG+
Sbjct: 1  MFPTPELVKNYIAAGLACSHVEVE---GDGQHFKAVIVSDAFAGKRLIQRHQIVYAALGD 57

Query: 61 KMGNALHALSIKTSVPD 77
          +M   +HALS+KT  P+
Sbjct: 58 RMREEIHALSMKTLTPE 74


>gi|99080958|ref|YP_613112.1| BolA-like protein [Ruegeria sp. TM1040]
 gi|99037238|gb|ABF63850.1| BolA-like protein [Ruegeria sp. TM1040]
          Length = 78

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 47/80 (58%), Gaps = 5/80 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M  HEIE ++++  P + + +     DG H +A +I E FRGKNR+QQ + VY +L  
Sbjct: 1  MPMQAHEIEALLRETFPDAQIQVG--GSDGVHMSAMVIDESFRGKNRVQQQRAVYAALKG 58

Query: 61 KM---GNALHALSIKTSVPD 77
          KM      LHAL++ T  P+
Sbjct: 59 KMDGPSGELHALALTTKAPE 78


>gi|260433853|ref|ZP_05787824.1| conserved domain protein [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417681|gb|EEX10940.1| conserved domain protein [Silicibacter lacuscaerulensis ITI-1157]
          Length = 78

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 48/80 (60%), Gaps = 5/80 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M+ HEIE ++++  P + + +     DG H +A ++ E FRGKNR+QQ + VY +L  
Sbjct: 1  MPMSAHEIETLLREAFPNADIKVG--GNDGVHMSAMVVDESFRGKNRVQQQRAVYAALKG 58

Query: 61 KMGNA---LHALSIKTSVPD 77
          KM      LHAL++ T  P+
Sbjct: 59 KMDGPDGELHALALTTRAPE 78


>gi|254474845|ref|ZP_05088231.1| BolA family protein [Ruegeria sp. R11]
 gi|214029088|gb|EEB69923.1| BolA family protein [Ruegeria sp. R11]
          Length = 78

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 5/80 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M  HEIE+++++  P + + +     DG H +A +I E FRGKNR+QQ + VY +L  
Sbjct: 1  MPMQAHEIEELLRQSFPDAEIQVG--GHDGVHMSAMVIDESFRGKNRVQQQRAVYAALKG 58

Query: 61 KMGNA---LHALSIKTSVPD 77
          KM  +   LHAL++ T  P+
Sbjct: 59 KMDGSNGELHALALTTKAPE 78


>gi|259419275|ref|ZP_05743192.1| conserved domain protein [Silicibacter sp. TrichCH4B]
 gi|259345497|gb|EEW57351.1| conserved domain protein [Silicibacter sp. TrichCH4B]
          Length = 78

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 47/80 (58%), Gaps = 5/80 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M  HEIE ++++  P + + +     DG H +A +I E FRGKNR+QQ + VY +L  
Sbjct: 1  MPMQAHEIEALLRETFPDAQIEVG--GSDGVHMSAMVIDESFRGKNRVQQQRAVYAALKG 58

Query: 61 KM---GNALHALSIKTSVPD 77
          KM      LHAL++ T  P+
Sbjct: 59 KMDGPSGELHALALTTKAPE 78


>gi|254465274|ref|ZP_05078685.1| BolA family protein [Rhodobacterales bacterium Y4I]
 gi|206686182|gb|EDZ46664.1| BolA family protein [Rhodobacterales bacterium Y4I]
          Length = 78

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 47/80 (58%), Gaps = 5/80 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M  HEIE++++   P + + +     DG H +A ++ E FRGKNR+QQ + VY +L  
Sbjct: 1  MPMQAHEIEELLRAAFPDAKIQVG--GTDGVHMSAMVVDESFRGKNRVQQQRAVYAALKG 58

Query: 61 KMGNA---LHALSIKTSVPD 77
          KM      LHAL++ T  P+
Sbjct: 59 KMDGPDGDLHALALTTKAPE 78


>gi|126668360|ref|ZP_01739318.1| BolA-like protein [Marinobacter sp. ELB17]
 gi|126627176|gb|EAZ97815.1| BolA-like protein [Marinobacter sp. ELB17]
          Length = 71

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 40/50 (80%)

Query: 29 DGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDS 78
          DG H+ A I+S++F GKN+IQQHQ+VY +LG++M + +HAL+++T  P +
Sbjct: 15 DGQHFEAVIVSQQFAGKNKIQQHQLVYLALGDRMRSEIHALAMRTFTPQT 64


>gi|134096227|ref|YP_001101302.1| hypothetical protein HEAR3072 [Herminiimonas arsenicoxydans]
 gi|133740130|emb|CAL63181.1| Putative stress-induced morphogen BolA protein [Herminiimonas
          arsenicoxydans]
          Length = 77

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 47/69 (68%), Gaps = 1/69 (1%)

Query: 10 KMIKKGIPQSIVTIH-DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHA 68
          +++K  I   +   H +++GDG H+ A I+S+ F GK  IQ+HQ+VY +LG++M   +HA
Sbjct: 5  ELVKSYIAAGMNCTHLEVSGDGAHFEAVIVSDAFAGKRLIQRHQLVYAALGDRMREEIHA 64

Query: 69 LSIKTSVPD 77
          LS+KT  P+
Sbjct: 65 LSMKTLTPE 73


>gi|254486527|ref|ZP_05099732.1| BolA family protein [Roseobacter sp. GAI101]
 gi|214043396|gb|EEB84034.1| BolA family protein [Roseobacter sp. GAI101]
          Length = 102

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 46/80 (57%), Gaps = 5/80 (6%)

Query: 1   MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
           M M   +IE ++++  P + + +     DG H AA +I E FRGKNR+QQ + VY +L  
Sbjct: 25  MPMQAPDIEALLRETFPNATIEVQ--GNDGVHMAAMVIDESFRGKNRVQQQRAVYAALKG 82

Query: 61  KM---GNALHALSIKTSVPD 77
           KM      LHAL++ T  PD
Sbjct: 83  KMDGPSGELHALALTTKAPD 102


>gi|319791935|ref|YP_004153575.1| bola family protein [Variovorax paradoxus EPS]
 gi|315594398|gb|ADU35464.1| BolA family protein [Variovorax paradoxus EPS]
          Length = 80

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 47/75 (62%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   +++ +I+  +P   ++   L GDG H+ A I+S EF GK  IQ+HQ VY +LG KM
Sbjct: 1  MTAEQLQALIQSHLPCEHIS---LEGDGRHWYATIVSAEFEGKRAIQRHQRVYATLGAKM 57

Query: 63 -GNALHALSIKTSVP 76
            + +HALS+KT  P
Sbjct: 58 HTDEVHALSMKTYTP 72


>gi|170695761|ref|ZP_02886903.1| BolA family protein [Burkholderia graminis C4D1M]
 gi|187925535|ref|YP_001897177.1| BolA family protein [Burkholderia phytofirmans PsJN]
 gi|307731177|ref|YP_003908401.1| BolA family protein [Burkholderia sp. CCGE1003]
 gi|323527523|ref|YP_004229676.1| BolA family protein [Burkholderia sp. CCGE1001]
 gi|170139366|gb|EDT07552.1| BolA family protein [Burkholderia graminis C4D1M]
 gi|187716729|gb|ACD17953.1| BolA family protein [Burkholderia phytofirmans PsJN]
 gi|307585712|gb|ADN59110.1| BolA family protein [Burkholderia sp. CCGE1003]
 gi|323384525|gb|ADX56616.1| BolA family protein [Burkholderia sp. CCGE1001]
          Length = 79

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (61%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P ++++ I  G+    +   ++ GDG H+ A I+S  F GK  IQ+HQ+VY +LG+
Sbjct: 1  MLPTPEQVKQYIAAGLACQHL---EVEGDGQHFFATIVSPSFEGKRLIQRHQLVYAALGD 57

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS+KT  P
Sbjct: 58 RMREEIHALSMKTLTP 73


>gi|332527343|ref|ZP_08403399.1| BolA family transcriptional regulator [Rubrivivax benzoatilyticus
          JA2]
 gi|332111752|gb|EGJ11732.1| BolA family transcriptional regulator [Rubrivivax benzoatilyticus
          JA2]
          Length = 86

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 44/70 (62%), Gaps = 3/70 (4%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          E+   I+ G+P   + +    GDG H+ A I+S  F G NR+++HQ VY +LG++M   +
Sbjct: 8  EVRGYIEAGLPCEHLQVE---GDGRHFFATIVSSAFEGLNRVRRHQRVYAALGDRMREQI 64

Query: 67 HALSIKTSVP 76
          HALS+KT  P
Sbjct: 65 HALSMKTLTP 74


>gi|68171831|ref|ZP_00545167.1| BolA-like protein [Ehrlichia chaffeensis str. Sapulpa]
 gi|88658618|ref|YP_507124.1| BolA family protein [Ehrlichia chaffeensis str. Arkansas]
 gi|67998752|gb|EAM85468.1| BolA-like protein [Ehrlichia chaffeensis str. Sapulpa]
 gi|88600075|gb|ABD45544.1| BolA family protein [Ehrlichia chaffeensis str. Arkansas]
          Length = 73

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 50/73 (68%), Gaps = 3/73 (4%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M++   ++E +I+   P++ +T+  L GD NHY+ ++IS +F+GK++++QH+M+Y  L  
Sbjct: 1  MTVTQSQLELLIRNAFPEAEITVTSLVGDNNHYSIKVISSQFQGKSKLEQHRMIYKVLD- 59

Query: 61 KMGNALHALSIKT 73
            G  +HA+ I+T
Sbjct: 60 --GLNIHAIQIQT 70


>gi|91785384|ref|YP_560590.1| putative morphogene protein, BolA [Burkholderia xenovorans LB400]
 gi|296159543|ref|ZP_06842367.1| BolA family protein [Burkholderia sp. Ch1-1]
 gi|91689338|gb|ABE32538.1| transcriptional regulator, BolA protein family [Burkholderia
          xenovorans LB400]
 gi|295890251|gb|EFG70045.1| BolA family protein [Burkholderia sp. Ch1-1]
          Length = 79

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (61%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P ++++ I  G+    +   ++ GDG H+ A I+S  F GK  IQ+HQ+VY +LG+
Sbjct: 1  MLPTPEQVKQYIAAGLACQHL---EVEGDGQHFFATIVSPSFEGKRPIQRHQLVYAALGD 57

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS+KT  P
Sbjct: 58 RMREEIHALSMKTLTP 73


>gi|297537493|ref|YP_003673262.1| BolA family protein [Methylotenera sp. 301]
 gi|297256840|gb|ADI28685.1| BolA family protein [Methylotenera sp. 301]
          Length = 81

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 48/75 (64%), Gaps = 2/75 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          ++  ++E  I + +    + +  L  DG H+ + I+S  F GK+ +QQHQ+VY +LG++M
Sbjct: 2  LSAQQLEAYITQNLACEYIKV--LGDDGTHFESVIVSSAFVGKSMVQQHQLVYTALGDRM 59

Query: 63 GNALHALSIKTSVPD 77
           + +HALS+KT  P+
Sbjct: 60 RSEIHALSMKTYTPE 74


>gi|57239419|ref|YP_180555.1| hypothetical protein Erum6920 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58579391|ref|YP_197603.1| hypothetical protein ERWE_CDS_07270 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58617446|ref|YP_196645.1| hypothetical protein ERGA_CDS_07190 [Ehrlichia ruminantium str.
          Gardel]
 gi|57161498|emb|CAH58424.1| conserved hypothetical protein [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58417058|emb|CAI28171.1| Conserved hypothetical protein [Ehrlichia ruminantium str.
          Gardel]
 gi|58418017|emb|CAI27221.1| Conserved hypothetical protein [Ehrlichia ruminantium str.
          Welgevonden]
          Length = 73

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 49/73 (67%), Gaps = 3/73 (4%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          MS+   ++E++IK   P++ +T+  L  D NHY+ +++S +F GK++++QH+MVY  L  
Sbjct: 1  MSVTQLQLEQVIKNAFPEADITVTSLVDDNNHYSIKVVSHQFHGKSKLEQHRMVYKVLD- 59

Query: 61 KMGNALHALSIKT 73
            G  +HA+ IKT
Sbjct: 60 --GLNIHAIQIKT 70


>gi|190573144|ref|YP_001970989.1| putative BolA-like protein [Stenotrophomonas maltophilia K279a]
 gi|190011066|emb|CAQ44675.1| putative BolA-like protein [Stenotrophomonas maltophilia K279a]
          Length = 76

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 45/74 (60%), Gaps = 2/74 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+   I  +I+ G+P +   +     DG H+ A ++ E F GK  + +H+MVY +LG+ M
Sbjct: 1  MDADTIRNLIETGLPGARADVQ--GDDGVHFEATVVCEAFAGKMPLARHRMVYATLGDLM 58

Query: 63 GNALHALSIKTSVP 76
          G A+HAL++KT  P
Sbjct: 59 GGAIHALALKTVTP 72


>gi|299688705|pdb|2KZ0|A Chain A, Solution Structure Of A Bola Protein (Ech_0303) From
          Ehrlichia Chaffeensis. Seattle Structural Genomics
          Center For Infectious Disease Target Ehcha.10365.A
          Length = 76

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 50/73 (68%), Gaps = 3/73 (4%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M++   ++E +I+   P++ +T+  L GD NHY+ ++IS +F+GK++++QH+M+Y  L  
Sbjct: 4  MTVTQSQLELLIRNAFPEAEITVTSLVGDNNHYSIKVISSQFQGKSKLEQHRMIYKVLD- 62

Query: 61 KMGNALHALSIKT 73
            G  +HA+ I+T
Sbjct: 63 --GLNIHAIQIQT 73


>gi|209516595|ref|ZP_03265449.1| BolA family protein [Burkholderia sp. H160]
 gi|209503036|gb|EEA03038.1| BolA family protein [Burkholderia sp. H160]
          Length = 79

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (61%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P ++++ I  G+    +   ++ GDG H+ A I+S  F GK  IQ+HQ+VY +LG+
Sbjct: 1  MLPTPEQVKQYIAAGLACEHL---EVEGDGQHFFATIVSPNFEGKRLIQRHQLVYAALGD 57

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS+KT  P
Sbjct: 58 RMREEIHALSMKTLTP 73


>gi|257051292|ref|YP_003129125.1| BolA family protein [Halorhabdus utahensis DSM 12940]
 gi|256690055|gb|ACV10392.1| BolA family protein [Halorhabdus utahensis DSM 12940]
          Length = 79

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTI-HDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNK 61
          M   E+E+ I+  IP +  T+ H    D  H AA ++S  F  K  ++QH+MVYD+L + 
Sbjct: 1  MESAEVERRIEDAIPDATATVTHPRPNDTEHLAATVVSPAFAEKTLVEQHEMVYDALEDA 60

Query: 62 MGNALHALSIKTSVPD 77
          +   +HAL + T  P+
Sbjct: 61 LTTEIHALKVTTRTPE 76


>gi|295677856|ref|YP_003606380.1| BolA family protein [Burkholderia sp. CCGE1002]
 gi|295437699|gb|ADG16869.1| BolA family protein [Burkholderia sp. CCGE1002]
          Length = 79

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (60%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P ++++ I  G+    +   ++ GDG H+ A I+S  F GK  IQ+HQ+VY +LG 
Sbjct: 1  MLPTPEQVKQYIAAGLACEHL---EVEGDGQHFFATIVSPSFEGKRLIQRHQLVYAALGE 57

Query: 61 KMGNALHALSIKTSVP 76
          +M   +HALS+KT  P
Sbjct: 58 RMREEIHALSMKTLTP 73


>gi|126737907|ref|ZP_01753637.1| BolA-like protein [Roseobacter sp. SK209-2-6]
 gi|126721300|gb|EBA18004.1| BolA-like protein [Roseobacter sp. SK209-2-6]
          Length = 78

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 50/81 (61%), Gaps = 7/81 (8%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAG-DGNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          M M   EIE ++++  P++ + +   AG DG H +A ++ E FRGKNRIQQ + VY +L 
Sbjct: 1  MPMQAQEIEDLLRESFPEAEIQV---AGHDGVHMSAMVVDESFRGKNRIQQQRAVYAALK 57

Query: 60 NKMGNA---LHALSIKTSVPD 77
           KM  +   LHAL++ T  P+
Sbjct: 58 GKMDGSNGELHALALTTKAPE 78


>gi|121593181|ref|YP_985077.1| BolA family protein [Acidovorax sp. JS42]
 gi|222109939|ref|YP_002552203.1| bola family protein [Acidovorax ebreus TPSY]
 gi|120605261|gb|ABM41001.1| BolA family protein [Acidovorax sp. JS42]
 gi|221729383|gb|ACM32203.1| BolA family protein [Acidovorax ebreus TPSY]
          Length = 82

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 46/75 (61%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   +++ +I  G+    +T   L GDG H+ A I+S EF GK  IQ+HQ VY +LG +M
Sbjct: 1  MTADQLKDIISAGMACDHIT---LEGDGRHWYATIVSSEFEGKRSIQRHQRVYATLGARM 57

Query: 63 -GNALHALSIKTSVP 76
            + +HALS+KT  P
Sbjct: 58 QSDEVHALSMKTFTP 72


>gi|16329669|ref|NP_440397.1| hypothetical protein ssr3122 [Synechocystis sp. PCC 6803]
 gi|6137287|sp|P73055|Y3122_SYNY3 RecName: Full=Uncharacterized protein ssr3122
 gi|1652153|dbj|BAA17077.1| ssr3122 [Synechocystis sp. PCC 6803]
          Length = 85

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 52/73 (71%), Gaps = 2/73 (2%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-A 65
          ++++ I+  +P + V ++DL G G+H  A ++S  F G++R++QHQMVY +L + + + A
Sbjct: 6  QVKQQIQAALPDAEVMVNDLGG-GDHLEAVVVSSAFTGQSRVKQHQMVYGALKDALASEA 64

Query: 66 LHALSIKTSVPDS 78
          +HAL++KT  P++
Sbjct: 65 IHALALKTFTPEA 77


>gi|113954401|ref|YP_730358.1| BolA family protein [Synechococcus sp. CC9311]
 gi|113881752|gb|ABI46710.1| BolA family protein [Synechococcus sp. CC9311]
          Length = 90

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 45/70 (64%), Gaps = 1/70 (1%)

Query: 8  IEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-AL 66
          +   I++ +P + V++ DL G G+H    ++S +F G  RI+QHQ+VY +L   + + A+
Sbjct: 20 VSSAIRRALPDAQVSVEDLTGGGDHLQVTVVSAKFEGLTRIKQHQLVYGALREDLASEAI 79

Query: 67 HALSIKTSVP 76
          HAL++ TS P
Sbjct: 80 HALALITSTP 89


>gi|254447874|ref|ZP_05061339.1| BolA-like protein [gamma proteobacterium HTCC5015]
 gi|198262654|gb|EDY86934.1| BolA-like protein [gamma proteobacterium HTCC5015]
          Length = 80

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 48/73 (65%), Gaps = 4/73 (5%)

Query: 6  HEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GN 64
           E + ++++ +P + +T++   GDG  Y A ++SEEF G N +Q+H+ VY +LG  + G 
Sbjct: 8  EEAKALLEQALPNAEITVN---GDGYKYEAIVVSEEFEGMNTLQRHKTVYAALGELITGG 64

Query: 65 ALHALSIKTSVPD 77
          ALHALSIK   P+
Sbjct: 65 ALHALSIKAKTPE 77


>gi|254524975|ref|ZP_05137030.1| BolA superfamily transcriptional regulator [Stenotrophomonas sp.
          SKA14]
 gi|219722566|gb|EED41091.1| BolA superfamily transcriptional regulator [Stenotrophomonas sp.
          SKA14]
          Length = 76

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 45/74 (60%), Gaps = 2/74 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+   I  +I+ G+P +   +     DG H+ A ++ E F G+  + +H+MVY +LG+ M
Sbjct: 1  MDADTIRNLIETGLPGARADVR--GDDGVHFEATVVCEAFAGRMPLARHRMVYATLGDLM 58

Query: 63 GNALHALSIKTSVP 76
          G A+HAL++KT  P
Sbjct: 59 GGAIHALALKTVTP 72


>gi|319761587|ref|YP_004125524.1| bola family protein [Alicycliphilus denitrificans BC]
 gi|330823455|ref|YP_004386758.1| BolA family protein [Alicycliphilus denitrificans K601]
 gi|317116148|gb|ADU98636.1| BolA family protein [Alicycliphilus denitrificans BC]
 gi|329308827|gb|AEB83242.1| BolA family protein [Alicycliphilus denitrificans K601]
          Length = 82

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   +I+ +I   +    +T   L GDG H+ A I+S EF GK  IQ+HQ VY +LG+KM
Sbjct: 1  MTADQIKDIISAAMACDYIT---LEGDGRHWYAVIVSAEFEGKRPIQRHQRVYATLGDKM 57

Query: 63 -GNALHALSIKTSVP 76
            + +HALS+KT  P
Sbjct: 58 QRDEVHALSMKTFTP 72


>gi|253995680|ref|YP_003047744.1| BolA family protein [Methylotenera mobilis JLW8]
 gi|253982359|gb|ACT47217.1| BolA family protein [Methylotenera mobilis JLW8]
          Length = 83

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 48/76 (63%), Gaps = 2/76 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          ++  ++E  I + +    + +  L  DG H+ A I+S EF GK  I+QHQ+VY +LG++M
Sbjct: 2  LSAQQLETYITQNLACDYIKV--LGDDGTHFEAVIVSPEFVGKTMIKQHQLVYAALGDRM 59

Query: 63 GNALHALSIKTSVPDS 78
             +HALS++T  P++
Sbjct: 60 RAEIHALSMRTLTPEA 75


>gi|294788284|ref|ZP_06753527.1| BolA family protein [Simonsiella muelleri ATCC 29453]
 gi|294483715|gb|EFG31399.1| BolA family protein [Simonsiella muelleri ATCC 29453]
          Length = 83

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 50/78 (64%), Gaps = 4/78 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          ++P +++ +I+  IP   V +    GDG+H+ A+I+S EF GKNR+ +H+++ D L  ++
Sbjct: 2  LHPEQVKSLIENVIPCEFVAVE---GDGHHFFAQIVSAEFEGKNRLTRHRLIKDGLAAQL 58

Query: 63 -GNALHALSIKTSVPDSQ 79
            N LHALSI  +   ++
Sbjct: 59 VSNELHALSISVAATPAE 76


>gi|73667314|ref|YP_303330.1| BolA-like protein [Ehrlichia canis str. Jake]
 gi|72394455|gb|AAZ68732.1| BolA-like protein [Ehrlichia canis str. Jake]
          Length = 76

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 49/73 (67%), Gaps = 3/73 (4%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M++   ++E +IK   P++ VTI  L  D NHY+ ++IS +F+GK++++QH+M+Y  L  
Sbjct: 4  MTIIQSQLETLIKDAFPEAEVTITSLVNDNNHYSIKVISNQFQGKSKLEQHRMIYKVLD- 62

Query: 61 KMGNALHALSIKT 73
            G  +HA+ I+T
Sbjct: 63 --GLNIHAIQIQT 73


>gi|322369321|ref|ZP_08043886.1| hypothetical protein ZOD2009_07529 [Haladaptatus paucihalophilus
          DX253]
 gi|320551053|gb|EFW92702.1| hypothetical protein ZOD2009_07529 [Haladaptatus paucihalophilus
          DX253]
          Length = 91

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 48/77 (62%), Gaps = 2/77 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAG--DGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          MN +E+ ++I+  +  +  T+    G  D +H AA ++S  F GK  ++QHQ+VYD+LG+
Sbjct: 10 MNANEVAELIESELNDADATVSHPRGVHDEDHLAATVVSPAFEGKTLVEQHQLVYDALGD 69

Query: 61 KMGNALHALSIKTSVPD 77
           M   +HAL +KT  P+
Sbjct: 70 HMTTDIHALELKTYTPE 86


>gi|255020574|ref|ZP_05292637.1| hypothetical protein ACA_1737 [Acidithiobacillus caldus ATCC
          51756]
 gi|254969959|gb|EET27458.1| hypothetical protein ACA_1737 [Acidithiobacillus caldus ATCC
          51756]
          Length = 79

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 47/75 (62%), Gaps = 2/75 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MN   I ++I+ G+P + V +  L  DG H+ A +I+ +F G++ +Q+HQ VY  LG +M
Sbjct: 1  MNADTIRELIQSGLPGADVRV--LGDDGAHFEAVVIAPQFTGRSLVQRHQQVYACLGERM 58

Query: 63 GNALHALSIKTSVPD 77
             +HAL ++T  P+
Sbjct: 59 RAEIHALQLRTLSPE 73


>gi|163736586|ref|ZP_02144005.1| BolA-like protein [Phaeobacter gallaeciensis BS107]
 gi|163742769|ref|ZP_02150154.1| BolA-like protein [Phaeobacter gallaeciensis 2.10]
 gi|161384024|gb|EDQ08408.1| BolA-like protein [Phaeobacter gallaeciensis 2.10]
 gi|161390456|gb|EDQ14806.1| BolA-like protein [Phaeobacter gallaeciensis BS107]
          Length = 78

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 47/80 (58%), Gaps = 5/80 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M   EIE ++++  P + + +     DG H +A +I E FRGKNR+QQ + VY +L  
Sbjct: 1  MPMQAQEIEDLLRESFPDAEIQVG--GHDGVHMSAMVIDESFRGKNRVQQQRAVYAALKG 58

Query: 61 KMGNA---LHALSIKTSVPD 77
          KM  A   LHAL++ T  P+
Sbjct: 59 KMDGANGELHALALTTKAPE 78


>gi|194364738|ref|YP_002027348.1| BolA family protein [Stenotrophomonas maltophilia R551-3]
 gi|194347542|gb|ACF50665.1| BolA family protein [Stenotrophomonas maltophilia R551-3]
          Length = 76

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 45/74 (60%), Gaps = 2/74 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+   I  +I+ G+P +   +     DG H+ A ++ + F GK  + +H+MVY +LG+ M
Sbjct: 1  MDADTIRNLIETGLPGARADVQ--GDDGVHFEATVVCDAFAGKMPLARHRMVYATLGDLM 58

Query: 63 GNALHALSIKTSVP 76
          G A+HAL++KT  P
Sbjct: 59 GGAIHALALKTVTP 72


>gi|71909006|ref|YP_286593.1| BolA-like protein [Dechloromonas aromatica RCB]
 gi|71848627|gb|AAZ48123.1| transcriptional regulator, BolA protein family [Dechloromonas
          aromatica RCB]
          Length = 81

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 49/76 (64%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+P  I+++I  G+   ++   +L GDG H+ A ++S+EF GK+R+Q+ Q VY +L  K+
Sbjct: 2  MHPDHIKELILAGMACDLL---ELDGDGQHFQALVVSKEFIGKSRVQRQQRVYQTLKEKL 58

Query: 63 GNA-LHALSIKTSVPD 77
              LHALS KT  P+
Sbjct: 59 DTGELHALSFKTLTPE 74


>gi|285018898|ref|YP_003376609.1| transcriptional regulator transcription regulator protein
          [Xanthomonas albilineans GPE PC73]
 gi|283474116|emb|CBA16617.1| putative transcriptional regulator transcription regulator
          protein [Xanthomonas albilineans]
          Length = 80

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 45/75 (60%), Gaps = 2/75 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M    I K+I+ G+P + V +     DG H+ A ++S  F GK  + +H+MVY +LG  M
Sbjct: 1  MEAETIRKLIQAGLPDAHVQVQ--GEDGVHFEATVVSAAFVGKLPLARHRMVYATLGELM 58

Query: 63 GNALHALSIKTSVPD 77
          G A+HAL++ T  P+
Sbjct: 59 GGAIHALALTTLTPE 73


>gi|124266021|ref|YP_001020025.1| BolA family transcriptional regulator [Methylibium petroleiphilum
          PM1]
 gi|124258796|gb|ABM93790.1| transcriptional regulator BolA superfamily-like protein
          [Methylibium petroleiphilum PM1]
          Length = 92

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 44/66 (66%), Gaps = 1/66 (1%)

Query: 12 IKKGIPQSIVTIH-DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALS 70
          +++ I Q +   H  + GDG H+ A I+S EF G +R+++HQ VY +LG++M   +HALS
Sbjct: 9  VQRYIAQGLACEHLQVDGDGRHFFATIVSAEFDGLSRVRRHQRVYAALGDRMREQIHALS 68

Query: 71 IKTSVP 76
          +KT  P
Sbjct: 69 MKTLTP 74


>gi|29653920|ref|NP_819612.1| BolA family protein [Coxiella burnetii RSA 493]
 gi|153208820|ref|ZP_01947047.1| BolA family protein [Coxiella burnetii 'MSU Goat Q177']
 gi|154707645|ref|YP_001424825.1| BolA [Coxiella burnetii Dugway 5J108-111]
 gi|161830322|ref|YP_001596510.1| BolA family protein [Coxiella burnetii RSA 331]
 gi|165919096|ref|ZP_02219182.1| BolA family protein [Coxiella burnetii RSA 334]
 gi|212212927|ref|YP_002303863.1| BolA [Coxiella burnetii CbuG_Q212]
 gi|212218798|ref|YP_002305585.1| BolA [Coxiella burnetii CbuK_Q154]
 gi|29541183|gb|AAO90126.1| BolA [Coxiella burnetii RSA 493]
 gi|120575726|gb|EAX32350.1| BolA family protein [Coxiella burnetii 'MSU Goat Q177']
 gi|154356931|gb|ABS78393.1| BolA [Coxiella burnetii Dugway 5J108-111]
 gi|161762189|gb|ABX77831.1| BolA family protein [Coxiella burnetii RSA 331]
 gi|165917230|gb|EDR35834.1| BolA family protein [Coxiella burnetii RSA 334]
 gi|212011337|gb|ACJ18718.1| BolA [Coxiella burnetii CbuG_Q212]
 gi|212013060|gb|ACJ20440.1| BolA [Coxiella burnetii CbuK_Q154]
          Length = 79

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 49/75 (65%), Gaps = 2/75 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          +  H+I++ I+ G+ +S V      GDG+H+ A ++   F G+  + +H++VY++LG+ M
Sbjct: 2  VTTHDIKQWIETGLSESRVI--SAEGDGHHFEAVVLCPTFEGQTALTRHRLVYNALGSHM 59

Query: 63 GNALHALSIKTSVPD 77
           + +HALS+KT  PD
Sbjct: 60 QSDIHALSLKTYTPD 74


>gi|86138823|ref|ZP_01057395.1| BolA-like protein [Roseobacter sp. MED193]
 gi|85824470|gb|EAQ44673.1| BolA-like protein [Roseobacter sp. MED193]
          Length = 78

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 47/80 (58%), Gaps = 5/80 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M   EIE ++++  P + + +     DG H +A ++ E FRGKNR+QQ + VY +L  
Sbjct: 1  MPMQAQEIEDLLRQTFPDAEIQVA--GNDGVHMSAMVVDESFRGKNRVQQQRAVYAALKG 58

Query: 61 KMGNA---LHALSIKTSVPD 77
          KM  +   LHAL++ T  P+
Sbjct: 59 KMDGSNGELHALALTTKAPE 78


>gi|257388097|ref|YP_003177870.1| BolA family protein [Halomicrobium mukohataei DSM 12286]
 gi|257170404|gb|ACV48163.1| BolA family protein [Halomicrobium mukohataei DSM 12286]
          Length = 80

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 46/76 (60%), Gaps = 2/76 (2%)

Query: 3  MNPHEIEKMIKKGI--PQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          MN  EIE++I+ GI    + VTI     + +HYAA +++  F G++ + +HQ VYD+L  
Sbjct: 1  MNTDEIERLIEAGIDDADATVTISHGTAEDDHYAARVVAPAFEGESLVDRHQRVYDALDG 60

Query: 61 KMGNALHALSIKTSVP 76
           M   +HA+ I+T  P
Sbjct: 61 HMTTDIHAIEIETYAP 76


>gi|89054663|ref|YP_510114.1| BolA-like protein [Jannaschia sp. CCS1]
 gi|88864212|gb|ABD55089.1| BolA-like protein [Jannaschia sp. CCS1]
          Length = 78

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 45/80 (56%), Gaps = 5/80 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M   EIE +++   P + + +     DG H AA ++ E FRGKNR+QQ + VY +L  
Sbjct: 1  MPMQASEIEMLLRDSFPDAKIEVS--GNDGVHMAAMVVDESFRGKNRVQQQRAVYAALKG 58

Query: 61 KM---GNALHALSIKTSVPD 77
          KM      LHAL++ T  P+
Sbjct: 59 KMDGPSGELHALALTTKAPE 78


>gi|37523986|ref|NP_927363.1| hypothetical protein gsr4417 [Gloeobacter violaceus PCC 7421]
 gi|35214992|dbj|BAC92358.1| gsr4417 [Gloeobacter violaceus PCC 7421]
          Length = 87

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 47/76 (61%), Gaps = 1/76 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+  ++  +I +  P + V + D  G G+H+ A ++SE F G   I+QH++VY S+ N +
Sbjct: 1  MDTEDVRALILQTFPDASVEVQDFTGTGDHFQAMVVSERFAGLTMIKQHKLVYQSVQNYI 60

Query: 63 GNA-LHALSIKTSVPD 77
           +  +HAL+++T  P+
Sbjct: 61 DDGRIHALALRTYTPE 76


>gi|159044261|ref|YP_001533055.1| hypothetical protein Dshi_1712 [Dinoroseobacter shibae DFL 12]
 gi|157912021|gb|ABV93454.1| hypothetical protein Dshi_1712 [Dinoroseobacter shibae DFL 12]
          Length = 77

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 5/79 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M M   EIE ++++  P + + +     DG H +A ++ E FRGKNR+QQ + VY +L  
Sbjct: 1  MPMQADEIEALLRESFPNAQIVVE--GDDGVHMSAMVVDESFRGKNRVQQQRAVYAALKG 58

Query: 61 KM---GNALHALSIKTSVP 76
          KM      LHAL++ T  P
Sbjct: 59 KMDGPAGELHALALTTKAP 77


>gi|91786703|ref|YP_547655.1| BolA-like protein [Polaromonas sp. JS666]
 gi|91695928|gb|ABE42757.1| BolA-like protein [Polaromonas sp. JS666]
          Length = 85

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 46/75 (61%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   E++ +I  G+P   +   +L+GDG H+ A I+S  F G   IQ+HQ VY +LG ++
Sbjct: 1  MTSEELQTIIAAGLPCEHI---ELSGDGRHWYATIVSSAFEGLRLIQRHQRVYATLGGRL 57

Query: 63 -GNALHALSIKTSVP 76
            + +HALS+KT  P
Sbjct: 58 QTDEVHALSMKTYTP 72


>gi|163854445|ref|YP_001628743.1| BolA-like protein [Bordetella petrii DSM 12804]
 gi|163258173|emb|CAP40472.1| BolA-like protein [Bordetella petrii]
          Length = 81

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 46/77 (59%), Gaps = 3/77 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P ++ + I   +P   +   D+ GDG+H+ A I+S  F GK  I +HQ+VY +LG 
Sbjct: 1  MLPTPEQVRQYIADNLPCEHL---DVQGDGSHFDAVIVSPAFEGKRLIARHQLVYAALGE 57

Query: 61 KMGNALHALSIKTSVPD 77
          +M   +HALS++T  P+
Sbjct: 58 RMKAEIHALSMRTMTPE 74


>gi|254468264|ref|ZP_05081670.1| BolA-like protein [beta proteobacterium KB13]
 gi|207087074|gb|EDZ64357.1| BolA-like protein [beta proteobacterium KB13]
          Length = 81

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (65%), Gaps = 2/70 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+  EI+K+I+K I    + +  +  DG H+ A +IS EF   NR+Q+HQ+VY SLG+ M
Sbjct: 1  MHKDEIKKVIEKDIDCHHIDV--MGDDGAHFEALVISNEFLNLNRVQRHQLVYQSLGDLM 58

Query: 63 GNALHALSIK 72
             +HALS+K
Sbjct: 59 NEKIHALSLK 68


>gi|187479781|ref|YP_787806.1| BolA-like protein [Bordetella avium 197N]
 gi|115424368|emb|CAJ50921.1| BolA-like protein [Bordetella avium 197N]
          Length = 81

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 47/77 (61%), Gaps = 3/77 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   P ++ + I  G+    +   D+ GDG+H+ A I+S  F GK  I +HQ+VY +LG+
Sbjct: 1  MLPTPEQVRQYIADGLSCEHL---DVQGDGSHFDAVIVSTAFEGKRLIARHQLVYAALGD 57

Query: 61 KMGNALHALSIKTSVPD 77
          +M   +HALS++T  P+
Sbjct: 58 RMKAEIHALSMRTLTPE 74


>gi|292657012|ref|YP_003536909.1| hypothetical protein HVO_2899 [Haloferax volcanii DS2]
 gi|291370436|gb|ADE02663.1| conserved domain protein [Haloferax volcanii DS2]
          Length = 87

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 46/75 (61%), Gaps = 5/75 (6%)

Query: 8  IEKMIKKGIPQSIVTIH-----DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          IE +I+  I  +  T+      D   + +HYAA ++S  F GK+ +QQHQ+VYD+LG+ M
Sbjct: 6  IEDLIESHIEDADATVSRPRTVDQDHEDDHYAAVVVSPAFEGKSLVQQHQLVYDALGDHM 65

Query: 63 GNALHALSIKTSVPD 77
             +HA+ +KT  P+
Sbjct: 66 TTDIHAMELKTYTPE 80


>gi|108758941|ref|YP_630252.1| BolA/YrbA family protein [Myxococcus xanthus DK 1622]
 gi|108462821|gb|ABF88006.1| BolA/YrbA family protein [Myxococcus xanthus DK 1622]
          Length = 85

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 8  IEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA-L 66
          I   I + +P S V + D  G G+HY A ++S +F GK  +QQHQ+VY  L   + +  L
Sbjct: 7  IRARILEALPGSEVEVRDYTGTGDHYEARVVSPDFAGKAMVQQHQLVYAPLQQWLKSGEL 66

Query: 67 HALSIKTSVPD 77
          HAL++KT  P+
Sbjct: 67 HALALKTYSPE 77


>gi|87302327|ref|ZP_01085152.1| BolA-like protein [Synechococcus sp. WH 5701]
 gi|87283252|gb|EAQ75208.1| BolA-like protein [Synechococcus sp. WH 5701]
          Length = 80

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          +   ++++ I   +P + V + DL G G+H   +++S  F G +RI+QHQ+VY +L  ++
Sbjct: 2  VQSEQVKEAICASLPDAEVEVEDLTGGGDHLQVKVVSSAFAGLSRIKQHQLVYAALRREL 61

Query: 63 GN-ALHALSIKTSVP 76
           + A+HAL+++T+ P
Sbjct: 62 ASEAIHALALQTTTP 76


>gi|115374891|ref|ZP_01462164.1| BolA family protein [Stigmatella aurantiaca DW4/3-1]
 gi|310820103|ref|YP_003952461.1| bola family protein [Stigmatella aurantiaca DW4/3-1]
 gi|115368109|gb|EAU67071.1| BolA family protein [Stigmatella aurantiaca DW4/3-1]
 gi|309393175|gb|ADO70634.1| BolA family protein [Stigmatella aurantiaca DW4/3-1]
          Length = 85

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 45/76 (59%), Gaps = 1/76 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          +N   + + I + +P S V + D  G G+H+ A ++S  F GK  +QQH++VY  L   +
Sbjct: 2  LNEETLRRYILEALPGSEVVVRDTTGTGDHFEAHVVSPAFAGKTMVQQHKLVYAPLQPWL 61

Query: 63 GNA-LHALSIKTSVPD 77
           +  LHAL++KT  P+
Sbjct: 62 ASGELHALALKTYSPE 77


>gi|171058267|ref|YP_001790616.1| BolA family protein [Leptothrix cholodnii SP-6]
 gi|170775712|gb|ACB33851.1| BolA family protein [Leptothrix cholodnii SP-6]
          Length = 92

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (57%), Gaps = 3/73 (4%)

Query: 4  NPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG 63
           P  ++ +I  G+    + +    GDG H+ A I+S  F G +RI++HQ VY  LG +M 
Sbjct: 5  TPDHVQSLIAAGLACEHLAV---EGDGRHFFATIVSSRFEGLSRIRRHQQVYAVLGERMR 61

Query: 64 NALHALSIKTSVP 76
            +HALS+KT  P
Sbjct: 62 EEIHALSMKTLTP 74


>gi|301630054|ref|XP_002944146.1| PREDICTED: ATP phosphoribosyltransferase-like [Xenopus (Silurana)
          tropicalis]
          Length = 227

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   +++ +I  G+    +    L GDG H+ A I+S EF G+  IQ+HQ VY +LGNK+
Sbjct: 1  MTADQLKDIISAGLACEHIA---LEGDGRHWWATIVSAEFEGQRPIQRHQRVYATLGNKI 57

Query: 63 -GNALHALSIKTSVP 76
            + +HALS+KT  P
Sbjct: 58 QRDEVHALSMKTFTP 72


>gi|45657673|ref|YP_001759.1| BolA-like protein [Leptospira interrogans serovar Copenhageni
          str. Fiocruz L1-130]
 gi|45600913|gb|AAS70396.1| BolA-like protein [Leptospira interrogans serovar Copenhageni
          str. Fiocruz L1-130]
          Length = 83

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 49/76 (64%)

Query: 2  SMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNK 61
          +M   EI+  I+ G+P S VTI D   DG H  A +I + F GK+ ++QH+MVY++L  +
Sbjct: 8  TMTIDEIKNKIESGLPDSKVTILDPYKDGVHIKAIVIYKGFEGKSILEQHRMVYETLKEE 67

Query: 62 MGNALHALSIKTSVPD 77
          +   +HAL+++T + +
Sbjct: 68 LKQEVHALALETRIQE 83


>gi|56416474|ref|YP_153548.1| hypothetical protein AM154 [Anaplasma marginale str. St. Maries]
 gi|254994700|ref|ZP_05276890.1| hypothetical protein AmarM_00645 [Anaplasma marginale str.
          Mississippi]
 gi|255002814|ref|ZP_05277778.1| hypothetical protein AmarPR_00605 [Anaplasma marginale str.
          Puerto Rico]
 gi|56387706|gb|AAV86293.1| hypothetical protein AM154 [Anaplasma marginale str. St. Maries]
          Length = 78

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 3/75 (4%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M +    IE+++    P S V +  LA DG HYA  ++S  F GK++++QH+MVY +L  
Sbjct: 1  MGVELFRIEQLLSSAFPGSEVHVRPLAHDGEHYAIRVVSNAFAGKSKLEQHRMVYSALS- 59

Query: 61 KMGNALHALSIKTSV 75
            G  +HAL I+T V
Sbjct: 60 --GIDVHALQIQTEV 72


>gi|116328088|ref|YP_797808.1| BolA family transcriptional regulator [Leptospira borgpetersenii
          serovar Hardjo-bovis L550]
 gi|116331459|ref|YP_801177.1| BolA family transcriptional regulator [Leptospira borgpetersenii
          serovar Hardjo-bovis JB197]
 gi|116120832|gb|ABJ78875.1| Transcriptional regulator, BolA-family [Leptospira borgpetersenii
          serovar Hardjo-bovis L550]
 gi|116125148|gb|ABJ76419.1| Transcriptional regulator, BolA-family [Leptospira borgpetersenii
          serovar Hardjo-bovis JB197]
          Length = 75

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 48/75 (64%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EI+  I+ G+P S VTI D   DG H  A +I + F GK+ ++QH+MVY++L  ++
Sbjct: 1  MTIDEIKNKIESGLPDSKVTILDPYRDGVHIKAVVIYKGFEGKSILEQHRMVYETLKEEL 60

Query: 63 GNALHALSIKTSVPD 77
             +HAL+++T + +
Sbjct: 61 KQEVHALALETRIQE 75


>gi|121611367|ref|YP_999174.1| BolA family protein [Verminephrobacter eiseniae EF01-2]
 gi|121556007|gb|ABM60156.1| BolA family protein [Verminephrobacter eiseniae EF01-2]
          Length = 82

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   E+ + I  G+  + +T   L GDG H+ A I+S EF G   I +HQ VY +LG  M
Sbjct: 1  MTAEELRQRIAAGLACTHIT---LTGDGRHWYASIVSPEFEGLRAIARHQRVYATLGTSM 57

Query: 63 -GNALHALSIKTSVP 76
            + +HALS+KT  P
Sbjct: 58 QTDEVHALSMKTYTP 72


>gi|289583244|ref|YP_003481710.1| BolA family protein [Natrialba magadii ATCC 43099]
 gi|289532797|gb|ADD07148.1| BolA family protein [Natrialba magadii ATCC 43099]
          Length = 88

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 2/77 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAG--DGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          MNP ++  +I+  +  +  T+       D +H AA +IS  F G++ +QQHQ VYD+L +
Sbjct: 1  MNPADVADLIESELEDADATVRPARDKHDEDHLAATVISPAFEGQSLVQQHQQVYDALDD 60

Query: 61 KMGNALHALSIKTSVPD 77
           M   +HAL + T  PD
Sbjct: 61 HMTTDIHALELSTYTPD 77


>gi|294828031|ref|NP_712291.2| BolA family protein [Leptospira interrogans serovar Lai str.
          56601]
 gi|293385878|gb|AAN49309.2| BolA family protein [Leptospira interrogans serovar Lai str.
          56601]
          Length = 75

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 48/75 (64%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EI+  I+ G+P S VTI D   DG H  A +I + F GK+ ++QH+MVY++L  ++
Sbjct: 1  MTIDEIKNKIESGLPDSKVTILDPYKDGVHIKAIVIYKGFEGKSILEQHRMVYETLKEEL 60

Query: 63 GNALHALSIKTSVPD 77
             +HAL+++T + +
Sbjct: 61 KQEVHALALETRIQE 75


>gi|119492821|ref|ZP_01623907.1| BolA-like protein [Lyngbya sp. PCC 8106]
 gi|119452974|gb|EAW34146.1| BolA-like protein [Lyngbya sp. PCC 8106]
          Length = 67

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 37/56 (66%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          ++E MI+  +P S+V + DL G G+H  A ++S EF GK  ++QHQMVY ++   M
Sbjct: 6  QVEAMIQSKLPGSMVQVQDLTGGGDHLQAVVVSSEFEGKTLVKQHQMVYSAVKEAM 61


>gi|123968749|ref|YP_001009607.1| BolA-like protein [Prochlorococcus marinus str. AS9601]
 gi|123198859|gb|ABM70500.1| BolA-like protein [Prochlorococcus marinus str. AS9601]
          Length = 76

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 48/72 (66%), Gaps = 2/72 (2%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-A 65
          E+ K+I K IP S V + +L G+ +H    +I+ EF G + ++QHQ+VY +L  ++ + A
Sbjct: 6  EVIKLITKKIPSSQVFVENLKGN-DHLQVTVIASEFNGLSLVKQHQLVYSALKEELASEA 64

Query: 66 LHALSIKTSVPD 77
          +HAL++KT  P+
Sbjct: 65 IHALALKTETPN 76


>gi|194477269|ref|YP_002049448.1| BolA-like protein [Paulinella chromatophora]
 gi|171192276|gb|ACB43238.1| BolA-like protein [Paulinella chromatophora]
          Length = 77

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 49/70 (70%), Gaps = 1/70 (1%)

Query: 8  IEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-AL 66
          + + I   +P S V + DL G G+H++ +++S  F G ++++QH++VY++L +++ N ++
Sbjct: 7  VREAICLSVPSSEVEVEDLTGTGDHFSVKVMSSTFVGLSKLKQHKLVYEALKSELQNHSI 66

Query: 67 HALSIKTSVP 76
          HA+++ T +P
Sbjct: 67 HAITLSTFIP 76


>gi|222869894|gb|EEF07025.1| predicted protein [Populus trichocarpa]
          Length = 75

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 47/75 (62%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   +++++I  G+P   +    L GDG H+ A I+S +F G+  +Q+ ++VY +LG +M
Sbjct: 1  MTADQLKELIATGLPCEHIA---LEGDGRHWFATIVSAQFEGQRLLQRQRLVYATLGQRM 57

Query: 63 -GNALHALSIKTSVP 76
            + +HALS+KT  P
Sbjct: 58 HTDEVHALSMKTYTP 72


>gi|160900960|ref|YP_001566542.1| BolA family protein [Delftia acidovorans SPH-1]
 gi|160366544|gb|ABX38157.1| BolA family protein [Delftia acidovorans SPH-1]
          Length = 82

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 47/75 (62%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   +++++I  G+P   +    L GDG H+ A I+S +F G+  +Q+ ++VY +LG +M
Sbjct: 1  MTADQLKELIATGLPCEHIA---LEGDGRHWFATIVSAQFEGQRLLQRQRLVYATLGQRM 57

Query: 63 -GNALHALSIKTSVP 76
            + +HALS+KT  P
Sbjct: 58 HTDEVHALSMKTYTP 72


>gi|260220248|emb|CBA27597.1| hypothetical protein Csp_A03070 [Curvibacter putative symbiont of
          Hydra magnipapillata]
          Length = 80

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 45/75 (60%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   +++ +I  G+         L GDG H+ A I+S EF GK  +Q+ ++VY +LGN+M
Sbjct: 1  MTADQLQAIITAGLACDHCA---LEGDGRHWYATIVSPEFEGKRLVQRQRLVYATLGNRM 57

Query: 63 -GNALHALSIKTSVP 76
            + +HALS+KT  P
Sbjct: 58 QTDEVHALSMKTFSP 72


>gi|221069023|ref|ZP_03545128.1| BolA family protein [Comamonas testosteroni KF-1]
 gi|220714046|gb|EED69414.1| BolA family protein [Comamonas testosteroni KF-1]
          Length = 80

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 46/75 (61%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   +++ +I  G+P   +    L GDG H+ A I+S +F G+  + + ++VY +LGN+M
Sbjct: 1  MTADQLKDLIAAGLPCEHIA---LEGDGRHWFATIVSAQFEGQRLLGRQRLVYATLGNRM 57

Query: 63 G-NALHALSIKTSVP 76
            + +HALS+KT  P
Sbjct: 58 ATDEVHALSMKTYTP 72


>gi|269959113|ref|YP_003328902.1| BolA-like protein [Anaplasma centrale str. Israel]
 gi|269848944|gb|ACZ49588.1| BolA-like protein [Anaplasma centrale str. Israel]
          Length = 78

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 44/75 (58%), Gaps = 3/75 (4%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M +    IE+++    P   V +  LA DG HYA  ++S  F GK++++QH+MVY +L  
Sbjct: 1  MGVELFRIEQLLSSAFPGGEVHVRPLAHDGEHYAIRVVSNAFAGKSKLEQHRMVYSAL-- 58

Query: 61 KMGNALHALSIKTSV 75
            G  +HAL I+T V
Sbjct: 59 -YGIDVHALQIQTEV 72


>gi|264676845|ref|YP_003276751.1| BolA-like protein [Comamonas testosteroni CNB-2]
 gi|299529665|ref|ZP_07043102.1| BolA-like protein [Comamonas testosteroni S44]
 gi|262207357|gb|ACY31455.1| BolA-like protein [Comamonas testosteroni CNB-2]
 gi|298722528|gb|EFI63448.1| BolA-like protein [Comamonas testosteroni S44]
          Length = 80

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 46/75 (61%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   +++ +I  G+P   +    L GDG H+ A I+S +F G+  + + ++VY +LGN+M
Sbjct: 1  MTADQLKDLIAAGLPCEHIA---LEGDGRHWFATIVSAQFEGQRLLGRQRLVYATLGNRM 57

Query: 63 G-NALHALSIKTSVP 76
            + +HALS+KT  P
Sbjct: 58 ATDEVHALSMKTYTP 72


>gi|220935853|ref|YP_002514752.1| BolA family protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997163|gb|ACL73765.1| BolA family protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 80

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 49/75 (65%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P +++++I   +P + V++    GDG  + A +IS EF G N +++HQ VY ++GN++
Sbjct: 1  MTPEQVQQLISSRMPDARVSV--TGGDGK-FEATVISAEFEGLNPVKRHQRVYATVGNEI 57

Query: 63 GN-ALHALSIKTSVP 76
           + A+HALSIK   P
Sbjct: 58 ASGAIHALSIKPFTP 72


>gi|222474843|ref|YP_002563258.1| hypothetical protein AMF_114 [Anaplasma marginale str. Florida]
 gi|255003946|ref|ZP_05278747.1| hypothetical protein AmarV_00615 [Anaplasma marginale str.
          Virginia]
 gi|222418979|gb|ACM49002.1| Conserved hypothetical protein [Anaplasma marginale str. Florida]
          Length = 78

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 44/75 (58%), Gaps = 3/75 (4%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M +    IE+++    P   V +  LA DG HYA  ++S  F GK++++QH+MVY +L  
Sbjct: 1  MGVELFRIEQLLSSAFPGGEVHVRPLAHDGEHYAIRVVSNAFAGKSKLEQHRMVYSALS- 59

Query: 61 KMGNALHALSIKTSV 75
            G  +HAL I+T V
Sbjct: 60 --GIDVHALQIQTEV 72


>gi|284043074|ref|YP_003393414.1| BolA family protein [Conexibacter woesei DSM 14684]
 gi|283947295|gb|ADB50039.1| BolA family protein [Conexibacter woesei DSM 14684]
          Length = 78

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 48/71 (67%), Gaps = 4/71 (5%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
          E+++ I++G+P S     D+ GD G+H+ A +++ +F G +RI QH++VYD    ++G  
Sbjct: 6  ELKQRIEEGLPGSSA---DVKGDDGHHFEAVVVAPQFEGLSRIAQHRLVYDVFEGELGGR 62

Query: 66 LHALSIKTSVP 76
          +HAL+++T  P
Sbjct: 63 IHALALQTKAP 73


>gi|126729724|ref|ZP_01745537.1| BolA-like protein [Sagittula stellata E-37]
 gi|126709843|gb|EBA08896.1| BolA-like protein [Sagittula stellata E-37]
          Length = 78

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 5/80 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M ++  ++E ++++  P + + +     DG H +A ++ E FRG NR+QQ + VY +L  
Sbjct: 1  MPIHAQDLEDLLRQSFPDAKIVVE--GDDGVHMSAMVVDESFRGMNRVQQQRAVYAALKG 58

Query: 61 KM---GNALHALSIKTSVPD 77
          KM      LHAL++ T  PD
Sbjct: 59 KMDGPSGELHALALTTRAPD 78


>gi|124026178|ref|YP_001015294.1| BolA-like protein [Prochlorococcus marinus str. NATL1A]
 gi|123961246|gb|ABM76029.1| BolA-like protein [Prochlorococcus marinus str. NATL1A]
          Length = 76

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 48/75 (64%), Gaps = 2/75 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          +   E+  +IK+ +P + + + D+ G G+H    ++S +F G + +QQHQ+VY +L N++
Sbjct: 2  ITAKEVTLLIKQSLPDAQIDVIDMGG-GDHLEVNVVSAKFAGLSLVQQHQLVYGALKNEL 60

Query: 63 GN-ALHALSIKTSVP 76
              +HAL++KTS P
Sbjct: 61 KTETIHALALKTSTP 75


>gi|149925798|ref|ZP_01914062.1| predicted transcriptional regulator, BolA superfamily protein
          [Limnobacter sp. MED105]
 gi|149825915|gb|EDM85123.1| predicted transcriptional regulator, BolA superfamily protein
          [Limnobacter sp. MED105]
          Length = 80

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 42/72 (58%), Gaps = 3/72 (4%)

Query: 5  PHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN 64
          P  +   I +G+    +T+   +GDG H+ A I++  F G   IQ+HQ VY  LG++M  
Sbjct: 4  PETVRGYIAQGLECEHLTV---SGDGQHFEAVIVASAFEGLRAIQRHQKVYAVLGDRMRA 60

Query: 65 ALHALSIKTSVP 76
           +HALS+KT  P
Sbjct: 61 EIHALSMKTLTP 72


>gi|72382479|ref|YP_291834.1| BolA-like protein [Prochlorococcus marinus str. NATL2A]
 gi|72002329|gb|AAZ58131.1| transcriptional regulator, BolA protein family [Prochlorococcus
          marinus str. NATL2A]
          Length = 76

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 47/71 (66%), Gaps = 2/71 (2%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNA 65
          E+  +IK+ +P + + + D+ G G+H    ++S +F G + +QQHQ+VY +L N++    
Sbjct: 6  EVTLLIKQSLPDAQIDVIDMGG-GDHLEVNVVSAKFAGLSLVQQHQLVYGALKNELRTET 64

Query: 66 LHALSIKTSVP 76
          +HAL++KTS P
Sbjct: 65 IHALALKTSTP 75


>gi|167950712|ref|ZP_02537786.1| hypothetical protein Epers_31641 [Endoriftia persephone
          'Hot96_1+Hot96_2']
          Length = 97

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 47/74 (63%), Gaps = 4/74 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M    +E++I+ G+  + VT+    GDG H+ A +IS EF GK+ IQ+H+MV  ++  ++
Sbjct: 1  METTRVEELIRAGLSGAEVTV---TGDGRHFEAVVISAEFAGKSLIQKHRMVLATVQEQI 57

Query: 63 GN-ALHALSIKTSV 75
           N  LHALSIK + 
Sbjct: 58 ANDELHALSIKKAC 71


>gi|170077171|ref|YP_001733809.1| BolA family protein; stress induced morphogen [Synechococcus sp.
          PCC 7002]
 gi|169884840|gb|ACA98553.1| BolA family protein; stress induced morphogen [Synechococcus sp.
          PCC 7002]
          Length = 86

 Score = 57.0 bits (136), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 41/58 (70%), Gaps = 1/58 (1%)

Query: 21 VTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-ALHALSIKTSVPD 77
          V + DL G G+H  A ++S +F G++R++QHQMVY +L   + + A+HAL+++T  P+
Sbjct: 20 VFVKDLTGGGDHLEAIVVSPDFAGQSRVRQHQMVYAALKEDLASEAIHALALRTFTPE 77


>gi|145341768|ref|XP_001415975.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144576198|gb|ABO94267.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 98

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 14/82 (17%)

Query: 9  EKMIKKGIPQSIVTIHDLA-----------GDGN---HYAAEIISEEFRGKNRIQQHQMV 54
          +K+ +   P S+V I + A           GD +   H+  EI+SE F GK ++ +H+M+
Sbjct: 13 QKLTRALAPASLVVIDESAAHAGHVGNPARGDPSAETHFKVEIVSEAFEGKRQVLRHRMI 72

Query: 55 YDSLGNKMGNALHALSIKTSVP 76
          YD+L  +M N +HAL +KT  P
Sbjct: 73 YDALSEEMDNPIHALQLKTKTP 94


>gi|238020301|ref|ZP_04600727.1| hypothetical protein GCWU000324_00179 [Kingella oralis ATCC
          51147]
 gi|237867281|gb|EEP68287.1| hypothetical protein GCWU000324_00179 [Kingella oralis ATCC
          51147]
          Length = 82

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 48/78 (61%), Gaps = 4/78 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P +++++I +  P  ++ +    GDG+H+ A+I+S  F GK R+ +H+++ D L  K+
Sbjct: 2  LFPEQVKELIAQVTPCELIEVE---GDGHHFFAKIVSASFEGKARLARHRLIKDGLAAKL 58

Query: 63 G-NALHALSIKTSVPDSQ 79
            N LHALSI  +   ++
Sbjct: 59 ASNELHALSITVAATPAE 76


>gi|71908518|ref|YP_286105.1| BolA-like protein [Dechloromonas aromatica RCB]
 gi|71848139|gb|AAZ47635.1| transcriptional regulator, BolA protein family [Dechloromonas
          aromatica RCB]
          Length = 88

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 36/53 (67%)

Query: 24 HDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          H  A DG HY  +I+++ F GK+ I +H+M+YD+ G+ M   +HALSI+  VP
Sbjct: 33 HAGARDGGHYQLQIVAQAFAGKSTIARHRMIYDAAGDLMRGRIHALSIRAEVP 85


>gi|126696555|ref|YP_001091441.1| BolA-like protein [Prochlorococcus marinus str. MIT 9301]
 gi|126543598|gb|ABO17840.1| BolA-like protein [Prochlorococcus marinus str. MIT 9301]
          Length = 76

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 47/72 (65%), Gaps = 2/72 (2%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-A 65
          E+  +I K IP S V + +L G+ +H    +I+ EF G + ++QHQ+VY +L  ++ + A
Sbjct: 6  EVINLITKKIPSSKVFVENLKGN-DHLQVTVIASEFHGLSLVKQHQLVYSALKEELASEA 64

Query: 66 LHALSIKTSVPD 77
          +HAL++KT  P+
Sbjct: 65 IHALALKTETPN 76


>gi|241663099|ref|YP_002981459.1| BolA family protein [Ralstonia pickettii 12D]
 gi|309781980|ref|ZP_07676710.1| BolA protein [Ralstonia sp. 5_7_47FAA]
 gi|240865126|gb|ACS62787.1| BolA family protein [Ralstonia pickettii 12D]
 gi|308919046|gb|EFP64713.1| BolA protein [Ralstonia sp. 5_7_47FAA]
          Length = 90

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 49/87 (56%), Gaps = 10/87 (11%)

Query: 1  MSMNPHEIEKMIKKGI-PQSIVTIHD---------LAGDGNHYAAEIISEEFRGKNRIQQ 50
          M+ +P EIE+++++   P  +V   D          A  G HY  EI+S  F GKNR+ +
Sbjct: 1  MAADPREIERLLREAFQPVQLVVEDDSAKHAGHAGAASGGGHYNVEIVSAAFAGKNRLAR 60

Query: 51 HQMVYDSLGNKMGNALHALSIKTSVPD 77
          H+MVYD+L      A+HAL+I+   P+
Sbjct: 61 HRMVYDALHTLWPAAIHALAIRAVTPE 87


>gi|332286377|ref|YP_004418288.1| BolA-like protein [Pusillimonas sp. T7-7]
 gi|330430330|gb|AEC21664.1| BolA-like protein [Pusillimonas sp. T7-7]
          Length = 82

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 36/52 (69%)

Query: 25 DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          ++ GDG H+ A I+S  F GK  I +HQ+VY +LG++M   +HALS++T  P
Sbjct: 22 EVQGDGAHFEALIVSAAFEGKRLIGRHQLVYAALGDRMKAEIHALSMRTLTP 73


>gi|187928545|ref|YP_001899032.1| BolA family protein [Ralstonia pickettii 12J]
 gi|187725435|gb|ACD26600.1| BolA family protein [Ralstonia pickettii 12J]
          Length = 90

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 49/87 (56%), Gaps = 10/87 (11%)

Query: 1  MSMNPHEIEKMIKKGI-PQSIVTIHD---------LAGDGNHYAAEIISEEFRGKNRIQQ 50
          M+ +P EIE+++++   P  +V   D          A  G HY  EI+S  F GKNR+ +
Sbjct: 1  MAADPQEIERLLREAFQPVQLVVEDDSAKHAGHAGAASGGGHYNVEIVSATFAGKNRLAR 60

Query: 51 HQMVYDSLGNKMGNALHALSIKTSVPD 77
          H+MVYD+L      A+HAL+I+   P+
Sbjct: 61 HRMVYDALHTLWPAAIHALAIRAVTPE 87


>gi|78485330|ref|YP_391255.1| BolA-like protein [Thiomicrospira crunogena XCL-2]
 gi|78363616|gb|ABB41581.1| BolA-like protein [Thiomicrospira crunogena XCL-2]
          Length = 73

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 49/76 (64%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+P +I +MI+  I  + V    + G+  ++A E+IS  F GK+ +Q+H+MV D   ++ 
Sbjct: 1  MSPEKIREMIQSVIEDAQVK---MTGEDCNFAIEVISASFEGKSPLQRHRMVNDIFKDEF 57

Query: 63 GN-ALHALSIKTSVPD 77
           + ALHALSIKT +P+
Sbjct: 58 ASGALHALSIKTKLPE 73


>gi|89901714|ref|YP_524185.1| BolA-like protein [Rhodoferax ferrireducens T118]
 gi|89346451|gb|ABD70654.1| BolA-like protein [Rhodoferax ferrireducens T118]
          Length = 80

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 41/67 (61%), Gaps = 2/67 (2%)

Query: 12 IKKGIPQSIVTIH-DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHAL 69
          IK  I  +++  H +L GDG H+   I+S EF G   I++HQ VY +LG K+  N +HAL
Sbjct: 6  IKNIIAANLLCEHIELTGDGQHWYTTIVSPEFEGLRAIKRHQRVYATLGEKIHSNEVHAL 65

Query: 70 SIKTSVP 76
          SIK   P
Sbjct: 66 SIKAFTP 72


>gi|88811862|ref|ZP_01127115.1| hypothetical protein NB231_05716 [Nitrococcus mobilis Nb-231]
 gi|88790746|gb|EAR21860.1| hypothetical protein NB231_05716 [Nitrococcus mobilis Nb-231]
          Length = 79

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 47/75 (62%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MNP +I+++I+ G   + V   ++AGDG H+ A ++S +F G   +++H+MVY  L   +
Sbjct: 2  MNPQQIKQLIETGFTDAQV---EVAGDGRHFQALVVSPDFEGAPMLKRHRMVYALLQEHI 58

Query: 63 -GNALHALSIKTSVP 76
              LHA+S++T  P
Sbjct: 59 DSEVLHAISLRTLTP 73


>gi|123966434|ref|YP_001011515.1| BolA-like protein [Prochlorococcus marinus str. MIT 9515]
 gi|123200800|gb|ABM72408.1| BolA-like protein [Prochlorococcus marinus str. MIT 9515]
          Length = 76

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 49/73 (67%), Gaps = 2/73 (2%)

Query: 6  HEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN- 64
          +E+  +IK+ I  S V + +L G+ +H    +IS EF G + ++QHQ+VY +L  ++ + 
Sbjct: 5  YEVINLIKQKISDSEVFVENLKGN-DHLQVTVISAEFNGLSLVKQHQLVYSALKEELASE 63

Query: 65 ALHALSIKTSVPD 77
          A+HAL++KT +P+
Sbjct: 64 AIHALALKTEIPN 76


>gi|55378098|ref|YP_135948.1| transcriptional regulator [Haloarcula marismortui ATCC 43049]
 gi|55230823|gb|AAV46242.1| putative transcriptional regulator [Haloarcula marismortui ATCC
          43049]
          Length = 80

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 45/76 (59%), Gaps = 2/76 (2%)

Query: 3  MNPHEIEKMIKKGIP--QSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+   + ++I++ +P  Q+ VT      D  HYA  ++S  F G++ + QHQ+V+D+LG+
Sbjct: 1  MDEDAVAELIEEALPEAQATVTTPRDPDDDKHYAVRVVSPVFEGESLVDQHQLVHDALGD 60

Query: 61 KMGNALHALSIKTSVP 76
           +   +HA+ + T  P
Sbjct: 61 HLTRDIHAIELTTLTP 76


>gi|33861666|ref|NP_893227.1| BolA-like protein [Prochlorococcus marinus subsp. pastoris str.
          CCMP1986]
 gi|33640034|emb|CAE19569.1| BolA-like protein [Prochlorococcus marinus subsp. pastoris str.
          CCMP1986]
          Length = 76

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 47/72 (65%), Gaps = 2/72 (2%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-A 65
          E+  +IK+ I  S V + +L GD +H    +IS EF G + ++QHQ+VY +L  ++ + A
Sbjct: 6  EVINLIKQKIVDSEVYVENLKGD-DHLQVTVISSEFNGLSLVKQHQLVYSALKEELASEA 64

Query: 66 LHALSIKTSVPD 77
          +HAL++KT  P+
Sbjct: 65 IHALALKTETPN 76


>gi|157413581|ref|YP_001484447.1| BolA-like protein [Prochlorococcus marinus str. MIT 9215]
 gi|157388156|gb|ABV50861.1| BolA-like protein [Prochlorococcus marinus str. MIT 9215]
          Length = 76

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 47/72 (65%), Gaps = 2/72 (2%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-A 65
          E+  +I K +P S V + +L G+ +H    +I+ EF G + ++QHQ+VY +L  ++ + A
Sbjct: 6  EVINLITKKLPSSQVFVENLKGN-DHLQVTVIASEFNGLSLVKQHQLVYSALKEELASEA 64

Query: 66 LHALSIKTSVPD 77
          +HAL++KT  P+
Sbjct: 65 IHALALKTETPN 76


>gi|332974596|gb|EGK11516.1| BolA family protein [Kingella kingae ATCC 23330]
          Length = 83

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 47/73 (64%), Gaps = 4/73 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P ++++MI++ +P   + +    GDG+H+ A+I+S  F GK R+ +H++V D L  ++
Sbjct: 2  LYPEQVKEMIEQVLPCEHLVVE---GDGHHFFAQIVSPAFEGKARLARHRLVKDGLAAQL 58

Query: 63 G-NALHALSIKTS 74
            N LHALSI  +
Sbjct: 59 ASNELHALSIAVA 71


>gi|183221292|ref|YP_001839288.1| putative BolA-like protein [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Paris)']
 gi|189911383|ref|YP_001962938.1| BolA family transcriptional regulator [Leptospira biflexa serovar
          Patoc strain 'Patoc 1 (Ames)']
 gi|167776059|gb|ABZ94360.1| Transcriptional regulator, BolA-family [Leptospira biflexa
          serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167779714|gb|ABZ98012.1| Putative BolA-like protein [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Paris)']
          Length = 74

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (60%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EI+K I++G+P   V I D   DG H  A +  + F GK  I+QH+MVY +L  ++
Sbjct: 1  MTIPEIQKKIEEGLPGCTVEILDPYRDGVHIKAVVTYQGFAGKGLIEQHRMVYATLKEEL 60

Query: 63 GNALHALSIKT 73
             +HAL+++T
Sbjct: 61 KEEIHALALET 71


>gi|117923670|ref|YP_864287.1| BolA family protein [Magnetococcus sp. MC-1]
 gi|117607426|gb|ABK42881.1| transcriptional regulator, BolA protein family [Magnetococcus sp.
          MC-1]
          Length = 80

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRG-KNRIQQHQMVYDSLGNK 61
          M    ++ +I+ G+  S   IH + GDG H+ A I+S EF      +QQHQ VY  LG  
Sbjct: 1  MEVENVKALIEAGL--SCDYIH-VDGDGRHFEATIVSPEFCADAGMVQQHQRVYRVLGEH 57

Query: 62 MGNALHALSIKTSVPD 77
          M  A+HALS+KT  P+
Sbjct: 58 MKEAIHALSLKTYTPE 73


>gi|118594035|ref|ZP_01551382.1| BolA-like protein [Methylophilales bacterium HTCC2181]
 gi|118439813|gb|EAV46440.1| BolA-like protein [Methylophilales bacterium HTCC2181]
          Length = 84

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 2/66 (3%)

Query: 8  IEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALH 67
          I+ +I+K +  + + I     DG+H+ A I+S+ F G  ++ QHQ VYD+L   M   LH
Sbjct: 7  IKAVIQKNMECNFIEIK--GDDGSHFEATIVSDIFEGLTKVMQHQKVYDALDGMMKQELH 64

Query: 68 ALSIKT 73
          ALSIKT
Sbjct: 65 ALSIKT 70


>gi|76802525|ref|YP_327533.1| morphology/transcription regulator BolA family protein
          [Natronomonas pharaonis DSM 2160]
 gi|76558390|emb|CAI49981.1| probable BolA-like protein [Natronomonas pharaonis DSM 2160]
          Length = 77

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 2/77 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAG--DGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M P ++E  I+  +     T+    G  D +H  A ++S  F   + + QHQ+VYD+LG 
Sbjct: 1  MTPEDVEAEIEAALEDCEATVSRARGKHDDDHLEATVVSPAFEELSLVDQHQLVYDALGE 60

Query: 61 KMGNALHALSIKTSVPD 77
           M   +HAL + T  P+
Sbjct: 61 AMTTDIHALELTTRTPE 77


>gi|225023404|ref|ZP_03712596.1| hypothetical protein EIKCOROL_00262 [Eikenella corrodens ATCC
          23834]
 gi|224943882|gb|EEG25091.1| hypothetical protein EIKCOROL_00262 [Eikenella corrodens ATCC
          23834]
          Length = 83

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 48/78 (61%), Gaps = 4/78 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P +++ MI + I   ++ +    GDG+H+ A I+S +F GK R+ +H+++ D L +++
Sbjct: 2  LTPEQVQAMIGEVINAEMIQVE---GDGHHFFAAIVSADFEGKPRLARHRLIKDGLADRL 58

Query: 63 G-NALHALSIKTSVPDSQ 79
            N LHALSI  +   ++
Sbjct: 59 ASNELHALSISVAATPAE 76


>gi|325267782|ref|ZP_08134432.1| BolA family protein [Kingella denitrificans ATCC 33394]
 gi|324980663|gb|EGC16325.1| BolA family protein [Kingella denitrificans ATCC 33394]
          Length = 83

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 47/76 (61%), Gaps = 4/76 (5%)

Query: 5  PHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG- 63
          P ++++MI + +P   + +    GDG+H+ A+I+S  F GK R+ +H++V D L  ++  
Sbjct: 4  PEQVKEMIAQVLPCEHLEVE---GDGHHFFAQIVSSAFEGKARLARHRLVKDGLAAQLAS 60

Query: 64 NALHALSIKTSVPDSQ 79
          N LHALSI  +   ++
Sbjct: 61 NELHALSISVAATPAE 76


>gi|303283744|ref|XP_003061163.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226457514|gb|EEH54813.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 85

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 48/70 (68%), Gaps = 2/70 (2%)

Query: 6  HEIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN 64
           ++E +++  +    V + D++GD G  +  E++S++F+GK  I +H++++D+L N+M +
Sbjct: 5  QQVEDLLRAALEAETVKVTDISGDCGESFEVEVVSKQFQGKLPIARHRLIHDALKNEMAS 64

Query: 65 ALHALSIKTS 74
           +HALSIK S
Sbjct: 65 -IHALSIKKS 73


>gi|258546133|ref|ZP_05706367.1| undecaprenyl-phosphate galactosephosphotransferase
          [Cardiobacterium hominis ATCC 15826]
 gi|258518558|gb|EEV87417.1| undecaprenyl-phosphate galactosephosphotransferase
          [Cardiobacterium hominis ATCC 15826]
          Length = 74

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 46/75 (61%), Gaps = 3/75 (4%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M    I   IK  +P + +T+     DG HY+A I S  F GK+R++QH+ V ++LG+ +
Sbjct: 1  MQEELITSRIKAVLPDAEITLTTF--DGVHYSAHIRSAGFAGKSRLEQHRTVMNALGDIL 58

Query: 63 G-NALHALSIKTSVP 76
          G N +HAL++KT V 
Sbjct: 59 GSNEIHALALKTEVA 73


>gi|34495894|ref|NP_900109.1| hypothetical protein CV_0439 [Chromobacterium violaceum ATCC
          12472]
 gi|34101749|gb|AAQ58117.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
          12472]
          Length = 81

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 47/77 (61%), Gaps = 5/77 (6%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P ++++ I+ G+     T  ++ GDG+H+ A ++S  F GK  I +H+MV + +  ++
Sbjct: 1  MTPEQVKQYIEAGLD---CTFLNVEGDGHHFYATVVSAAFEGKRLIDRHRMVKEVIATRL 57

Query: 63 G-NALHALSI-KTSVPD 77
            N +HALSI K + PD
Sbjct: 58 ASNEIHALSIVKAATPD 74


>gi|308799623|ref|XP_003074592.1| BolA (ISS) [Ostreococcus tauri]
 gi|116000763|emb|CAL50443.1| BolA (ISS) [Ostreococcus tauri]
          Length = 366

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 32/45 (71%)

Query: 32  HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+  EI+S+ F GK ++ +H+M+YD+L  +M N +HAL +KT  P
Sbjct: 316 HFRVEIVSDAFEGKRQVMRHRMIYDALSEEMDNPIHALQLKTKTP 360


>gi|299066761|emb|CBJ37955.1| Putative transcription regulator, bolA [Ralstonia solanacearum
          CMR15]
          Length = 90

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 49/87 (56%), Gaps = 10/87 (11%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHD----------LAGDGNHYAAEIISEEFRGKNRIQQ 50
          M+ +P EIE+++++    + + + D           A  G HY  +I+S  F GK+R+ +
Sbjct: 1  MAADPREIERLLREAFQPTHLVVEDDSAKHAGHAGAASGGGHYNVDIVSAAFAGKSRVAR 60

Query: 51 HQMVYDSLGNKMGNALHALSIKTSVPD 77
          H+MVYD+L      A+HAL+I+   P+
Sbjct: 61 HRMVYDALRTLWPAAIHALAIRAVTPE 87


>gi|121998894|ref|YP_001003681.1| BolA family protein [Halorhodospira halophila SL1]
 gi|121590299|gb|ABM62879.1| transcriptional regulator, BolA protein family [Halorhodospira
          halophila SL1]
          Length = 83

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 49/75 (65%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P EIE++++  +  + V +   +GDG H+ A I+S +F+G +RI++H++V  +L   +
Sbjct: 2  MQPQEIERLVQDQLSDARVEV---SGDGRHFRAFIVSPDFQGLSRIERHRLVNRALRAHI 58

Query: 63 -GNALHALSIKTSVP 76
            + LHA+S++T  P
Sbjct: 59 DDDTLHAISMRTLTP 73


>gi|42524292|ref|NP_969672.1| hypothetical protein Bd2886 [Bdellovibrio bacteriovorus HD100]
 gi|39576501|emb|CAE80665.1| hypothetical protein predicted by Glimmer/Critica [Bdellovibrio
          bacteriovorus HD100]
          Length = 76

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (56%), Gaps = 1/74 (1%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   ++++ ++K  PQS + + DL G  +H+   + S  F G  RIQQHQ V    G ++
Sbjct: 1  MTAEQMKERLEKHYPQSTIEVFDLTGTQDHWEVFVESTVFAGMTRIQQHQNVMACFGPEL 60

Query: 63 GNA-LHALSIKTSV 75
              +HALSIKT +
Sbjct: 61 KTGEVHALSIKTKI 74


>gi|78779504|ref|YP_397616.1| BolA-like protein [Prochlorococcus marinus str. MIT 9312]
 gi|78713003|gb|ABB50180.1| BolA-like protein [Prochlorococcus marinus str. MIT 9312]
          Length = 76

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 47/72 (65%), Gaps = 2/72 (2%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-A 65
          E+  +I K +P S V + +L G+ +H    +I+ +F G + ++QHQ+VY +L  ++ + A
Sbjct: 6  EVINLITKKLPSSQVFVENLKGN-DHLQVTVIATQFNGLSLVKQHQLVYSALKEELASEA 64

Query: 66 LHALSIKTSVPD 77
          +HAL++KT  P+
Sbjct: 65 IHALALKTETPN 76


>gi|301167504|emb|CBW27087.1| BolA-like protein [Bacteriovorax marinus SJ]
          Length = 84

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 42/71 (59%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MN  E++ +I+  I  + V + DL G  +H    ++S+ F+GK  I QHQ++ D L  K+
Sbjct: 1  MNFEELKALIQSHIEDAKVQVTDLTGTQDHLGLLVVSDVFKGKMLIAQHQIIMDILKEKL 60

Query: 63 GNALHALSIKT 73
             +HA+ IKT
Sbjct: 61 KQEIHAVQIKT 71


>gi|86605275|ref|YP_474038.1| BolA protein [Synechococcus sp. JA-3-3Ab]
 gi|86553817|gb|ABC98775.1| BolA protein [Synechococcus sp. JA-3-3Ab]
          Length = 93

 Score = 53.5 bits (127), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 35/50 (70%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G G HY  +++S  F GK  +Q+H++VY +L  +MG ++HAL+++T  P+
Sbjct: 38 GSGGHYRVQVVSPLFAGKTSLQRHRLVYAALAEEMGQSIHALALQTYSPE 87


>gi|226531790|ref|NP_001149091.1| transcription regulator [Zea mays]
 gi|195624678|gb|ACG34169.1| transcription regulator [Zea mays]
          Length = 164

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 2   SMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNK 61
           S+    +E  IK+ +    VT+ D +GDG H   ++IS+ F GK+ + + +MVY ++  +
Sbjct: 82  SLATKALEAKIKEQLEADTVTVVDTSGDGRHVCIDVISKAFEGKSAVNRQRMVYKAIWEE 141

Query: 62  MGNALHALS-IKTSVPD 77
           + + +HA+  + T  PD
Sbjct: 142 LQSTVHAVDQMTTKTPD 158


>gi|254525424|ref|ZP_05137476.1| BolA family protein [Prochlorococcus marinus str. MIT 9202]
 gi|221536848|gb|EEE39301.1| BolA family protein [Prochlorococcus marinus str. MIT 9202]
          Length = 76

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 46/72 (63%), Gaps = 2/72 (2%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-A 65
          E+  +I K +P S V + +L G  +H    +I+ EF G + ++QH++VY +L  ++ + A
Sbjct: 6  EVINLITKKLPSSQVFVENLKG-SDHLQVTVIASEFNGLSLVKQHKLVYSALKEELASEA 64

Query: 66 LHALSIKTSVPD 77
          +HAL++KT  P+
Sbjct: 65 IHALALKTETPN 76


>gi|300691435|ref|YP_003752430.1| transcription regulator, bolA [Ralstonia solanacearum PSI07]
 gi|299078495|emb|CBJ51148.1| Putative transcription regulator, bolA [Ralstonia solanacearum
          PSI07]
          Length = 90

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 49/87 (56%), Gaps = 10/87 (11%)

Query: 1  MSMNPHEIEKMIKKGI-PQSIVTIHD---------LAGDGNHYAAEIISEEFRGKNRIQQ 50
          M+ +P EIE+++++   P  +V   D          A  G HY  +I+S  F GK+R+ +
Sbjct: 1  MAADPREIERLLREAFQPLHLVVEDDSAKHAGHAGAASGGGHYNVDIVSAAFAGKSRVAR 60

Query: 51 HQMVYDSLGNKMGNALHALSIKTSVPD 77
          H+MVYD+L      A+HAL+I+   P+
Sbjct: 61 HRMVYDALRTLWPAAIHALAIRAVTPE 87


>gi|329120326|ref|ZP_08248994.1| BolA family protein [Neisseria bacilliformis ATCC BAA-1200]
 gi|327462667|gb|EGF08990.1| BolA family protein [Neisseria bacilliformis ATCC BAA-1200]
          Length = 136

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 5   PHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG- 63
           P +++++I   +P   + +    GDG+H+ A I+S  F GK R+ +H+++ D L  K+  
Sbjct: 58  PEQVKELIAAVVPCEHIEVE---GDGHHFFAVIVSSAFEGKARLARHRLIKDGLAEKLAS 114

Query: 64  NALHALSIKTSVPDSQ 79
           N LHALS+  +   ++
Sbjct: 115 NELHALSVSVAATPAE 130


>gi|259490613|ref|NP_001158907.1| hypothetical protein LOC100303801 [Zea mays]
 gi|194702996|gb|ACF85582.1| unknown [Zea mays]
 gi|195623080|gb|ACG33370.1| transcription regulator [Zea mays]
          Length = 164

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 2   SMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNK 61
           S+    +E  IK+ +    VT+ D +GDG H   ++IS+ F GK+ + + +MVY ++  +
Sbjct: 82  SLATKALEAKIKEQLEADTVTVVDTSGDGRHVCIDVISKAFEGKSAVNRQRMVYKAIWEE 141

Query: 62  MGNALHALS-IKTSVPD 77
           + + +HA+  + T  PD
Sbjct: 142 LQSTVHAVDQMTTKTPD 158


>gi|145352634|ref|XP_001420644.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144580879|gb|ABO98937.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 77

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 50/73 (68%), Gaps = 3/73 (4%)

Query: 4  NPHEIEKMIKKGI-PQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNK 61
          +  E+ +++++   P + + + D++G+ G+ +   ++SE FR K+RI+ H+ ++D+LG+ 
Sbjct: 3  STREVRELLERAFAPCAELDVVDVSGECGSAFEVRVVSESFRDKSRIESHRAIHDALGSV 62

Query: 62 MGNALHALSIKTS 74
          MG  +HALS+K +
Sbjct: 63 MGK-IHALSVKVA 74


>gi|153872833|ref|ZP_02001611.1| BolA-like protein [Beggiatoa sp. PS]
 gi|152070702|gb|EDN68390.1| BolA-like protein [Beggiatoa sp. PS]
          Length = 91

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 32/48 (66%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G H+   I+SE+F  K  +Q+H+MVY ++ + M  A+HALSI+   PD
Sbjct: 40 GGHFVVTIVSEQFTEKTLVQRHRMVYSAIDDLMKTAIHALSIQAQTPD 87


>gi|294670523|ref|ZP_06735403.1| hypothetical protein NEIELOOT_02245 [Neisseria elongata subsp.
          glycolytica ATCC 29315]
 gi|291307802|gb|EFE49045.1| hypothetical protein NEIELOOT_02245 [Neisseria elongata subsp.
          glycolytica ATCC 29315]
          Length = 81

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 46/78 (58%), Gaps = 4/78 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P +++++I   +P   + +    GDG+H+ A I+S  F GK R+ +H+++ D L  K+
Sbjct: 2  LLPEQVKELIAAIVPCEHIEVE---GDGHHFFAVIVSSAFEGKARLARHRLIKDGLAEKL 58

Query: 63 G-NALHALSIKTSVPDSQ 79
            N LHALS+  +   ++
Sbjct: 59 ASNELHALSVSVAATPAE 76


>gi|332289503|ref|YP_004420355.1| transcriptional regulator BolA [Gallibacterium anatis UMN179]
 gi|330432399|gb|AEC17458.1| transcriptional regulator BolA [Gallibacterium anatis UMN179]
          Length = 84

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 46/76 (60%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+P EIE+++K+ +    V +    G+  HY    +S++F   +R++Q QM+Y  L + +
Sbjct: 1  MDPKEIEQLLKQALDLDEVYVR---GENAHYDVIAVSDKFADLSRVKQQQMIYAPLMDHL 57

Query: 63 G-NALHALSIKTSVPD 77
            NA+HAL+IKT   D
Sbjct: 58 ASNAIHALTIKTFTVD 73


>gi|56479152|ref|YP_160741.1| stress-induced morphogen BolA [Aromatoleum aromaticum EbN1]
 gi|56315195|emb|CAI09840.1| Stress-induced morphogen BolA [Aromatoleum aromaticum EbN1]
          Length = 87

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 33/48 (68%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G HY   I++E F+GKN + +H++VYD+LG+ M   +HAL+++    D
Sbjct: 38 GGHYRLTIVAECFQGKNTVARHRLVYDALGDLMRTRVHALAVRALTAD 85


>gi|224825283|ref|ZP_03698388.1| BolA family protein [Lutiella nitroferrum 2002]
 gi|224602204|gb|EEG08382.1| BolA family protein [Lutiella nitroferrum 2002]
          Length = 89

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 33/48 (68%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G HY   I+S  F G +R+++HQMVY++LG+ M   +HAL+IK   P+
Sbjct: 40 GGHYNLTIVSPCFAGLSRVKRHQMVYEALGDLMKTGIHALAIKAFAPN 87


>gi|207743080|ref|YP_002259472.1| hypothetical protein RSIPO_01247 [Ralstonia solanacearum IPO1609]
 gi|206594477|emb|CAQ61404.1| hypothetical protein RSIPO_01247 [Ralstonia solanacearum IPO1609]
          Length = 90

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 48/87 (55%), Gaps = 10/87 (11%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHD----------LAGDGNHYAAEIISEEFRGKNRIQQ 50
          M+ +P EIE+++++      + + D           A  G HY  +I+S  F GK+R+ +
Sbjct: 1  MAADPREIERLLREAFQPVHLAVEDDSAKHAGHAGAASGGGHYNVDIVSAAFAGKSRVAR 60

Query: 51 HQMVYDSLGNKMGNALHALSIKTSVPD 77
          H+MVYD+L      A+HAL+I+   P+
Sbjct: 61 HRMVYDALRALWPAAIHALAIRAVTPE 87


>gi|58584932|ref|YP_198505.1| stress-induced morphogen, BolA [Wolbachia endosymbiont strain TRS
          of Brugia malayi]
 gi|58419248|gb|AAW71263.1| Stress-induced morphogen, BolA [Wolbachia endosymbiont strain TRS
          of Brugia malayi]
          Length = 72

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 48/74 (64%), Gaps = 3/74 (4%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M +  HE+ ++I++    + + I+DLAGD +HY  +I S+ F  K +I+Q+++ Y +L  
Sbjct: 1  MVIVIHELGEIIRQLFSDADIKINDLAGDDSHYYLKITSKHFLEKTKIEQYRIAYKALE- 59

Query: 61 KMGNALHALSIKTS 74
            G ++HAL ++TS
Sbjct: 60 --GQSIHALQLETS 71


>gi|66803973|ref|XP_635799.1| bolA family protein [Dictyostelium discoideum AX4]
 gi|60464125|gb|EAL62286.1| bolA family protein [Dictyostelium discoideum AX4]
          Length = 151

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           G   H+   I+S+ F GK+ + QH+++ D+L N+M N +HALSI  S PD
Sbjct: 72  GSETHFKVIIVSDIFNGKSVVAQHRLINDTLKNEMKNGVHALSIHCSTPD 121


>gi|168028398|ref|XP_001766715.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162682147|gb|EDQ68568.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 172

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 42/66 (63%), Gaps = 1/66 (1%)

Query: 12  IKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALS- 70
           IK  +    V++ D  GDG H + ++++E F G++R+ + +MVY ++  ++ NA+HA+  
Sbjct: 97  IKDSLKAEEVSVVDAYGDGRHVSIDVVAEAFEGQSRVSRQRMVYKAIWEELQNAVHAVDQ 156

Query: 71  IKTSVP 76
           ++T  P
Sbjct: 157 LRTRTP 162


>gi|328868726|gb|EGG17104.1| hypothetical protein DFA_08086 [Dictyostelium fasciculatum]
          Length = 940

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 35/51 (68%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDS 78
           G   H+   ++SE F+GK+ IQQH+MV + L  ++   +HALSIKT+ P+S
Sbjct: 70  GSETHFKVIVVSELFKGKSMIQQHRMVNELLSEELKGGVHALSIKTATPES 120


>gi|302760569|ref|XP_002963707.1| hypothetical protein SELMODRAFT_405066 [Selaginella moellendorffii]
 gi|300168975|gb|EFJ35578.1| hypothetical protein SELMODRAFT_405066 [Selaginella moellendorffii]
          Length = 160

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 39/57 (68%), Gaps = 1/57 (1%)

Query: 21  VTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHAL-SIKTSVP 76
           VT+ D  GDG H + E+++E F G++++ + +MVY ++  ++ NA+HA+  +KT  P
Sbjct: 99  VTVKDAYGDGRHVSIEVVAEVFEGQSQVNRQRMVYKAIWEELQNAVHAVDQLKTKTP 155


>gi|17546464|ref|NP_519866.1| hypothetical protein RSc1745 [Ralstonia solanacearum GMI1000]
 gi|17428762|emb|CAD15447.1| putative transcription regulator protein [Ralstonia solanacearum
          GMI1000]
          Length = 94

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 47/91 (51%), Gaps = 14/91 (15%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNH--------------YAAEIISEEFRGKN 46
          M+ NP E+ + I++ + ++   IH    D +               Y  +I+S  F GK+
Sbjct: 1  MAANPGEMRREIERLLREAFQPIHLAVEDDSARHAGHAGAASGGGHYNVDIVSAAFAGKS 60

Query: 47 RIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          R+ +H+MVYD+L      A+HAL+I+   P+
Sbjct: 61 RVARHRMVYDALRTLWPAAIHALAIRAVTPE 91


>gi|302786052|ref|XP_002974797.1| hypothetical protein SELMODRAFT_414907 [Selaginella moellendorffii]
 gi|300157692|gb|EFJ24317.1| hypothetical protein SELMODRAFT_414907 [Selaginella moellendorffii]
          Length = 160

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 39/57 (68%), Gaps = 1/57 (1%)

Query: 21  VTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHAL-SIKTSVP 76
           VT+ D  GDG H + E+++E F G++++ + +MVY ++  ++ NA+HA+  +KT  P
Sbjct: 99  VTVKDAYGDGRHVSIEVVAEVFEGQSQVNRQRMVYKAIWEELQNAVHAVDQLKTKTP 155


>gi|124266955|ref|YP_001020959.1| BolA-like protein [Methylibium petroleiphilum PM1]
 gi|124259730|gb|ABM94724.1| BolA-like protein [Methylibium petroleiphilum PM1]
          Length = 105

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 45/79 (56%), Gaps = 9/79 (11%)

Query: 7  EIEKMIKKGI-PQSIVTIHDL--------AGDGNHYAAEIISEEFRGKNRIQQHQMVYDS 57
          E+E  ++  + PQS+    D         A +G HY+  ++SE F G +R+ +H++VYD+
Sbjct: 19 ELEAALRDALAPQSLHVSDDSHQHAGHAGAREGGHYSVHLVSERFDGLSRLARHRLVYDA 78

Query: 58 LGNKMGNALHALSIKTSVP 76
          + + M   +HAL++ T  P
Sbjct: 79 VASWMPRGIHALALTTLTP 97


>gi|257092248|ref|YP_003165889.1| BolA family protein [Candidatus Accumulibacter phosphatis clade
          IIA str. UW-1]
 gi|257044772|gb|ACV33960.1| BolA family protein [Candidatus Accumulibacter phosphatis clade
          IIA str. UW-1]
          Length = 81

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSL-GNK 61
          M P ++  +I  G+P   + +    GDG H+ A I+S EF G +R+Q+ Q V   L G+ 
Sbjct: 2  MQPEQLHTIIAAGLPCEHLQV---IGDGQHFEALIVSAEFIGMSRVQRQQRVNAVLRGHF 58

Query: 62 MGNALHALSIKTSVPD 77
              LHALS+KT  P+
Sbjct: 59 NSGELHALSMKTQTPE 74


>gi|292492348|ref|YP_003527787.1| BolA family protein [Nitrosococcus halophilus Nc4]
 gi|291580943|gb|ADE15400.1| BolA family protein [Nitrosococcus halophilus Nc4]
          Length = 93

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 31/44 (70%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          Y   I++E F GK+RI++H++VY ++   MGN +HALSIK   P
Sbjct: 44 YQVTIVAEAFAGKSRIERHRLVYGAVDEAMGNEIHALSIKAYTP 87


>gi|242095796|ref|XP_002438388.1| hypothetical protein SORBIDRAFT_10g015890 [Sorghum bicolor]
 gi|241916611|gb|EER89755.1| hypothetical protein SORBIDRAFT_10g015890 [Sorghum bicolor]
          Length = 163

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 8   IEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALH 67
           +E  IK+ +    VT+ D +GDG H   +++S+ F GK+ + + +MVY ++  ++ + +H
Sbjct: 88  LEAKIKEQLQADTVTVVDTSGDGRHVCIDVVSKVFEGKSAVNRQRMVYKAIWEELQSTVH 147

Query: 68  ALS-IKTSVPD 77
           A+  + T  PD
Sbjct: 148 AVDQMTTKTPD 158


>gi|156351327|ref|XP_001622461.1| predicted protein [Nematostella vectensis]
 gi|156209008|gb|EDO30361.1| predicted protein [Nematostella vectensis]
          Length = 85

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          +E+ +KK    S V + DL+ G G    A I+SE+F+GK  +Q+H+MVY  L  +M   +
Sbjct: 8  VEEKLKKEFEASHVEVKDLSDGCGAKIEAVIVSEKFQGKPLLQRHKMVYGCLEEEM-KTI 66

Query: 67 HALSIKTSVPD 77
          HA S KT  P+
Sbjct: 67 HAFSQKTYTPE 77


>gi|238612140|ref|XP_002398141.1| hypothetical protein MPER_01311 [Moniliophthora perniciosa FA553]
 gi|215474071|gb|EEB99071.1| hypothetical protein MPER_01311 [Moniliophthora perniciosa FA553]
          Length = 102

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 31/46 (67%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H++  ++SE F GK  IQ+H+M+YD L  ++   LH+LS+KT  P
Sbjct: 45 THFSINVVSEAFEGKTTIQRHRMIYDILVEELQQGLHSLSLKTKTP 90


>gi|34498386|ref|NP_902601.1| hypothetical protein CV_2931 [Chromobacterium violaceum ATCC
          12472]
 gi|34104240|gb|AAQ60599.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
          12472]
          Length = 88

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 30/48 (62%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G HY   I+S  F G NR+ +H+++Y +LG  M   +HAL+I+   P+
Sbjct: 39 GGHYTLTIVSARFAGLNRVARHRLIYQTLGEMMSGRVHALAIRALTPE 86


>gi|114321367|ref|YP_743050.1| BolA family protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227761|gb|ABI57560.1| transcriptional regulator, BolA protein family [Alkalilimnicola
          ehrlichii MLHE-1]
          Length = 81

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P E+E++I  G+    +++   AGDG H+ A I+S EF  K+ +Q+ ++V   L    
Sbjct: 2  MEPSEVERLITDGLQVENISV---AGDGQHFEARIVSPEFADKSPLQRQRLVNAVLKEHF 58

Query: 63 GNA-LHALSIKTSVPD 77
           +  LHAL+++T  P+
Sbjct: 59 DSGRLHALAMQTLTPE 74


>gi|297807777|ref|XP_002871772.1| hypothetical protein ARALYDRAFT_909754 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297317609|gb|EFH48031.1| hypothetical protein ARALYDRAFT_909754 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 174

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 39/64 (60%)

Query: 6   HEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
             +E+ IK+ +    VT+ D++GDG H    ++S  F G++ + + +MVY ++  ++ N 
Sbjct: 100 QSMEQKIKEQLNAESVTVTDMSGDGRHVCINVVSSAFEGQSAVNRQRMVYKAIWEELQNV 159

Query: 66  LHAL 69
           +HA+
Sbjct: 160 VHAV 163


>gi|83859708|ref|ZP_00953228.1| BolA-like protein [Oceanicaulis alexandrii HTCC2633]
 gi|83852067|gb|EAP89921.1| BolA-like protein [Oceanicaulis alexandrii HTCC2633]
          Length = 91

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 45/87 (51%), Gaps = 11/87 (12%)

Query: 1  MSMNPHEIEKMIKKGI-PQSIVTIHDLA----------GDGNHYAAEIISEEFRGKNRIQ 49
          MS    +IE  +   + PQS+V   D A             +H+  EI+S  F G+ R+Q
Sbjct: 1  MSSVKQQIEDRLTAALSPQSLVITDDSALHAGHSEQAKAGESHFTVEIVSSAFEGQARVQ 60

Query: 50 QHQMVYDSLGNKMGNALHALSIKTSVP 76
          +H++V  +LG+ +   +HAL+IK   P
Sbjct: 61 RHRLVNQALGDLLKAQVHALAIKAKAP 87


>gi|300704056|ref|YP_003745658.1| transcriptional regulator BolA [Ralstonia solanacearum CFBP2957]
 gi|299071719|emb|CBJ43043.1| Putative transcription regulator, bolA [Ralstonia solanacearum
          CFBP2957]
          Length = 94

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 45/83 (54%), Gaps = 10/83 (12%)

Query: 5  PHEIEKMIKKGIPQSIVTIHD----------LAGDGNHYAAEIISEEFRGKNRIQQHQMV 54
          P EIE+++++      + + D           A  G HY  +I+S  F GK+R+ +H+MV
Sbjct: 9  PREIERLLREAFQPVHLAVEDDSARHAGHAGAASGGGHYNVDIVSAAFAGKSRVARHRMV 68

Query: 55 YDSLGNKMGNALHALSIKTSVPD 77
          YD+L      A+HAL+I+   P+
Sbjct: 69 YDALRTLWPAAIHALAIRAVTPE 91


>gi|114768951|ref|ZP_01446577.1| BolA-like protein [alpha proteobacterium HTCC2255]
 gi|114549868|gb|EAU52749.1| BolA-like protein [alpha proteobacterium HTCC2255]
          Length = 79

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 5/80 (6%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M++    IE +I++  P + V++     DG H +A + S +F GK+ I QH+MV+ +L  
Sbjct: 1  MAIEASVIENLIREAFPDADVSVD--GADGVHMSAIVSSSQFAGKSMINQHRMVFSALKG 58

Query: 61 KM---GNALHALSIKTSVPD 77
          KM      LHAL++ T + +
Sbjct: 59 KMDGPNGELHALALTTKIKE 78


>gi|301381348|ref|ZP_07229766.1| bolA protein [Pseudomonas syringae pv. tomato Max13]
 gi|302060226|ref|ZP_07251767.1| bolA protein [Pseudomonas syringae pv. tomato K40]
 gi|302130015|ref|ZP_07256005.1| bolA protein [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|330877053|gb|EGH11202.1| bolA protein [Pseudomonas syringae pv. morsprunorum str.
          M302280PT]
 gi|330964785|gb|EGH65045.1| bolA protein [Pseudomonas syringae pv. actinidiae str. M302091]
 gi|331016829|gb|EGH96885.1| bolA protein [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 97

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   HY A ++S++F+G N +++HQ VY +LG  MG   HAL++ T  PD
Sbjct: 31 GQQTHYKAVLVSDQFQGLNSVKRHQKVYATLGALMGE-FHALALHTYTPD 79


>gi|28868939|ref|NP_791558.1| bolA protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213968732|ref|ZP_03396874.1| bolA protein [Pseudomonas syringae pv. tomato T1]
 gi|28852179|gb|AAO55253.1| bolA protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213926665|gb|EEB60218.1| bolA protein [Pseudomonas syringae pv. tomato T1]
          Length = 95

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   HY A ++S++F+G N +++HQ VY +LG  MG   HAL++ T  PD
Sbjct: 29 GQQTHYKAVLVSDQFQGLNSVKRHQKVYATLGALMGE-FHALALHTYTPD 77


>gi|241997846|ref|XP_002433566.1| BolA protein, putative [Ixodes scapularis]
 gi|215495325|gb|EEC04966.1| BolA protein, putative [Ixodes scapularis]
          Length = 139

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 32/49 (65%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           G   H+   ++S  F GK+ +QQH +VY ++  ++ N +HAL+I+TS P
Sbjct: 66  GSETHFRVTVVSASFEGKSLVQQHALVYGAVKEELQNPVHALAIETSTP 114


>gi|196012604|ref|XP_002116164.1| hypothetical protein TRIADDRAFT_60160 [Trichoplax adhaerens]
 gi|190581119|gb|EDV21197.1| hypothetical protein TRIADDRAFT_60160 [Trichoplax adhaerens]
          Length = 117

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 46/70 (65%), Gaps = 2/70 (2%)

Query: 8   IEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
           I  ++K  +  S + + D++G  G+ Y   I S+ F+GK+ IQQH+MV ++L  ++ N +
Sbjct: 48  ISSILKDTVNPSYLEVRDISGGCGSMYEILIQSDNFKGKSIIQQHRMVKEALAEEIKN-M 106

Query: 67  HALSIKTSVP 76
           H L+I+TSVP
Sbjct: 107 HGLTIRTSVP 116


>gi|325127264|gb|EGC50202.1| BolA family protein [Neisseria meningitidis N1568]
          Length = 82

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 48/78 (61%), Gaps = 4/78 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P +++ MI+ G+ +      ++ GDG+H+ A I+S EF GK R+ +H+++ D L  ++
Sbjct: 2  LTPEQVKAMIE-GVAKCEHI--EVEGDGHHFFAVIVSSEFEGKARLARHRLIKDGLKAQL 58

Query: 63 -GNALHALSIKTSVPDSQ 79
            N LHALSI  +   ++
Sbjct: 59 ESNELHALSISVAATPAE 76


>gi|238026988|ref|YP_002911219.1| BolA family protein [Burkholderia glumae BGR1]
 gi|237876182|gb|ACR28515.1| BolA family protein [Burkholderia glumae BGR1]
          Length = 104

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 29/45 (64%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          Y   I+S  F GK+R+ +H++VYD+L + M   +HAL+I    PD
Sbjct: 53 YTVTIVSAAFAGKSRVARHRLVYDALADAMQRGIHALAIVAYTPD 97


>gi|325197315|gb|ADY92771.1| BolA family protein [Neisseria meningitidis G2136]
 gi|325203143|gb|ADY98596.1| BolA family protein [Neisseria meningitidis M01-240355]
          Length = 82

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (57%), Gaps = 4/78 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P +++ MI+       + +    GDG+H+ A I+S EF GK R+ +H+++ D L  ++
Sbjct: 2  LTPEQVKAMIEDVAKCEHIKVE---GDGHHFFAVIVSSEFEGKARLARHRLIKDGLKAQL 58

Query: 63 -GNALHALSIKTSVPDSQ 79
            N LHALSI  +   ++
Sbjct: 59 ESNELHALSISVAATPAE 76


>gi|269213926|ref|ZP_05983156.2| BolA family protein [Neisseria cinerea ATCC 14685]
 gi|269145142|gb|EEZ71560.1| BolA family protein [Neisseria cinerea ATCC 14685]
          Length = 92

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 48/78 (61%), Gaps = 4/78 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P +++ MI+ G+ +      ++ GDG+H+ A I+S EF GK R+ +H+++ D L  ++
Sbjct: 12 LTPEQVKAMIE-GVAKCEHI--EVEGDGHHFFAVIVSSEFEGKARLARHRLIKDGLKAQL 68

Query: 63 -GNALHALSIKTSVPDSQ 79
            N LHALSI  +   ++
Sbjct: 69 ESNELHALSISVAATPAE 86


>gi|221118197|ref|XP_002155631.1| PREDICTED: similar to bolA homolog 3 [Hydra magnipapillata]
          Length = 106

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 44/71 (61%), Gaps = 2/71 (2%)

Query: 7   EIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
           ++E +++K +    + + D++G  G+ Y   I + EFRGK  +QQH++V D L  ++ N 
Sbjct: 35  DLENILRKNLDVKEIEVQDISGGCGSMYQIFICANEFRGKRMVQQHRIVTDVLKEQVKN- 93

Query: 66  LHALSIKTSVP 76
           +H L I T+VP
Sbjct: 94  MHGLRITTAVP 104


>gi|296840688|ref|ZP_06863211.2| BolA family protein [Neisseria polysaccharea ATCC 43768]
 gi|296840242|gb|EFH24180.1| BolA family protein [Neisseria polysaccharea ATCC 43768]
          Length = 92

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 48/78 (61%), Gaps = 4/78 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P +++ MI+ G+ +      ++ GDG+H+ A I+S EF GK R+ +H+++ D L  ++
Sbjct: 12 LTPEQVKAMIE-GVAKCEHI--EVEGDGHHFFAVIVSSEFEGKARLARHRLIKDGLKAQL 68

Query: 63 -GNALHALSIKTSVPDSQ 79
            N LHALSI  +   ++
Sbjct: 69 ESNELHALSISVAATPAE 86


>gi|255068540|ref|ZP_05320395.1| BolA family protein [Neisseria sicca ATCC 29256]
 gi|288575970|ref|ZP_05977940.2| BolA family protein [Neisseria mucosa ATCC 25996]
 gi|255047215|gb|EET42679.1| BolA family protein [Neisseria sicca ATCC 29256]
 gi|288566663|gb|EFC88223.1| BolA family protein [Neisseria mucosa ATCC 25996]
          Length = 101

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 1/56 (1%)

Query: 25 DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVPDSQ 79
          ++ GDG+H+ A I+S EF GK R+ +H+++ D L  ++  N LHALSI  +   ++
Sbjct: 40 EVEGDGHHFFAVIVSSEFEGKARLARHRLIKDGLKAQLASNELHALSISVAATPAE 95


>gi|194099823|ref|YP_002002958.1| BolA/YrbA family protein [Neisseria gonorrhoeae NCCP11945]
 gi|218767278|ref|YP_002341790.1| hypothetical protein NMA0256 [Neisseria meningitidis Z2491]
 gi|239999995|ref|ZP_04719919.1| hypothetical protein Ngon3_11016 [Neisseria gonorrhoeae 35/02]
 gi|240013057|ref|ZP_04719970.1| hypothetical protein NgonD_00100 [Neisseria gonorrhoeae DGI18]
 gi|240017626|ref|ZP_04724166.1| hypothetical protein NgonFA_10771 [Neisseria gonorrhoeae FA6140]
 gi|240081893|ref|ZP_04726436.1| hypothetical protein NgonF_11386 [Neisseria gonorrhoeae FA19]
 gi|240114172|ref|ZP_04728662.1| hypothetical protein NgonM_11499 [Neisseria gonorrhoeae MS11]
 gi|240116810|ref|ZP_04730872.1| hypothetical protein NgonPID1_11331 [Neisseria gonorrhoeae PID18]
 gi|240119038|ref|ZP_04733100.1| hypothetical protein NgonPID_11372 [Neisseria gonorrhoeae PID1]
 gi|240122247|ref|ZP_04735209.1| hypothetical protein NgonPI_10885 [Neisseria gonorrhoeae PID24-1]
 gi|240122424|ref|ZP_04735380.1| hypothetical protein NgonP_00511 [Neisseria gonorrhoeae PID332]
 gi|240126727|ref|ZP_04739613.1| hypothetical protein NgonSK_11043 [Neisseria gonorrhoeae
          SK-92-679]
 gi|240127137|ref|ZP_04739798.1| hypothetical protein NgonS_00520 [Neisseria gonorrhoeae
          SK-93-1035]
 gi|254493436|ref|ZP_05106607.1| BolA/YrbA family protein [Neisseria gonorrhoeae 1291]
 gi|254804035|ref|YP_003082256.1| BolA-like protein [Neisseria meningitidis alpha14]
 gi|260441603|ref|ZP_05795419.1| BolA-like protein [Neisseria gonorrhoeae DGI2]
 gi|268595802|ref|ZP_06129969.1| BolA/YrbA family protein [Neisseria gonorrhoeae 35/02]
 gi|268597991|ref|ZP_06132158.1| BolA/YrbA family protein [Neisseria gonorrhoeae FA19]
 gi|268600246|ref|ZP_06134413.1| BolA/YrbA family protein [Neisseria gonorrhoeae MS11]
 gi|268602486|ref|ZP_06136653.1| BolA/YrbA family protein [Neisseria gonorrhoeae PID18]
 gi|268604754|ref|ZP_06138921.1| BolA/YrbA family protein [Neisseria gonorrhoeae PID1]
 gi|268681011|ref|ZP_06147873.1| BolA/YrbA family protein [Neisseria gonorrhoeae PID332]
 gi|268685307|ref|ZP_06152169.1| BolA/YrbA family protein [Neisseria gonorrhoeae SK-92-679]
 gi|268685493|ref|ZP_06152355.1| BolA/YrbA family protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291044974|ref|ZP_06570683.1| BolA/YrbA family protein [Neisseria gonorrhoeae DGI2]
 gi|293398044|ref|ZP_06642250.1| hypothetical protein NGNG_01047 [Neisseria gonorrhoeae F62]
 gi|121051286|emb|CAM07562.1| hypothetical protein NMA0256 [Neisseria meningitidis Z2491]
 gi|193935113|gb|ACF30937.1| BolA/YrbA family protein [Neisseria gonorrhoeae NCCP11945]
 gi|226512476|gb|EEH61821.1| BolA/YrbA family protein [Neisseria gonorrhoeae 1291]
 gi|254667577|emb|CBA03314.1| BolA-like protein [Neisseria meningitidis alpha14]
 gi|268549191|gb|EEZ44609.1| BolA/YrbA family protein [Neisseria gonorrhoeae 35/02]
 gi|268551779|gb|EEZ46798.1| BolA/YrbA family protein [Neisseria gonorrhoeae FA19]
 gi|268584377|gb|EEZ49053.1| BolA/YrbA family protein [Neisseria gonorrhoeae MS11]
 gi|268586617|gb|EEZ51293.1| BolA/YrbA family protein [Neisseria gonorrhoeae PID18]
 gi|268588885|gb|EEZ53561.1| BolA/YrbA family protein [Neisseria gonorrhoeae PID1]
 gi|268621295|gb|EEZ53695.1| BolA/YrbA family protein [Neisseria gonorrhoeae PID332]
 gi|268625591|gb|EEZ57991.1| BolA/YrbA family protein [Neisseria gonorrhoeae SK-92-679]
 gi|268625777|gb|EEZ58177.1| BolA/YrbA family protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291011868|gb|EFE03864.1| BolA/YrbA family protein [Neisseria gonorrhoeae DGI2]
 gi|291611990|gb|EFF41059.1| hypothetical protein NGNG_01047 [Neisseria gonorrhoeae F62]
 gi|317165292|gb|ADV08833.1| BolA/YrbA family protein [Neisseria gonorrhoeae TCDC-NG08107]
 gi|325205115|gb|ADZ00568.1| BolA family protein [Neisseria meningitidis M04-240196]
          Length = 82

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 1/56 (1%)

Query: 25 DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPDSQ 79
          ++ GDG+H+ A I+S EF GK R+ +H+++ D L  ++  N LHALSI  +   ++
Sbjct: 21 EVEGDGHHFFAVIVSSEFEGKARLARHRLIKDGLKAQLESNELHALSISVAATPAE 76


>gi|325129279|gb|EGC52118.1| BolA family protein [Neisseria meningitidis OX99.30304]
          Length = 82

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 1/56 (1%)

Query: 25 DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPDSQ 79
          ++ GDG+H+ A I+S EF GK R+ +H+++ D L  ++  N LHALSI  +   ++
Sbjct: 21 EVEGDGHHFFAVIVSSEFEGKARLARHRLIKDGLKAQLESNELHALSISVAATPAE 76


>gi|15675957|ref|NP_273075.1| BolA/YrbA family protein [Neisseria meningitidis MC58]
 gi|7225234|gb|AAF40488.1| BolA/YrbA family protein [Neisseria meningitidis MC58]
 gi|254671264|emb|CBA08555.1| BolA-like protein [Neisseria meningitidis alpha153]
 gi|254672606|emb|CBA06325.1| BolA-like protein [Neisseria meningitidis alpha275]
 gi|308388234|gb|ADO30554.1| BolA-like protein [Neisseria meningitidis alpha710]
 gi|316984535|gb|EFV63501.1| bolA-like family protein [Neisseria meningitidis H44/76]
 gi|325131253|gb|EGC53965.1| BolA family protein [Neisseria meningitidis M6190]
 gi|325133337|gb|EGC56003.1| BolA family protein [Neisseria meningitidis M13399]
 gi|325135391|gb|EGC58012.1| BolA family protein [Neisseria meningitidis M0579]
 gi|325137427|gb|EGC60015.1| BolA family protein [Neisseria meningitidis ES14902]
 gi|325139479|gb|EGC62019.1| BolA family protein [Neisseria meningitidis CU385]
 gi|325143404|gb|EGC65733.1| BolA family protein [Neisseria meningitidis 961-5945]
 gi|325143571|gb|EGC65892.1| BolA family protein [Neisseria meningitidis M01-240013]
 gi|325199244|gb|ADY94699.1| BolA family protein [Neisseria meningitidis H44/76]
 gi|325201206|gb|ADY96660.1| BolA family protein [Neisseria meningitidis M01-240149]
 gi|325207063|gb|ADZ02515.1| BolA family protein [Neisseria meningitidis NZ-05/33]
          Length = 82

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 1/56 (1%)

Query: 25 DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPDSQ 79
          ++ GDG+H+ A I+S EF GK R+ +H+++ D L  ++  N LHALSI  +   ++
Sbjct: 21 EVEGDGHHFFAVIVSSEFEGKARLARHRLIKDGLKAQLESNELHALSISVAATPAE 76


>gi|121635812|ref|YP_976057.1| hypothetical protein NMC2147 [Neisseria meningitidis FAM18]
 gi|120867518|emb|CAM11295.1| hypothetical protein NMC2147 [Neisseria meningitidis FAM18]
          Length = 92

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 1/56 (1%)

Query: 25 DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPDSQ 79
          ++ GDG+H+ A I+S EF GK R+ +H+++ D L  ++  N LHALSI  +   ++
Sbjct: 31 EVEGDGHHFFAVIVSSEFEGKARLARHRLIKDGLKAQLESNELHALSISVAATPAE 86


>gi|304388807|ref|ZP_07370863.1| BolA family protein [Neisseria meningitidis ATCC 13091]
 gi|304337259|gb|EFM03437.1| BolA family protein [Neisseria meningitidis ATCC 13091]
          Length = 92

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (57%), Gaps = 4/78 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          + P +++ MI+       + +    GDG+H+ A I+S EF GK R+ +H+++ D L  ++
Sbjct: 12 LTPEQVKAMIEDVAKCEHIKVE---GDGHHFFAVIVSSEFEGKARLARHRLIKDGLKAQL 68

Query: 63 -GNALHALSIKTSVPDSQ 79
            N LHALSI  +   ++
Sbjct: 69 ESNELHALSISVAATPAE 86


>gi|261391568|emb|CAX49001.1| putative BolA-like protein [Neisseria meningitidis 8013]
          Length = 82

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 1/56 (1%)

Query: 25 DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPDSQ 79
          ++ GDG+H+ A I+S EF GK R+ +H+++ D L  ++  N LHALSI  +   ++
Sbjct: 21 EVEGDGHHFFAVIVSSEFEGKARLARHRLIKDGLKAQLESNELHALSISVAATPAE 76


>gi|161869027|ref|YP_001598193.1| BolA/YrbA family protein [Neisseria meningitidis 053442]
 gi|161594580|gb|ABX72240.1| BolA/YrbA family protein [Neisseria meningitidis 053442]
 gi|319409543|emb|CBY89830.1| putative BolA-like protein [Neisseria meningitidis WUE 2594]
          Length = 92

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 1/56 (1%)

Query: 25 DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPDSQ 79
          ++ GDG+H+ A I+S EF GK R+ +H+++ D L  ++  N LHALSI  +   ++
Sbjct: 31 EVEGDGHHFFAVIVSSEFEGKARLARHRLIKDGLKAQLESNELHALSISVAATPAE 86


>gi|261401500|ref|ZP_05987625.1| BolA family protein [Neisseria lactamica ATCC 23970]
 gi|313669325|ref|YP_004049609.1| BolA/YrbA family protein [Neisseria lactamica ST-640]
 gi|269208401|gb|EEZ74856.1| BolA family protein [Neisseria lactamica ATCC 23970]
 gi|309379844|emb|CBX21620.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|313006787|emb|CBN88257.1| BolA/YrbA family protein [Neisseria lactamica 020-06]
          Length = 82

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 1/56 (1%)

Query: 25 DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPDSQ 79
          ++ GDG+H+ A I+S EF GK R+ +H+++ D L  ++  N LHALSI  +   ++
Sbjct: 21 EVEGDGHHFFAVIVSSEFEGKARLARHRLIKDGLKAQLESNELHALSISVAATPAE 76


>gi|118595139|ref|ZP_01552486.1| BolA-like protein [Methylophilales bacterium HTCC2181]
 gi|118440917|gb|EAV47544.1| BolA-like protein [Methylophilales bacterium HTCC2181]
          Length = 84

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 32/48 (66%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G H+   I S  F GK R+++H+MVY +L + +   +HALSIKT VPD
Sbjct: 36 GAHFNVLIKSPLFIGKTRMERHRMVYTALEDLIPQTIHALSIKTEVPD 83


>gi|53804279|ref|YP_114088.1| bolA protein [Methylococcus capsulatus str. Bath]
 gi|53758040|gb|AAU92331.1| bolA protein [Methylococcus capsulatus str. Bath]
          Length = 95

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 30/44 (68%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          + A I+S  F GK+ +Q+HQMVY +LG+ M N +HA S+K   P
Sbjct: 43 FHATIVSAAFDGKSLVQRHQMVYSALGDMMHNEIHAFSMKALTP 86


>gi|296090030|emb|CBI39849.3| unnamed protein product [Vitis vinifera]
          Length = 407

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 32/45 (71%)

Query: 32  HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+  +++SEEF GK+ +++H++VYD L  ++ N LHALSI    P
Sbjct: 345 HFNLKVVSEEFEGKSLVKRHRVVYDLLQEELQNGLHALSIVAKTP 389


>gi|170092409|ref|XP_001877426.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164647285|gb|EDR11529.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 126

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 34/48 (70%), Gaps = 3/48 (6%)

Query: 28 GDGN---HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIK 72
          G GN   H++ +I+S +F+GK  +Q+H+M+Y +L  ++   LHALS+K
Sbjct: 46 GGGNGETHFSVQIVSNDFKGKTAMQRHRMIYSALSQELSQGLHALSLK 93


>gi|330808275|ref|YP_004352737.1| morphogene protein [Pseudomonas brassicacearum subsp.
          brassicacearum NFM421]
 gi|327376383|gb|AEA67733.1| morphogene protein [Pseudomonas brassicacearum subsp.
          brassicacearum NFM421]
          Length = 99

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   H+ A ++S++F G NR+++HQ VY +LG  MG   HAL++ T  P+
Sbjct: 31 GLQTHFKAVVVSQQFEGLNRVKRHQKVYGTLGELMGE-FHALALHTYTPE 79


>gi|145541315|ref|XP_001456346.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124424157|emb|CAK88949.1| unnamed protein product [Paramecium tetraurelia]
          Length = 86

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 48/76 (63%), Gaps = 6/76 (7%)

Query: 6  HEIEKMIKKGIPQSI----VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
           +IEK++   + Q +    V + D +G  G+ Y  EI S EF+GK++++QHQMV ++L  
Sbjct: 11 QDIEKVMADKLTQVLKATKVEVIDTSGGCGSMYRLEIESPEFQGKSKVKQHQMVVEALKA 70

Query: 61 KMGNALHALSIKTSVP 76
          ++  A H  SIKT++P
Sbjct: 71 ELAGA-HGYSIKTNIP 85


>gi|302847421|ref|XP_002955245.1| bola-like protein [Volvox carteri f. nagariensis]
 gi|300259537|gb|EFJ43764.1| bola-like protein [Volvox carteri f. nagariensis]
          Length = 165

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 12  IKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHAL-S 70
           I + +     T+ D+ GDG H + E++S+ F  KN +Q+ +MVY ++  ++  A+HA+ S
Sbjct: 95  ICEALETDTCTVTDVYGDGRHVSIEVVSKLFADKNSMQRQRMVYKAIWLELQEAVHAVDS 154

Query: 71  IKTSVPD 77
           + T  P+
Sbjct: 155 MTTRTPE 161


>gi|254787681|ref|YP_003075110.1| BolA family protein [Teredinibacter turnerae T7901]
 gi|237686366|gb|ACR13630.1| BolA family protein [Teredinibacter turnerae T7901]
          Length = 80

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 3/75 (4%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P EI+ +I+  +P+    ++  + DG H AA I+S  F G   +++ Q+VY +L   +
Sbjct: 1  MQPDEIKALIEAALPECTAQVN--SDDGKHVAALIVSPAFEGLMPVKRQQLVYGALNEHI 58

Query: 63 GN-ALHALSIKTSVP 76
           +  +HAL +KT  P
Sbjct: 59 SSGTIHALQMKTLTP 73


>gi|104780657|ref|YP_607155.1| BolA family transcriptional regulator [Pseudomonas entomophila
          L48]
 gi|95109644|emb|CAK14345.1| putative transcriptional regulator, BolA superfamily [Pseudomonas
          entomophila L48]
          Length = 98

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   HY A ++SE+F G N +++HQ VY ++G  MG  +HAL+I T  P+
Sbjct: 31 GQETHYKAVLVSEQFAGLNSVKRHQKVYATMGELMGE-IHALAIHTYTPE 79


>gi|15237987|ref|NP_197258.1| BolA-like family protein [Arabidopsis thaliana]
 gi|9755781|emb|CAC01900.1| putative protein [Arabidopsis thaliana]
 gi|21618086|gb|AAM67136.1| unknown [Arabidopsis thaliana]
 gi|98960931|gb|ABF58949.1| At5g17560 [Arabidopsis thaliana]
 gi|332005060|gb|AED92443.1| BolA-like protein [Arabidopsis thaliana]
          Length = 177

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 38/64 (59%)

Query: 6   HEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
             +E  IK+ +    VT+ D++GDG H    ++S  F G++ + + +MVY ++  ++ N 
Sbjct: 103 QSMELKIKEQLNAESVTVTDMSGDGRHVCINVVSSAFEGQSAVNRQRMVYKAIWEELQNV 162

Query: 66  LHAL 69
           +HA+
Sbjct: 163 VHAV 166


>gi|51535749|dbj|BAD37765.1| BolA-like [Oryza sativa Japonica Group]
 gi|215693054|dbj|BAG88474.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|218198203|gb|EEC80630.1| hypothetical protein OsI_23010 [Oryza sativa Indica Group]
 gi|222635605|gb|EEE65737.1| hypothetical protein OsJ_21386 [Oryza sativa Japonica Group]
          Length = 166

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 39/62 (62%)

Query: 8   IEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALH 67
           +E  IK+ +    VT+ D +GDG H   +++S+ F GK+ + + +MVY ++  ++ + +H
Sbjct: 90  LETKIKEQLEADTVTVVDTSGDGRHVCIDVVSKVFEGKSAVNRQRMVYKAIWEELQSTVH 149

Query: 68  AL 69
           A+
Sbjct: 150 AV 151


>gi|330960559|gb|EGH60819.1| bolA protein [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 97

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G+  HY A ++S++F+G N +++HQ VY +LG  MG   HAL++ T  P+
Sbjct: 31 GEQTHYKAILVSDQFQGLNSVKRHQKVYATLGGLMGE-FHALALHTYTPE 79


>gi|40063241|gb|AAR38068.1| BolA protein, putative [uncultured marine bacterium 577]
          Length = 87

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 32/48 (66%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G H+   I+S  F  K+ I++H+++YD+LG  +G  +HALSIK   P+
Sbjct: 38 GGHFLLTIVSGNFYKKSTIERHRIIYDALGKMVGRDIHALSIKAYTPE 85


>gi|117621265|ref|YP_858373.1| BolA/YrbA family protein [Aeromonas hydrophila subsp. hydrophila
          ATCC 7966]
 gi|145297395|ref|YP_001140236.1| BolA-like protein [Aeromonas salmonicida subsp. salmonicida A449]
 gi|330827994|ref|YP_004390946.1| BolA-like protein [Aeromonas veronii B565]
 gi|117562672|gb|ABK39620.1| BolA/YrbA family protein [Aeromonas hydrophila subsp. hydrophila
          ATCC 7966]
 gi|142850167|gb|ABO88488.1| BolA-like protein [Aeromonas salmonicida subsp. salmonicida A449]
 gi|328803130|gb|AEB48329.1| BolA-like protein [Aeromonas veronii B565]
          Length = 85

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 43/72 (59%), Gaps = 4/72 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EIE ++ + +P S V +    GDG+HY    + + F G +R+++ Q +Y  L +K+
Sbjct: 1  MQVSEIEAILLEALPLSEVHVK---GDGSHYQVIAVGDMFDGMSRVKKQQAIYAPLMDKI 57

Query: 63 G-NALHALSIKT 73
            NA+HALSIK 
Sbjct: 58 ASNAIHALSIKA 69


>gi|71737858|ref|YP_275821.1| bolA protein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|71558411|gb|AAZ37622.1| bolA protein [Pseudomonas syringae pv. phaseolicola 1448A]
          Length = 97

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   HY A ++S++F+G N +++HQ VY +LG  MG+  HAL++ T  P+
Sbjct: 31 GQQTHYKAVLVSDQFQGLNSVKRHQKVYATLGALMGD-FHALALHTYTPE 79


>gi|284165101|ref|YP_003403380.1| BolA family protein [Haloterrigena turkmenica DSM 5511]
 gi|284014756|gb|ADB60707.1| BolA family protein [Haloterrigena turkmenica DSM 5511]
          Length = 84

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 28/48 (58%)

Query: 29 DGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          D +H AA ++S  F G   +QQHQ VYD+L   M   +HAL + T  P
Sbjct: 29 DDDHLAATVVSPAFEGLPLVQQHQQVYDALDGHMTTDIHALELSTYTP 76


>gi|225076798|ref|ZP_03719997.1| hypothetical protein NEIFLAOT_01849 [Neisseria flavescens
           NRL30031/H210]
 gi|224951837|gb|EEG33046.1| hypothetical protein NEIFLAOT_01849 [Neisseria flavescens
           NRL30031/H210]
          Length = 109

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 5   PHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-G 63
           P +++ +I+   P   V   ++ GDG+H+ A I+S  F GK R+ +H+++ D L  ++  
Sbjct: 31  PEQVKTLIEGVTPCEHV---EVEGDGHHFFAVIVSSSFEGKARLARHRLIKDGLKPQLES 87

Query: 64  NALHALSIKTSVPDSQ 79
           N LHALSI  +   ++
Sbjct: 88  NELHALSISVAATPAE 103


>gi|15602044|ref|NP_245116.1| hypothetical protein PM0179 [Pasteurella multocida subsp.
          multocida str. Pm70]
 gi|12720399|gb|AAK02263.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 85

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 42/72 (58%), Gaps = 4/72 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSL-GNK 61
          M   EIE+++K  +    V +    G+  HY    +S+EF G +R++Q Q++Y  L  + 
Sbjct: 1  METQEIERILKDALKLDEVYVQ---GENAHYGVIAVSDEFAGLSRVKQQQLIYAPLMAHI 57

Query: 62 MGNALHALSIKT 73
            NA+HAL+IKT
Sbjct: 58 SSNAIHALTIKT 69


>gi|15790385|ref|NP_280209.1| hypothetical protein VNG1357C [Halobacterium sp. NRC-1]
 gi|169236119|ref|YP_001689319.1| hypothetical protein OE2937R [Halobacterium salinarum R1]
 gi|10580869|gb|AAG19689.1| conserved hypothetical protein [Halobacterium sp. NRC-1]
 gi|167727185|emb|CAP13971.1| conserved hypothetical protein [Halobacterium salinarum R1]
          Length = 82

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 39/74 (52%), Gaps = 3/74 (4%)

Query: 3  MNPHEIEKMIKKGIPQSI-VTIHDLAG--DGNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          M+  +IE  I+ G       T+    G  D +H  A ++S  F G + + QH MVYD+LG
Sbjct: 1  MDLADIEARIEAGFEADCSATVSRARGPHDDDHLEAVVVSPAFEGVSLVDQHDMVYDALG 60

Query: 60 NKMGNALHALSIKT 73
          + M   +HAL + T
Sbjct: 61 DAMTTEIHALELTT 74


>gi|59802233|ref|YP_208945.1| hypothetical protein NGO1920 [Neisseria gonorrhoeae FA 1090]
 gi|59719128|gb|AAW90533.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
          Length = 82

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 1/56 (1%)

Query: 25 DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPDSQ 79
          ++ GDG+H+ A I+S EF GK R+ +H+++ D L  ++  N LHALSI  +   ++
Sbjct: 21 EVEGDGHHFFAVIVSLEFEGKARLARHRLIKDGLKAQLESNELHALSISVAATPAE 76


>gi|241760637|ref|ZP_04758729.1| BolA/YrbA family protein [Neisseria flavescens SK114]
 gi|261379653|ref|ZP_05984226.1| BolA family protein [Neisseria subflava NJ9703]
 gi|319638734|ref|ZP_07993493.1| BolA/YrbA family protein [Neisseria mucosa C102]
 gi|241318818|gb|EER55344.1| BolA/YrbA family protein [Neisseria flavescens SK114]
 gi|284798138|gb|EFC53485.1| BolA family protein [Neisseria subflava NJ9703]
 gi|317399975|gb|EFV80637.1| BolA/YrbA family protein [Neisseria mucosa C102]
          Length = 82

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 5  PHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-G 63
          P +++ +I+   P   V   ++ GDG+H+ A I+S  F GK R+ +H+++ D L  ++  
Sbjct: 4  PEQVKTLIEGVTPCEHV---EVEGDGHHFFAVIVSSSFEGKARLARHRLIKDGLKPQLES 60

Query: 64 NALHALSIKTSVPDSQ 79
          N LHALSI  +   ++
Sbjct: 61 NELHALSISVAATPAE 76


>gi|288940242|ref|YP_003442482.1| BolA family protein [Allochromatium vinosum DSM 180]
 gi|288895614|gb|ADC61450.1| BolA family protein [Allochromatium vinosum DSM 180]
          Length = 79

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 45/78 (57%), Gaps = 4/78 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M    + + I+ G+P + V +    GDG H+ A ++S+ F G + I++ ++V +++  ++
Sbjct: 1  METEAVAQRIRAGLPGAEVQV---TGDGEHFEAVVVSDAFEGLSLIKRERLVMETVREQV 57

Query: 63 GNA-LHALSIKTSVPDSQ 79
           +  LHALSIK   P  Q
Sbjct: 58 ASGELHALSIKARTPAQQ 75


>gi|147803488|emb|CAN70939.1| hypothetical protein VITISV_001965 [Vitis vinifera]
          Length = 378

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 32/45 (71%)

Query: 32  HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+  +++SEEF GK+ +++H++VYD L  ++ N LHALSI    P
Sbjct: 328 HFNLKVVSEEFEGKSLVKRHRVVYDLLQEELQNGLHALSIVAKTP 372


>gi|37520260|ref|NP_923637.1| hypothetical protein gsl0691 [Gloeobacter violaceus PCC 7421]
 gi|35211253|dbj|BAC88632.1| gsl0691 [Gloeobacter violaceus PCC 7421]
          Length = 99

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 32/45 (71%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          Y   I+SE F G   I++H++VY++L  +MG+A+HALS++   PD
Sbjct: 45 YNVLIVSERFGGLPAIRRHRLVYEALAAEMGSAIHALSLRALAPD 89


>gi|320323364|gb|EFW79452.1| bolA protein [Pseudomonas syringae pv. glycinea str. B076]
 gi|320327561|gb|EFW83573.1| bolA protein [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330876530|gb|EGH10679.1| bolA protein [Pseudomonas syringae pv. glycinea str. race 4]
          Length = 97

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   HY A ++S++F+G N +++HQ VY +LG  MG   HAL++ T  P+
Sbjct: 31 GQQTHYKAVLVSDQFQGLNSVKRHQKVYATLGALMGE-FHALALHTYTPE 79


>gi|284433786|gb|ADB85099.1| putative transcription regulator [Jatropha curcas]
          Length = 93

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 45/80 (56%), Gaps = 2/80 (2%)

Query: 1  MSMNPHEIEKMIKKGI-PQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          M +   ++E  +K  + P  +  I    G G  +A EI+SE+F GK  +++H++V  +L 
Sbjct: 1  MGVTKEQVESALKSKLNPSHLEVIDTSGGCGASFAVEIVSEQFEGKRLLERHRLVNAALE 60

Query: 60 NKMGNALHALSIKTSVPDSQ 79
           +M   +HALSIK +V   Q
Sbjct: 61 EEM-KQIHALSIKKAVTPGQ 79


>gi|330817256|ref|YP_004360961.1| BolA family protein [Burkholderia gladioli BSR3]
 gi|327369649|gb|AEA61005.1| BolA family protein [Burkholderia gladioli BSR3]
          Length = 104

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 29/45 (64%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          Y   I++  F GK+R+ +H++VYD+L + M   +HAL+I    PD
Sbjct: 53 YTVTIVAAAFAGKSRVARHRLVYDALADAMRRGIHALAIVAYTPD 97


>gi|186475789|ref|YP_001857259.1| BolA family protein [Burkholderia phymatum STM815]
 gi|184192248|gb|ACC70213.1| BolA family protein [Burkholderia phymatum STM815]
          Length = 104

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 29/45 (64%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          YA  +++  F GK R+ +H+MVYD+L + M   +HAL+I    P+
Sbjct: 53 YAVTVVAGAFAGKARVARHRMVYDALADAMQRGIHALAITAYTPE 97


>gi|225463503|ref|XP_002263467.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 378

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 32/45 (71%)

Query: 32  HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+  +++SEEF GK+ +++H++VYD L  ++ N LHALSI    P
Sbjct: 328 HFNLKVVSEEFEGKSLVKRHRVVYDLLQEELQNGLHALSIVAKTP 372


>gi|299748762|ref|XP_001840130.2| hypothetical protein CC1G_02593 [Coprinopsis cinerea
          okayama7#130]
 gi|298408123|gb|EAU81577.2| hypothetical protein CC1G_02593 [Coprinopsis cinerea
          okayama7#130]
          Length = 85

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 46/77 (59%), Gaps = 2/77 (2%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          M+++   +E+ IK  IP + + I D + G G +YA  I+SE F GK  + +H+M+ + L 
Sbjct: 1  MAIDLAALEQAIKAAIPVTHLEIEDQSSGCGENYAVLIVSEAFVGKTTLARHRMINELLK 60

Query: 60 NKMGNALHALSIKTSVP 76
          +++   +HA S KT  P
Sbjct: 61 DQIAQ-MHAFSQKTYTP 76


>gi|260914435|ref|ZP_05920904.1| BolA/YrbA family protein [Pasteurella dagmatis ATCC 43325]
 gi|260631536|gb|EEX49718.1| BolA/YrbA family protein [Pasteurella dagmatis ATCC 43325]
          Length = 85

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 43/72 (59%), Gaps = 4/72 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EIE+++K+ +    V +    G+  HY    +S+EF G +R++Q Q++Y  L   +
Sbjct: 1  METQEIERILKEALNLDEVYVQ---GENAHYGVIAVSDEFAGLSRVKQQQLIYAPLMEHI 57

Query: 63 G-NALHALSIKT 73
            NA+HAL+IKT
Sbjct: 58 SNNAIHALTIKT 69


>gi|289623720|ref|ZP_06456674.1| bolA protein [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|330866087|gb|EGH00796.1| bolA protein [Pseudomonas syringae pv. aesculi str. 0893_23]
          Length = 97

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   HY A ++S++F+G N +++HQ VY +LG  MG   HAL++ T  P+
Sbjct: 31 GQQTHYKAVLVSDQFQGLNSVRRHQKVYATLGALMGE-FHALALHTYTPE 79


>gi|257485863|ref|ZP_05639904.1| bolA protein [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|289648162|ref|ZP_06479505.1| bolA protein [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298488003|ref|ZP_07006040.1| Cell division protein BolA [Pseudomonas savastanoi pv. savastanoi
          NCPPB 3335]
 gi|302187653|ref|ZP_07264326.1| bolA protein [Pseudomonas syringae pv. syringae 642]
 gi|298157282|gb|EFH98365.1| Cell division protein BolA [Pseudomonas savastanoi pv. savastanoi
          NCPPB 3335]
 gi|330889360|gb|EGH22021.1| bolA protein [Pseudomonas syringae pv. mori str. 301020]
 gi|330986678|gb|EGH84781.1| bolA protein [Pseudomonas syringae pv. lachrymans str. M301315]
 gi|331012948|gb|EGH93004.1| bolA protein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 97

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   HY A ++S++F+G N +++HQ VY +LG  MG   HAL++ T  P+
Sbjct: 31 GQQTHYKAVLVSDQFQGLNSVKRHQKVYATLGALMGE-FHALALHTYTPE 79


>gi|226941466|ref|YP_002796540.1| BolA/YrbA family protein [Laribacter hongkongensis HLHK9]
 gi|226716393|gb|ACO75531.1| BolA/YrbA family protein [Laribacter hongkongensis HLHK9]
          Length = 79

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 44/73 (60%), Gaps = 4/73 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P ++ ++I   +  + +   D+ GDG+H+ A I+S  F GK  +++H MV  +L  + 
Sbjct: 2  MTPDQVRQLIAATLDCTAI---DVRGDGHHFYASIVSPAFAGKRLVERHLMVKSALKPQF 58

Query: 63 GN-ALHALSIKTS 74
           +  LHALSI+++
Sbjct: 59 DDGTLHALSIESA 71


>gi|254796589|ref|YP_003081425.1| BolA family protein [Neorickettsia risticii str. Illinois]
 gi|254589829|gb|ACT69191.1| BolA family protein [Neorickettsia risticii str. Illinois]
          Length = 81

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 45/79 (56%), Gaps = 4/79 (5%)

Query: 1  MSMNPHEIEKMIKKGIP----QSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYD 56
          M +   EI +++    P    ++ + + D  GD +HY  +I S  F GK+ +++H++V  
Sbjct: 1  MPVEEKEITRLLLDAFPDVDPETDMHLVDTVGDKDHYLLKIRSTSFAGKSAVERHRLVVS 60

Query: 57 SLGNKMGNALHALSIKTSV 75
          +LG  +   LH++SI+T V
Sbjct: 61 ALGEILKGRLHSISIETKV 79


>gi|5139535|emb|CAB45536.1| BolA protein [Pseudomonas fluorescens]
          Length = 99

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 32/49 (65%), Gaps = 1/49 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G   H+ A ++S++F G NR+++HQ VY +LG  MG   HAL++ T  P
Sbjct: 31 GLQTHFKAVVVSQQFEGLNRVKRHQKVYGTLGELMGE-FHALALHTYTP 78


>gi|66046888|ref|YP_236729.1| BolA-like protein [Pseudomonas syringae pv. syringae B728a]
 gi|63257595|gb|AAY38691.1| BolA-like protein [Pseudomonas syringae pv. syringae B728a]
 gi|330972357|gb|EGH72423.1| BolA-like protein [Pseudomonas syringae pv. aceris str.
          M302273PT]
          Length = 97

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   HY A ++S++F+G N +++HQ VY +LG  MG   HAL++ T  P+
Sbjct: 31 GQQTHYKAVLVSDQFQGLNSVKRHQKVYATLGPLMGE-FHALALHTYTPE 79


>gi|207723562|ref|YP_002253961.1| hypothetical protein RSMK00846 [Ralstonia solanacearum MolK2]
 gi|206588763|emb|CAQ35726.1| hypothetical protein RSMK00846 [Ralstonia solanacearum MolK2]
          Length = 94

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 47/91 (51%), Gaps = 14/91 (15%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNH--------------YAAEIISEEFRGKN 46
          M+ N +E+ + I++ + ++   +H    D +               Y  +I+S  F GK+
Sbjct: 1  MAANSNEMRREIERLLREAFQPVHLAVEDDSAKHAGHAGAASGGGHYNVDIVSAAFAGKS 60

Query: 47 RIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          R+ +H+MVYD+L      A+HAL+I+   P+
Sbjct: 61 RVARHRMVYDALRALWPAAIHALAIRAVTPE 91


>gi|83720240|ref|YP_442658.1| BolA-like protein [Burkholderia thailandensis E264]
 gi|167619711|ref|ZP_02388342.1| BolA-like protein [Burkholderia thailandensis Bt4]
 gi|257138871|ref|ZP_05587133.1| BolA-like protein [Burkholderia thailandensis E264]
 gi|83654065|gb|ABC38128.1| BolA-like protein [Burkholderia thailandensis E264]
          Length = 106

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 29/45 (64%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          Y   I+S  F GK+RI +H++VYD+L + M   +HAL+I    P+
Sbjct: 53 YTVTIVSAAFAGKSRIARHRLVYDALADAMQRGIHALAIVAYTPE 97


>gi|307826209|ref|ZP_07656419.1| BolA family protein [Methylobacter tundripaludum SV96]
 gi|307732743|gb|EFO03610.1| BolA family protein [Methylobacter tundripaludum SV96]
          Length = 92

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
          G HY   I++E F G++ +Q+HQ++Y++LG+ M   +HAL I    P  +
Sbjct: 38 GGHYHVSIVAEIFEGRSLVQRHQLIYNALGDMMKQQIHALGINALSPSEE 87


>gi|255630800|gb|ACU15761.1| unknown [Glycine max]
          Length = 93

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (56%), Gaps = 3/79 (3%)

Query: 1  MSMNPHEIEKMIKKGI-PQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          M +   E+E  +K  + P  +  +    G G  +  EI+SE+F GK  +++H+MV  +L 
Sbjct: 1  MGVTKEEVESSLKAKLNPSHLEVVDTSGGCGASFVVEIVSEQFEGKRLLERHRMVNAALE 60

Query: 60 NKMGNALHALSIKTSV-PD 77
           +M   +HALSIK +V PD
Sbjct: 61 EEM-KQIHALSIKKAVTPD 78


>gi|94499434|ref|ZP_01305971.1| stress-induced morphogen [Oceanobacter sp. RED65]
 gi|94428188|gb|EAT13161.1| stress-induced morphogen [Oceanobacter sp. RED65]
          Length = 101

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 34/52 (65%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDS 78
          A    H+   ++++EF G N+++QHQ +Y +L +++   +HAL++ T  PD+
Sbjct: 32 ANSETHFKVVLVADEFAGMNKVKQHQAIYAALKDELAGPVHALALHTFAPDT 83


>gi|330953514|gb|EGH53774.1| BolA-like protein [Pseudomonas syringae Cit 7]
          Length = 97

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   HY A ++S++F+G N +++HQ VY +LG  MG   HAL++ T  P+
Sbjct: 31 GQQTHYKAVLVSDQFQGLNSVKRHQKVYATLGPLMGE-FHALALHTYTPE 79


>gi|289677131|ref|ZP_06498021.1| BolA-like protein [Pseudomonas syringae pv. syringae FF5]
 gi|330897189|gb|EGH28608.1| BolA-like protein [Pseudomonas syringae pv. japonica str.
          M301072PT]
 gi|330939661|gb|EGH42963.1| BolA-like protein [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330980254|gb|EGH78399.1| BolA-like protein [Pseudomonas syringae pv. aptata str. DSM
          50252]
          Length = 97

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   HY A ++S++F+G N +++HQ VY +LG  MG   HAL++ T  P+
Sbjct: 31 GQQTHYKAVLVSDQFQGLNSVKRHQKVYATLGPLMGE-FHALALHTYTPE 79


>gi|281206061|gb|EFA80250.1| bolA family protein [Polysphondylium pallidum PN500]
          Length = 133

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 36/51 (70%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDS 78
           G   H+   ++S+ F+GK+ I+QH+MV ++L  ++ + +HALS+KT+  +S
Sbjct: 61  GSETHFKVVVVSDMFKGKSLIEQHRMVNNTLSEQLSSGVHALSVKTATVES 111


>gi|254524700|ref|ZP_05136755.1| morphogene BolA protein [Stenotrophomonas sp. SKA14]
 gi|219722291|gb|EED40816.1| morphogene BolA protein [Stenotrophomonas sp. SKA14]
          Length = 91

 Score = 48.1 bits (113), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 46/90 (51%), Gaps = 13/90 (14%)

Query: 3  MNPHEIEKM---IKKGIPQSIVTIHD---------LAGDGN-HYAAEIISEEFRGKNRIQ 49
          MN   IE+M   +++ +  S++ I D          A DG  H+   ++SE F G   + 
Sbjct: 1  MNAERIERMRDALQQALAPSVLEIEDDSHRHAGHAGARDGRGHFNVHVVSERFAGLGPLA 60

Query: 50 QHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
          +H+ VY +LG+ M   +HALSI+   P  Q
Sbjct: 61 RHRAVYAALGSMMDTDIHALSIRAQTPSEQ 90


>gi|302879436|ref|YP_003848000.1| BolA family protein [Gallionella capsiferriformans ES-2]
 gi|302582225|gb|ADL56236.1| BolA family protein [Gallionella capsiferriformans ES-2]
          Length = 87

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 33/46 (71%)

Query: 32 HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          HY  +I++E+F GK  + +H+M+Y +LG  M + +HAL+I+ + P+
Sbjct: 40 HYLLQIVAEQFTGKGTLARHRMIYSALGEMMKDDIHALNIQANTPN 85


>gi|294889737|ref|XP_002772947.1| UV-induced protein uvi31, putative [Perkinsus marinus ATCC 50983]
 gi|294949632|ref|XP_002786285.1| UV-induced protein uvi31, putative [Perkinsus marinus ATCC 50983]
 gi|239877527|gb|EER04763.1| UV-induced protein uvi31, putative [Perkinsus marinus ATCC 50983]
 gi|239900460|gb|EER18081.1| UV-induced protein uvi31, putative [Perkinsus marinus ATCC 50983]
          Length = 103

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 33/51 (64%), Gaps = 4/51 (7%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM----GNALHALSIKTSVPD 77
           H+  E++S+EF+G NR+Q+ +++Y  L ++M    G  +HALS+    PD
Sbjct: 46 THFRVEVVSDEFKGLNRVQRQKLMYSILSDEMDSNPGGTVHALSMSCKTPD 96


>gi|323135936|ref|ZP_08071019.1| BolA family protein [Methylocystis sp. ATCC 49242]
 gi|322399027|gb|EFY01546.1| BolA family protein [Methylocystis sp. ATCC 49242]
          Length = 98

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 32/49 (65%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G+ +H+  E++S  F GK+R+Q+H+MV + L  ++   +HAL+I    P
Sbjct: 48 GNESHFRVEVVSAAFEGKSRVQRHRMVNELLAQEIAEGVHALAISAKAP 96


>gi|161524536|ref|YP_001579548.1| BolA family protein [Burkholderia multivorans ATCC 17616]
 gi|189350708|ref|YP_001946336.1| bolA-like protein [Burkholderia multivorans ATCC 17616]
 gi|221198201|ref|ZP_03571247.1| BolA family protein [Burkholderia multivorans CGD2M]
 gi|221208306|ref|ZP_03581309.1| BolA family protein [Burkholderia multivorans CGD2]
 gi|221215071|ref|ZP_03588038.1| BolA family protein [Burkholderia multivorans CGD1]
 gi|160341965|gb|ABX15051.1| BolA family protein [Burkholderia multivorans ATCC 17616]
 gi|189334730|dbj|BAG43800.1| bolA-like protein [Burkholderia multivorans ATCC 17616]
 gi|221165007|gb|EED97486.1| BolA family protein [Burkholderia multivorans CGD1]
 gi|221171719|gb|EEE04163.1| BolA family protein [Burkholderia multivorans CGD2]
 gi|221182133|gb|EEE14534.1| BolA family protein [Burkholderia multivorans CGD2M]
          Length = 104

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 29/45 (64%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          Y   I+S  F GK+R+ +H++VYD+L + M   +HAL+I    P+
Sbjct: 51 YTVTIVSAAFAGKSRVARHRLVYDALADAMQRGIHALAIVAYTPE 95


>gi|194289565|ref|YP_002005472.1| hypothetical protein RALTA_A1456 [Cupriavidus taiwanensis LMG
          19424]
 gi|193223400|emb|CAQ69405.1| conserved hypothetical protein; stress induced morphogen
          BolA-like protein [Cupriavidus taiwanensis LMG 19424]
          Length = 108

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (51%), Gaps = 10/81 (12%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHD----------LAGDGNHYAAEIISEEFRGKNRIQQ 50
          M+ +P  IE M++  +  S + + D           A  G HY   I+SE F G NR+ +
Sbjct: 1  MAADPATIEAMLRTALAPSHLAVRDDSALHAGHAGAASGGGHYDVTIVSERFAGHNRVAR 60

Query: 51 HQMVYDSLGNKMGNALHALSI 71
          H+MVYD+L       +HAL++
Sbjct: 61 HRMVYDALRGLFPTQIHALAV 81


>gi|88608074|ref|YP_506097.1| BolA family protein [Neorickettsia sennetsu str. Miyayama]
 gi|88600243|gb|ABD45711.1| BolA family protein [Neorickettsia sennetsu str. Miyayama]
          Length = 86

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 37/59 (62%)

Query: 17 PQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSV 75
          P++ + + D  GD +HY  +I S  F GK+ +++H++V  +LG  +   LH++SI+  V
Sbjct: 26 PETDIQLVDTVGDKDHYLLKIRSTSFVGKSAVERHRLVVSALGEILKERLHSISIEAKV 84


>gi|167581595|ref|ZP_02374469.1| BolA-like protein [Burkholderia thailandensis TXDOH]
          Length = 106

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 29/45 (64%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          Y   I+S  F GK+R+ +H++VYD+L + M   +HAL+I    P+
Sbjct: 53 YTVTIVSAAFAGKSRVARHRLVYDALADAMQRGIHALAIVAYTPE 97


>gi|269137867|ref|YP_003294567.1| conserved hypothetical protein, BolA superfamily [Edwardsiella
          tarda EIB202]
 gi|267983527|gb|ACY83356.1| conserved hypothetical protein, BolA superfamily [Edwardsiella
          tarda EIB202]
 gi|304557920|gb|ADM40584.1| YrbA [Edwardsiella tarda FL6-60]
          Length = 84

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MN  +I+ ++ K +  ++  +H + GDG+H+   ++ E F G +R++Q Q VY  L   +
Sbjct: 1  MNNDQIKDVLMKAL--ALQEVH-VTGDGSHFQVIVVGELFAGMSRVKQQQAVYAPLMEYI 57

Query: 63 G-NALHALSIKTSVPD 77
            N +HAL+IK   PD
Sbjct: 58 ADNRIHALTIKAYTPD 73


>gi|255562387|ref|XP_002522200.1| transcription regulator, putative [Ricinus communis]
 gi|223538571|gb|EEF40175.1| transcription regulator, putative [Ricinus communis]
          Length = 93

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 47/80 (58%), Gaps = 2/80 (2%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          M +   ++E  +K  +  S + + D +G  G  +A EI+SE+F GK  +++H++V  +L 
Sbjct: 1  MGVTKEQVESTLKTKLNPSHLEVTDTSGGCGASFAIEIVSEQFEGKRLLERHRLVNAALE 60

Query: 60 NKMGNALHALSIKTSVPDSQ 79
           +M   +HALSIK +V   Q
Sbjct: 61 EEM-KQIHALSIKKAVTPEQ 79


>gi|329901822|ref|ZP_08272914.1| Cell division protein BolA [Oxalobacteraceae bacterium IMCC9480]
 gi|327549005|gb|EGF33617.1| Cell division protein BolA [Oxalobacteraceae bacterium IMCC9480]
          Length = 93

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 31/46 (67%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          +H+   ++S  F G++R+ +H++VYD L N M   +HAL++ T+ P
Sbjct: 41 SHFRLHLVSARFEGESRVNRHRLVYDCLRNMMQAEIHALALSTAAP 86


>gi|88810629|ref|ZP_01125886.1| putative stress-induced morphogen BolA [Nitrococcus mobilis
          Nb-231]
 gi|88792259|gb|EAR23369.1| putative stress-induced morphogen BolA [Nitrococcus mobilis
          Nb-231]
          Length = 97

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 43/80 (53%), Gaps = 11/80 (13%)

Query: 8  IEKMIKKGIPQSIVTIHD----------LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDS 57
          IE+ ++  +    VT+ D              G HY   I+S +F G++ +Q+H+MVY++
Sbjct: 9  IEQRLRAALQVETVTVRDDSRLHAGHAGAKDGGGHYRVLIVSPDFTGRSTLQRHRMVYEA 68

Query: 58 LGNKM-GNALHALSIKTSVP 76
          +G  M  + +HALSI+   P
Sbjct: 69 MGEAMRADTIHALSIQALSP 88


>gi|89901175|ref|YP_523646.1| BolA-like protein [Rhodoferax ferrireducens T118]
 gi|89345912|gb|ABD70115.1| transcriptional regulator BolA [Rhodoferax ferrireducens T118]
          Length = 97

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 33/52 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDS 78
          +G G H+   I S  F GK+ + +H++VYD+L + M + LHAL+I+   P +
Sbjct: 46 SGFGTHFRVRITSHLFTGKSIVMRHRLVYDALHDFMAHGLHALAIEAQAPTA 97


>gi|134295946|ref|YP_001119681.1| transcriptional regulator BolA [Burkholderia vietnamiensis G4]
 gi|134139103|gb|ABO54846.1| transcriptional regulator, BolA protein family [Burkholderia
          vietnamiensis G4]
          Length = 102

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 29/45 (64%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          Y   I+S  F GK+R+ +H++VYD+L + M   +HAL+I    P+
Sbjct: 51 YTVTIVSAAFAGKSRVARHRLVYDALADAMQRGIHALAIVAYTPE 95


>gi|37527881|ref|NP_931226.1| hypothetical protein plu4029 [Photorhabdus luminescens subsp.
          laumondii TTO1]
 gi|253991140|ref|YP_003042496.1| transcriptional regulator protein yrba [Photorhabdus asymbiotica
          subsp. asymbiotica ATCC 43949]
 gi|36787317|emb|CAE16401.1| unnamed protein product [Photorhabdus luminescens subsp.
          laumondii TTO1]
 gi|253782590|emb|CAQ85754.1| transcriptional regulator protein yrba [Photorhabdus asymbiotica]
          Length = 84

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+ +EI++++   +    V ++   GDG+H+   ++ E F G +R++Q Q VY  L   +
Sbjct: 1  MDTNEIKQVLMDKLALDEVIVN---GDGSHFQVIVVGEMFAGMSRVKQQQAVYAPLMEYI 57

Query: 63 G-NALHALSIKTSVPD 77
            N +HALSIK   PD
Sbjct: 58 ADNRIHALSIKAYTPD 73


>gi|312962183|ref|ZP_07776675.1| BolA protein [Pseudomonas fluorescens WH6]
 gi|311283520|gb|EFQ62109.1| BolA protein [Pseudomonas fluorescens WH6]
          Length = 95

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   H+ A ++S++F G NR+++HQ VY +LG+ M    HAL++ T  P+
Sbjct: 29 GLQTHFKAVLVSQQFEGLNRVKRHQTVYATLGDLMSE-FHALALHTYTPE 77


>gi|50419797|ref|XP_458430.1| DEHA2C17050p [Debaryomyces hansenii CBS767]
 gi|49654096|emb|CAG86512.1| DEHA2C17050p [Debaryomyces hansenii]
          Length = 85

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 47/77 (61%), Gaps = 2/77 (2%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          MS++     ++IK+ +  S+V + D++G  G  +A  I+S  F GKN++ +H++V ++L 
Sbjct: 1  MSLSADSFRELIKEKLQASLVQVEDMSGGCGQAFAVIIVSPNFEGKNKLMRHRLVNNALK 60

Query: 60 NKMGNALHALSIKTSVP 76
           ++  ++HA + K   P
Sbjct: 61 EEIA-SIHAFTQKAFTP 76


>gi|167562431|ref|ZP_02355347.1| BolA/YrbA family protein [Burkholderia oklahomensis EO147]
 gi|167569613|ref|ZP_02362487.1| BolA/YrbA family protein [Burkholderia oklahomensis C6786]
          Length = 104

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          Y   I+S  F GK R+ +H++VYD+L + M   +HAL+I    P+
Sbjct: 51 YTVTIVSAAFAGKTRVARHRLVYDALADAMQRGIHALAILAYTPE 95


>gi|171321061|ref|ZP_02910044.1| BolA family protein [Burkholderia ambifaria MEX-5]
 gi|171093675|gb|EDT38825.1| BolA family protein [Burkholderia ambifaria MEX-5]
          Length = 102

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 29/45 (64%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          Y   I+S  F GK R+++H++VYD+L + M   +HAL+I    P+
Sbjct: 51 YTVTIVSAAFAGKPRVERHRLVYDALADAMQRGIHALAIVAYTPE 95


>gi|229591731|ref|YP_002873850.1| BolA protein [Pseudomonas fluorescens SBW25]
 gi|229363597|emb|CAY50904.1| BolA protein [Pseudomonas fluorescens SBW25]
          Length = 97

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   H+ A ++S +F G NR+++HQ VY +LG+ M    HAL++ T  PD
Sbjct: 31 GLQTHFKAVLVSPQFEGLNRVKRHQKVYATLGDLMSE-FHALALHTYTPD 79


>gi|77460312|ref|YP_349819.1| transcriptional regulator BolA [Pseudomonas fluorescens Pf0-1]
 gi|77384315|gb|ABA75828.1| transcriptional regulator, BolA protein family [Pseudomonas
          fluorescens Pf0-1]
          Length = 99

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   H+ A ++S +F G NR+++HQ VY +LG  MG   HAL++ T  P 
Sbjct: 31 GLQTHFKAVVVSAQFEGLNRVKRHQKVYGTLGELMGE-FHALALHTYTPQ 79


>gi|85086711|ref|XP_957735.1| hypothetical protein NCU00264 [Neurospora crassa OR74A]
 gi|28918830|gb|EAA28499.1| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 162

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 44/67 (65%), Gaps = 3/67 (4%)

Query: 11  MIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHAL 69
           +I++  P ++V + D++G  G+ Y  +I SE+FRG N ++Q ++V  +LG+ +    H +
Sbjct: 98  LIREFAPTNLV-VRDISGGCGSMYGVDICSEKFRGLNMLKQQRLVNAALGD-LVKQWHGI 155

Query: 70  SIKTSVP 76
            IKTSVP
Sbjct: 156 QIKTSVP 162


>gi|307107847|gb|EFN56089.1| hypothetical protein CHLNCDRAFT_145612 [Chlorella variabilis]
          Length = 138

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 12  IKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHAL-S 70
           I+  +   +V + D+ GDG H    ++S+EF GK+ + + +MVY ++  ++   +HA+ +
Sbjct: 68  IQAALSAELVQVEDMQGDGRHVEIVVVSKEFEGKSAVNRQRMVYKAIWEELQETVHAVDA 127

Query: 71  IKTSVPD 77
           + T  P+
Sbjct: 128 MVTKTPE 134


>gi|77361166|ref|YP_340741.1| regulator protein [Pseudoalteromonas haloplanktis TAC125]
 gi|76876077|emb|CAI87299.1| regulator protein [Pseudoalteromonas haloplanktis TAC125]
          Length = 101

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 34/51 (66%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          AG  +H+   ++SEEF GK  +Q+H+ + + L +++ N +HAL+I T  PD
Sbjct: 29 AGSDSHFKVIVVSEEFAGKRLLQRHREINEILKDELANHIHALAIHTYTPD 79


>gi|298369775|ref|ZP_06981092.1| BolA family protein [Neisseria sp. oral taxon 014 str. F0314]
 gi|298282332|gb|EFI23820.1| BolA family protein [Neisseria sp. oral taxon 014 str. F0314]
          Length = 86

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 25 DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPDSQ 79
          ++ GDG+H+ A I+S  F GK R+ +H+++ D L   +  N LHALSI  +   ++
Sbjct: 26 EVEGDGHHFFAVIVSSAFEGKTRLARHRLIKDGLKTHLQSNELHALSISVAATPAE 81


>gi|187923911|ref|YP_001895553.1| BolA family protein [Burkholderia phytofirmans PsJN]
 gi|187715105|gb|ACD16329.1| BolA family protein [Burkholderia phytofirmans PsJN]
          Length = 106

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 29/45 (64%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          ++  I++  F GK R+ +H+MVYD+L + M   +HAL+I    P+
Sbjct: 55 FSVTIVAAAFAGKARVARHRMVYDALADAMQRGIHALAITAYTPE 99


>gi|92114337|ref|YP_574265.1| BolA-like protein [Chromohalobacter salexigens DSM 3043]
 gi|91797427|gb|ABE59566.1| BolA-like protein [Chromohalobacter salexigens DSM 3043]
          Length = 84

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P +++ +++  I      I    G+G ++    ISE F G + +++ Q++Y +L +++
Sbjct: 1  MQPSDVKALLESRIDDCQFHIQ---GEGCNFQVVAISEAFAGLSPVKRQQLIYSALSDEI 57

Query: 63 GN-ALHALSIKTSVPD 77
           + ALHA+SIKT  PD
Sbjct: 58 ASGALHAISIKTYTPD 73


>gi|32035041|ref|ZP_00135107.1| COG5007: Predicted transcriptional regulator, BolA superfamily
          [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126208753|ref|YP_001053978.1| hypothetical protein APL_1287 [Actinobacillus pleuropneumoniae
          L20]
 gi|126097545|gb|ABN74373.1| hypothetical protein APL_1287 [Actinobacillus pleuropneumoniae
          serovar 5b str. L20]
          Length = 86

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 43/72 (59%), Gaps = 3/72 (4%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P ++E+++K  +P +   IH   G+ +HY   ++S+E    ++++Q Q VY  LG   
Sbjct: 1  MEPKQLEEILKNALPHA-SEIHA-QGENSHYGVIVVSDELAQLSKVKQQQAVYAPLGEYF 58

Query: 63 G-NALHALSIKT 73
            NA+HAL+IK 
Sbjct: 59 ATNAIHALTIKV 70


>gi|296157843|ref|ZP_06840677.1| BolA family protein [Burkholderia sp. Ch1-1]
 gi|295892089|gb|EFG71873.1| BolA family protein [Burkholderia sp. Ch1-1]
          Length = 106

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 29/45 (64%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          ++  I++  F GK R+ +H+MVYD+L + M   +HAL+I    P+
Sbjct: 55 FSVTIVAAAFAGKARVARHRMVYDALADAMQRGIHALAITAYTPE 99


>gi|261868151|ref|YP_003256073.1| BolA protein [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|293391907|ref|ZP_06636241.1| BolA protein [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|261413483|gb|ACX82854.1| BolA protein [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|290952441|gb|EFE02560.1| BolA protein [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 85

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 43/72 (59%), Gaps = 4/72 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EIE+++K+ +    V +    G+  HY    +S++F G ++++Q QM+Y  L N +
Sbjct: 1  METQEIERILKEALNLDEVYVQ---GEDAHYGVIAVSDQFEGLSKVKQQQMIYAPLLNHI 57

Query: 63 -GNALHALSIKT 73
            N +HALSI+T
Sbjct: 58 SSNEIHALSIRT 69


>gi|121608768|ref|YP_996575.1| BolA family protein [Verminephrobacter eiseniae EF01-2]
 gi|121553408|gb|ABM57557.1| transcriptional regulator BolA [Verminephrobacter eiseniae
          EF01-2]
          Length = 86

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
           G G+H    I S  F G++R+ QH++VYD+L   MG  +HAL+I+ 
Sbjct: 39 TGQGSHIRVRIASPLFTGRSRLAQHRLVYDALQEFMGQGVHALAIEV 85


>gi|91783536|ref|YP_558742.1| putative stress-induced morphogene BolA- like protein
          [Burkholderia xenovorans LB400]
 gi|91687490|gb|ABE30690.1| transcriptional regulator, BolA protein family [Burkholderia
          xenovorans LB400]
          Length = 106

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 29/45 (64%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          ++  I++  F GK R+ +H+MVYD+L + M   +HAL+I    P+
Sbjct: 55 FSVTIVAAAFAGKARVARHRMVYDALADAMQRGIHALAITAYTPE 99


>gi|190150607|ref|YP_001969132.1| hypothetical protein APP7_1338 [Actinobacillus pleuropneumoniae
          serovar 7 str. AP76]
 gi|303250631|ref|ZP_07336828.1| transcriptional regulator [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|303252083|ref|ZP_07338252.1| transcriptional regulator [Actinobacillus pleuropneumoniae
          serovar 2 str. 4226]
 gi|307248312|ref|ZP_07530337.1| hypothetical protein appser2_12900 [Actinobacillus
          pleuropneumoniae serovar 2 str. S1536]
 gi|307252922|ref|ZP_07534810.1| hypothetical protein appser6_14330 [Actinobacillus
          pleuropneumoniae serovar 6 str. Femo]
 gi|307257353|ref|ZP_07539123.1| hypothetical protein appser10_13510 [Actinobacillus
          pleuropneumoniae serovar 10 str. D13039]
 gi|307263952|ref|ZP_07545555.1| hypothetical protein appser13_13600 [Actinobacillus
          pleuropneumoniae serovar 13 str. N273]
 gi|189915738|gb|ACE61990.1| hypothetical protein APP7_1338 [Actinobacillus pleuropneumoniae
          serovar 7 str. AP76]
 gi|302649065|gb|EFL79252.1| transcriptional regulator [Actinobacillus pleuropneumoniae
          serovar 2 str. 4226]
 gi|302650619|gb|EFL80778.1| transcriptional regulator [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|306855182|gb|EFM87360.1| hypothetical protein appser2_12900 [Actinobacillus
          pleuropneumoniae serovar 2 str. S1536]
 gi|306859560|gb|EFM91585.1| hypothetical protein appser6_14330 [Actinobacillus
          pleuropneumoniae serovar 6 str. Femo]
 gi|306864203|gb|EFM96116.1| hypothetical protein appser10_13510 [Actinobacillus
          pleuropneumoniae serovar 10 str. D13039]
 gi|306870714|gb|EFN02455.1| hypothetical protein appser13_13600 [Actinobacillus
          pleuropneumoniae serovar 13 str. N273]
          Length = 86

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 43/72 (59%), Gaps = 3/72 (4%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P ++E+++K  +P +   IH   G+ +HY   ++S+E    ++++Q Q VY  LG   
Sbjct: 1  MEPKQLEEILKNALPHA-SEIHA-QGENSHYGVIVVSDELAQLSKVKQQQAVYAPLGEYF 58

Query: 63 G-NALHALSIKT 73
            NA+HAL+IK 
Sbjct: 59 ATNAIHALTIKV 70


>gi|325182157|emb|CCA16610.1| conserved hypothetical protein [Albugo laibachii Nc14]
          Length = 1560

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 39/57 (68%), Gaps = 2/57 (3%)

Query: 21   VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
            V + D++G  G+ Y  +++S +F GK+R+ QH+MV + L +++   +H L+IKTS P
Sbjct: 1504 VQVTDVSGGCGSMYNVKVVSSQFEGKSRVIQHRMVNEVLKDEI-KGMHGLTIKTSTP 1559


>gi|167836283|ref|ZP_02463166.1| BolA-like protein [Burkholderia thailandensis MSMB43]
          Length = 104

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 29/45 (64%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          Y   I+S  F GK+R+ +H++VYD+L + M   +HAL+I    P+
Sbjct: 51 YTVTIVSAAFAGKSRVARHRLVYDALADAMQRGVHALAIVAYTPE 95


>gi|167586946|ref|ZP_02379334.1| BolA family protein [Burkholderia ubonensis Bu]
          Length = 91

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          Y   I+S  F GK R+ +H++VYD+L + M   +HAL+I    P+
Sbjct: 40 YTVTIVSAAFAGKARVARHRLVYDALADAMQRGIHALAIVAYTPE 84


>gi|146329310|ref|YP_001209751.1| BolA family protein [Dichelobacter nodosus VCS1703A]
 gi|146232780|gb|ABQ13758.1| BolA family protein [Dichelobacter nodosus VCS1703A]
          Length = 74

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 29 DGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPD 77
          DG H+ A + S  F G +R++QH+MV  +L + +  N +HALS+KT V D
Sbjct: 25 DGVHFEATVTSAAFAGHSRLEQHRMVLKALEDVISSNEVHALSLKTKVSD 74


>gi|322515305|ref|ZP_08068302.1| BolA superfamily transcriptional regulator [Actinobacillus ureae
          ATCC 25976]
 gi|322118681|gb|EFX90893.1| BolA superfamily transcriptional regulator [Actinobacillus ureae
          ATCC 25976]
          Length = 86

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 43/72 (59%), Gaps = 3/72 (4%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P ++E++++  +P +   IH   G+ +HY   ++S+E    ++++Q Q VY  LG   
Sbjct: 1  MEPKQLEEILRNALPTA-AEIHA-QGENSHYGVIVVSDELVQLSKVKQQQAVYAPLGEYF 58

Query: 63 G-NALHALSIKT 73
            NA+HAL+IK 
Sbjct: 59 ATNAIHALTIKV 70


>gi|307129075|ref|YP_003881091.1| putative DNA-binding transcriptional regulator [Dickeya dadantii
          3937]
 gi|306526604|gb|ADM96534.1| predicted DNA-binding transcriptional regulator [Dickeya dadantii
          3937]
          Length = 84

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVPD 77
          ++GDG+H+   +I E F+G +R++Q Q VY  L   +  N +HALSIK   P+
Sbjct: 21 VSGDGSHFQVIVIGELFKGMSRVKQQQTVYAPLMEYIADNRIHALSIKAYTPE 73


>gi|315633778|ref|ZP_07889068.1| BolA superfamily transcriptional regulator [Aggregatibacter
          segnis ATCC 33393]
 gi|315477820|gb|EFU68562.1| BolA superfamily transcriptional regulator [Aggregatibacter
          segnis ATCC 33393]
          Length = 85

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 43/72 (59%), Gaps = 4/72 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EIE+++K+ +    V +    G+  HY    +S++F G ++++Q QM+Y  L N +
Sbjct: 1  METQEIERILKEALNLDEVYVQ---GENAHYGVIAVSDQFEGLSKVKQQQMIYAPLLNHI 57

Query: 63 -GNALHALSIKT 73
            N +HALSI+T
Sbjct: 58 SSNEIHALSIRT 69


>gi|154252167|ref|YP_001412991.1| BolA family protein [Parvibaculum lavamentivorans DS-1]
 gi|154156117|gb|ABS63334.1| BolA family protein [Parvibaculum lavamentivorans DS-1]
          Length = 92

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 33/50 (66%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   H+   ++S  F GK+R+++ +++  +L  +MGN +HALS+KT  P+
Sbjct: 38 GVETHFKVTVVSAGFAGKSRVERQRLISAALKEEMGNPIHALSMKTMTPE 87


>gi|296223530|ref|XP_002757671.1| PREDICTED: bolA-like protein 3-like [Callithrix jacchus]
          Length = 109

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 3/71 (4%)

Query: 8   IEKMIKKGIPQSI-VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
           + +++K+  PQ+  + + D++G  G  Y  +I SEEF+ K  +QQHQMV  +L  ++   
Sbjct: 38  VTQILKEKFPQATAIKVTDISGGCGAMYEIKIESEEFKEKRTVQQHQMVNQALKEEI-KG 96

Query: 66  LHALSIKTSVP 76
           +H L I TSVP
Sbjct: 97  MHGLRIFTSVP 107


>gi|224126137|ref|XP_002319764.1| predicted protein [Populus trichocarpa]
 gi|118482877|gb|ABK93353.1| unknown [Populus trichocarpa]
 gi|222858140|gb|EEE95687.1| predicted protein [Populus trichocarpa]
          Length = 171

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 38/62 (61%)

Query: 8   IEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALH 67
           +E  IK+ +    V++ D  GDG H   ++ISE F G++ + + +MVY ++  ++ + +H
Sbjct: 95  MENKIKEELTAESVSVKDAYGDGRHVCIDVISEAFEGQSAVNRQRMVYKAIWEELQSTVH 154

Query: 68  AL 69
           A+
Sbjct: 155 AV 156


>gi|170692425|ref|ZP_02883588.1| BolA family protein [Burkholderia graminis C4D1M]
 gi|170142855|gb|EDT11020.1| BolA family protein [Burkholderia graminis C4D1M]
          Length = 103

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 29/45 (64%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          ++  I++  F GK R+ +H+MVYD+L + M   +HAL+I    P+
Sbjct: 52 FSVTIVAAAFAGKPRVARHRMVYDALADAMQRGIHALAITAYTPE 96


>gi|157819589|ref|NP_001100071.1| bolA-like protein 3 [Rattus norvegicus]
 gi|149036521|gb|EDL91139.1| similar to BolA domain-containing protein like (11.4 kD) (1P25)
           (predicted) [Rattus norvegicus]
          Length = 110

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 45/74 (60%), Gaps = 3/74 (4%)

Query: 7   EIEKMIKKGIPQSI-VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN 64
           ++ +++K+  P++  + + D++G  G  Y  +I SEEF+ K  +QQHQMV  +L  ++  
Sbjct: 38  KVTQVLKEKFPRATAIQVTDISGGCGAMYEIKIESEEFKAKRMVQQHQMVNQALKEEI-K 96

Query: 65  ALHALSIKTSVPDS 78
            +H L I TSVP  
Sbjct: 97  GMHGLRIFTSVPKC 110


>gi|70731676|ref|YP_261418.1| bolA protein [Pseudomonas fluorescens Pf-5]
 gi|68345975|gb|AAY93581.1| bolA protein [Pseudomonas fluorescens Pf-5]
          Length = 99

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   H+ A ++SE+F G N +++HQ VY +LG  MG   HAL++ T  P+
Sbjct: 31 GLETHFKAVLVSEQFAGLNSVKRHQKVYATLGELMGQ-FHALALHTYTPE 79


>gi|167032360|ref|YP_001667591.1| BolA family protein [Pseudomonas putida GB-1]
 gi|166858848|gb|ABY97255.1| BolA family protein [Pseudomonas putida GB-1]
          Length = 98

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 42/74 (56%), Gaps = 5/74 (6%)

Query: 8  IEKMIKKGIPQSIVTIHDL----AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG 63
          IE+ +    PQ +  +++      G   HY A I+SE+F G N +++HQ VY ++G  MG
Sbjct: 7  IEQQLATLAPQHLQVLNESHMHSRGQETHYKAVIVSEQFAGLNSVKRHQKVYATMGELMG 66

Query: 64 NALHALSIKTSVPD 77
            +HAL+I T   +
Sbjct: 67 E-IHALAIHTYTAE 79


>gi|261855125|ref|YP_003262408.1| BolA family protein [Halothiobacillus neapolitanus c2]
 gi|261835594|gb|ACX95361.1| BolA family protein [Halothiobacillus neapolitanus c2]
          Length = 73

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MN  EI  MI+  IP +   +H   G+G ++   ++S EF GK  +QQHQ V   L   +
Sbjct: 1  MNSAEIVSMIQNEIPDA--EVHP-EGEGCNFKITVLSSEFAGKTMLQQHQRVNKILAPSL 57

Query: 63 GN-ALHALSIKTSVP 76
           + ALHA+++ T  P
Sbjct: 58 ASGALHAVTLVTRTP 72


>gi|26988488|ref|NP_743913.1| BolA family protein [Pseudomonas putida KT2440]
 gi|148549163|ref|YP_001269265.1| BolA family protein [Pseudomonas putida F1]
 gi|24983252|gb|AAN67377.1|AE016364_2 bolA protein [Pseudomonas putida KT2440]
 gi|148513221|gb|ABQ80081.1| transcriptional regulator BolA [Pseudomonas putida F1]
 gi|313500077|gb|ADR61443.1| BolA [Pseudomonas putida BIRD-1]
          Length = 98

 Score = 47.4 bits (111), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   HY A I+SE+F G N +++HQ VY ++G  MG  +HAL+I T   +
Sbjct: 31 GQETHYKAVIVSEQFAGLNSVKRHQKVYATMGELMGE-IHALAIHTYTAE 79


>gi|307729670|ref|YP_003906894.1| BolA family protein [Burkholderia sp. CCGE1003]
 gi|307584205|gb|ADN57603.1| BolA family protein [Burkholderia sp. CCGE1003]
          Length = 103

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 29/45 (64%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          ++  I++  F GK R+ +H+MVYD+L + M   +HAL+I    P+
Sbjct: 52 FSVTIVAAAFAGKPRVARHRMVYDALADAMQRGIHALAITAYTPE 96


>gi|323526034|ref|YP_004228187.1| BolA family protein [Burkholderia sp. CCGE1001]
 gi|323383036|gb|ADX55127.1| BolA family protein [Burkholderia sp. CCGE1001]
          Length = 103

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 29/45 (64%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          ++  I++  F GK R+ +H+MVYD+L + M   +HAL+I    P+
Sbjct: 52 FSVTIVAAAFAGKPRVARHRMVYDALADAMQRGIHALAITAYTPE 96


>gi|242059349|ref|XP_002458820.1| hypothetical protein SORBIDRAFT_03g040920 [Sorghum bicolor]
 gi|241930795|gb|EES03940.1| hypothetical protein SORBIDRAFT_03g040920 [Sorghum bicolor]
          Length = 93

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 44/80 (55%), Gaps = 2/80 (2%)

Query: 1  MSMNPHEIEKMIKKGI-PQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          M +   ++E  I   + P ++V      G G  Y  E++SE+F GK  +++H+MV  +L 
Sbjct: 1  MGVTKEDVEAAITSALSPSNLVVTDTSGGCGASYEIEVVSEKFEGKRLLERHRMVNTALA 60

Query: 60 NKMGNALHALSIKTSVPDSQ 79
            M   +HA+SIK ++  +Q
Sbjct: 61 PHMAE-IHAVSIKKALTPAQ 79


>gi|119776208|ref|YP_928948.1| BolA-like protein [Shewanella amazonensis SB2B]
 gi|119768708|gb|ABM01279.1| BolA-like protein [Shewanella amazonensis SB2B]
          Length = 85

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+  +IE+++ + +   +  +H +  DG+HY    + E F G +RI+Q Q +Y  L + +
Sbjct: 1  MDCKQIEEILTQAL--GLEEVH-VTSDGSHYQVVAVGECFDGMSRIKQQQAIYAPLMDHI 57

Query: 63 GN-ALHALSIKTSVP 76
           + ALHALSIKT  P
Sbjct: 58 TSGALHALSIKTFTP 72


>gi|255566058|ref|XP_002524017.1| transcription regulator, putative [Ricinus communis]
 gi|223536744|gb|EEF38385.1| transcription regulator, putative [Ricinus communis]
          Length = 174

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 38/64 (59%)

Query: 6   HEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
             +EK IK+ +    V + D  GDG H + ++IS  F G++ + + +MVY ++  ++ + 
Sbjct: 96  QSMEKKIKESLDADSVIVKDAYGDGRHVSIDVISSAFEGQSAVNRQRMVYKAIWEELQST 155

Query: 66  LHAL 69
           +HA+
Sbjct: 156 VHAV 159


>gi|114564526|ref|YP_752040.1| BolA family protein [Shewanella frigidimarina NCIMB 400]
 gi|114335819|gb|ABI73201.1| BolA family protein [Shewanella frigidimarina NCIMB 400]
          Length = 83

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M    IE+++ + +  S+   H +  DG+HY    + E F G +R++Q Q +Y  L  ++
Sbjct: 1  MECKVIEQILTEAL--SLTEAH-VTSDGSHYKVVAVGECFEGMSRVKQQQAIYTPLAEQI 57

Query: 63 GNA-LHALSIKTSVP 76
           +  LHAL+IKT  P
Sbjct: 58 ASGELHALTIKTFTP 72


>gi|251791361|ref|YP_003006082.1| BolA family protein [Dickeya zeae Ech1591]
 gi|247539982|gb|ACT08603.1| BolA family protein [Dickeya zeae Ech1591]
          Length = 84

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVPD 77
          ++GDG+H+   +I E F+G +R++Q Q VY  L   +  N +HALSIK   P+
Sbjct: 21 VSGDGSHFQVIVIGELFKGMSRVKQQQAVYAPLMEYIADNRIHALSIKAYTPE 73


>gi|226510586|ref|NP_001148455.1| bolA-like protein [Zea mays]
 gi|195605538|gb|ACG24599.1| bolA-like protein [Zea mays]
 gi|195619394|gb|ACG31527.1| bolA-like protein [Zea mays]
 gi|195620302|gb|ACG31981.1| bolA-like protein [Zea mays]
 gi|195638654|gb|ACG38795.1| bolA-like protein [Zea mays]
 gi|223974419|gb|ACN31397.1| unknown [Zea mays]
          Length = 95

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 2/76 (2%)

Query: 1  MSMNPHEIEKMIKKGI-PQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          M +   ++E  I   + P ++V      G G  Y  E++SE+F GK  +++H+MV  +L 
Sbjct: 1  MGVTKEDVEAAITSALSPSNLVVTDTSGGCGASYEIEVVSEKFEGKRLLERHRMVNTALA 60

Query: 60 NKMGNALHALSIKTSV 75
          + M   +HA+SIK ++
Sbjct: 61 SHMAE-IHAVSIKKAL 75


>gi|254252166|ref|ZP_04945484.1| Stress-induced morphogen (activity unknown) [Burkholderia dolosa
          AUO158]
 gi|124894775|gb|EAY68655.1| Stress-induced morphogen (activity unknown) [Burkholderia dolosa
          AUO158]
          Length = 102

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          Y   I+S  F GK R+ +H++VYD+L + M   +HAL+I    P+
Sbjct: 51 YTVTIVSAAFAGKPRVARHRLVYDALADAMQRGIHALAIVAYTPE 95


>gi|240948311|ref|ZP_04752697.1| hypothetical protein AM305_05644 [Actinobacillus minor NM305]
 gi|240297350|gb|EER47891.1| hypothetical protein AM305_05644 [Actinobacillus minor NM305]
          Length = 86

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 43/76 (56%), Gaps = 3/76 (3%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P ++E+++K  +  +   IH   G+ +HY   ++S+     +R++Q Q VY  LG+  
Sbjct: 1  MEPKQLEEILKAALTDA-TEIHA-QGENSHYGVIVVSDSLAALSRVKQQQAVYAPLGDLF 58

Query: 63 G-NALHALSIKTSVPD 77
            NA+HAL+IK    D
Sbjct: 59 ATNAIHALTIKVFSTD 74


>gi|167738144|ref|ZP_02410918.1| BolA/YrbA family protein [Burkholderia pseudomallei 14]
          Length = 106

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 29/45 (64%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          Y   I++  F GK+R+ +H++VYD+L + M   +HAL+I    P+
Sbjct: 53 YTVTIVAAAFAGKSRVARHRLVYDALADAMQRGIHALAIVAYTPE 97


>gi|167719142|ref|ZP_02402378.1| BolA/YrbA family protein [Burkholderia pseudomallei DM98]
 gi|167815331|ref|ZP_02447011.1| BolA/YrbA family protein [Burkholderia pseudomallei 91]
 gi|167823738|ref|ZP_02455209.1| BolA/YrbA family protein [Burkholderia pseudomallei 9]
 gi|226197202|ref|ZP_03792779.1| BolA/YrbA family protein [Burkholderia pseudomallei Pakistan 9]
 gi|254179445|ref|ZP_04886044.1| BolA/YrbA family protein [Burkholderia pseudomallei 1655]
 gi|184209985|gb|EDU07028.1| BolA/YrbA family protein [Burkholderia pseudomallei 1655]
 gi|225930581|gb|EEH26591.1| BolA/YrbA family protein [Burkholderia pseudomallei Pakistan 9]
          Length = 106

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 29/45 (64%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          Y   I++  F GK+R+ +H++VYD+L + M   +HAL+I    P+
Sbjct: 53 YTVTIVAAAFAGKSRVARHRLVYDALADAMQRGIHALAIVAYTPE 97


>gi|271498874|ref|YP_003331899.1| BolA family protein [Dickeya dadantii Ech586]
 gi|270342429|gb|ACZ75194.1| BolA family protein [Dickeya dadantii Ech586]
          Length = 84

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVPD 77
          ++GDG+H+   +I E F+G +R++Q Q VY  L   +  N +HALSIK   P+
Sbjct: 21 VSGDGSHFQVIVIGELFKGMSRVKQQQAVYAPLMEYIADNRIHALSIKAYTPE 73


>gi|53723650|ref|YP_103095.1| BolA-like protein [Burkholderia mallei ATCC 23344]
 gi|67642003|ref|ZP_00440766.1| BolA family protein [Burkholderia mallei GB8 horse 4]
 gi|121598343|ref|YP_993253.1| BolA-like protein [Burkholderia mallei SAVP1]
 gi|126439186|ref|YP_001059335.1| BolA/YrbA family protein [Burkholderia pseudomallei 668]
 gi|126453541|ref|YP_001066603.1| BolA/YrbA family protein [Burkholderia pseudomallei 1106a]
 gi|166998725|ref|ZP_02264579.1| BolA/YrbA family protein [Burkholderia mallei PRL-20]
 gi|167845287|ref|ZP_02470795.1| BolA/YrbA family protein [Burkholderia pseudomallei B7210]
 gi|167910521|ref|ZP_02497612.1| BolA/YrbA family protein [Burkholderia pseudomallei 112]
 gi|242314578|ref|ZP_04813594.1| BolA/YrbA family protein [Burkholderia pseudomallei 1106b]
 gi|254178577|ref|ZP_04885232.1| BolA-like protein [Burkholderia mallei ATCC 10399]
 gi|254206377|ref|ZP_04912729.1| BolA/YrbA family protein [Burkholderia mallei JHU]
 gi|254358209|ref|ZP_04974482.1| BolA/YrbA family protein [Burkholderia mallei 2002721280]
 gi|52427073|gb|AAU47666.1| BolA-like protein [Burkholderia mallei ATCC 23344]
 gi|121227153|gb|ABM49671.1| BolA-like protein [Burkholderia mallei SAVP1]
 gi|126218679|gb|ABN82185.1| BolA/YrbA family protein [Burkholderia pseudomallei 668]
 gi|126227183|gb|ABN90723.1| BolA/YrbA family protein [Burkholderia pseudomallei 1106a]
 gi|147753820|gb|EDK60885.1| BolA/YrbA family protein [Burkholderia mallei JHU]
 gi|148027336|gb|EDK85357.1| BolA/YrbA family protein [Burkholderia mallei 2002721280]
 gi|160699616|gb|EDP89586.1| BolA-like protein [Burkholderia mallei ATCC 10399]
 gi|238523044|gb|EEP86485.1| BolA family protein [Burkholderia mallei GB8 horse 4]
 gi|242137817|gb|EES24219.1| BolA/YrbA family protein [Burkholderia pseudomallei 1106b]
 gi|243065079|gb|EES47265.1| BolA/YrbA family protein [Burkholderia mallei PRL-20]
          Length = 106

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 29/45 (64%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          Y   I++  F GK+R+ +H++VYD+L + M   +HAL+I    P+
Sbjct: 53 YTVTIVAAAFAGKSRVARHRLVYDALADAMQRGIHALAIVAYTPE 97


>gi|124383925|ref|YP_001029303.1| BolA-like protein [Burkholderia mallei NCTC 10229]
 gi|126450215|ref|YP_001080761.1| BolA-like protein [Burkholderia mallei NCTC 10247]
 gi|254200042|ref|ZP_04906408.1| BolA/YrbA family protein [Burkholderia mallei FMH]
 gi|254297328|ref|ZP_04964781.1| BolA/YrbA family protein [Burkholderia pseudomallei 406e]
 gi|124291945|gb|ABN01214.1| BolA-like protein [Burkholderia mallei NCTC 10229]
 gi|126243085|gb|ABO06178.1| BolA-like protein [Burkholderia mallei NCTC 10247]
 gi|147749638|gb|EDK56712.1| BolA/YrbA family protein [Burkholderia mallei FMH]
 gi|157807658|gb|EDO84828.1| BolA/YrbA family protein [Burkholderia pseudomallei 406e]
          Length = 104

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 29/45 (64%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          Y   I++  F GK+R+ +H++VYD+L + M   +HAL+I    P+
Sbjct: 51 YTVTIVAAAFAGKSRVARHRLVYDALADAMQRGIHALAIVAYTPE 95


>gi|172060876|ref|YP_001808528.1| BolA family protein [Burkholderia ambifaria MC40-6]
 gi|171993393|gb|ACB64312.1| BolA family protein [Burkholderia ambifaria MC40-6]
          Length = 102

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          Y   I+S  F GK R+ +H++VYD+L + M   +HAL+I    P+
Sbjct: 51 YTVTIVSAAFAGKPRVARHRLVYDALADAMQRGIHALAIVAYTPE 95


>gi|134277890|ref|ZP_01764605.1| BolA/YrbA family protein [Burkholderia pseudomallei 305]
 gi|167893829|ref|ZP_02481231.1| BolA/YrbA family protein [Burkholderia pseudomallei 7894]
 gi|167902280|ref|ZP_02489485.1| BolA/YrbA family protein [Burkholderia pseudomallei NCTC 13177]
 gi|167918549|ref|ZP_02505640.1| BolA/YrbA family protein [Burkholderia pseudomallei BCC215]
 gi|217421648|ref|ZP_03453152.1| BolA/YrbA family protein [Burkholderia pseudomallei 576]
 gi|237812659|ref|YP_002897110.1| BolA/YrbA family protein [Burkholderia pseudomallei MSHR346]
 gi|254189166|ref|ZP_04895677.1| BolA/YrbA family protein [Burkholderia pseudomallei Pasteur
          52237]
 gi|254260659|ref|ZP_04951713.1| BolA/YrbA family protein [Burkholderia pseudomallei 1710a]
 gi|134251540|gb|EBA51619.1| BolA/YrbA family protein [Burkholderia pseudomallei 305]
 gi|157936845|gb|EDO92515.1| BolA/YrbA family protein [Burkholderia pseudomallei Pasteur
          52237]
 gi|217395390|gb|EEC35408.1| BolA/YrbA family protein [Burkholderia pseudomallei 576]
 gi|237502968|gb|ACQ95286.1| BolA/YrbA family protein [Burkholderia pseudomallei MSHR346]
 gi|254219348|gb|EET08732.1| BolA/YrbA family protein [Burkholderia pseudomallei 1710a]
          Length = 106

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 29/45 (64%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          Y   I++  F GK+R+ +H++VYD+L + M   +HAL+I    P+
Sbjct: 53 YTVTIVAAAFAGKSRVARHRLVYDALADAMQRGIHALAIVAYTPE 97


>gi|254197556|ref|ZP_04903978.1| BolA/YrbA family protein [Burkholderia pseudomallei S13]
 gi|169654297|gb|EDS86990.1| BolA/YrbA family protein [Burkholderia pseudomallei S13]
          Length = 104

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 29/45 (64%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          Y   I++  F GK+R+ +H++VYD+L + M   +HAL+I    P+
Sbjct: 51 YTVTIVAAAFAGKSRVARHRLVYDALADAMQRGIHALAIVAYTPE 95


>gi|115351950|ref|YP_773789.1| BolA family protein [Burkholderia ambifaria AMMD]
 gi|115281938|gb|ABI87455.1| transcriptional regulator, BolA protein family [Burkholderia
          ambifaria AMMD]
          Length = 102

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          Y   I+S  F GK R+ +H++VYD+L + M   +HAL+I    P+
Sbjct: 51 YTVTIVSAAFAGKPRVARHRLVYDALADAMQRGIHALAIVAYTPE 95


>gi|237805389|ref|ZP_04592093.1| bolA protein [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331026496|gb|EGI06551.1| bolA protein [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 88

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   HY A ++S++F G +++++HQ VY +LG  MG   HAL++ T  P+
Sbjct: 22 GQQTHYKAVLVSDQFEGLSQVKRHQKVYATLGALMGE-FHALALHTYTPE 70


>gi|53719055|ref|YP_108041.1| hypothetical protein BPSL1419 [Burkholderia pseudomallei K96243]
 gi|52209469|emb|CAH35421.1| conserved hypothetical protein [Burkholderia pseudomallei K96243]
          Length = 104

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 29/45 (64%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          Y   I++  F GK+R+ +H++VYD+L + M   +HAL+I    P+
Sbjct: 51 YTVTIVAAAFAGKSRVARHRLVYDALADAMQRGIHALAIVAYTPE 95


>gi|170720550|ref|YP_001748238.1| BolA family protein [Pseudomonas putida W619]
 gi|169758553|gb|ACA71869.1| BolA family protein [Pseudomonas putida W619]
          Length = 99

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 31/46 (67%), Gaps = 1/46 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G   HY A I+SE+F G N +++HQ VY ++G  MG  +HAL+I T
Sbjct: 31 GQETHYKAVIVSEQFAGLNSVKRHQKVYATMGELMGQ-IHALAIHT 75


>gi|325276972|ref|ZP_08142651.1| BolA family protein [Pseudomonas sp. TJI-51]
 gi|324097894|gb|EGB96061.1| BolA family protein [Pseudomonas sp. TJI-51]
          Length = 98

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 31/46 (67%), Gaps = 1/46 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G   HY A I+SE+F G N +++HQ VY ++G  MG  +HAL+I T
Sbjct: 31 GQETHYKAVIVSEQFAGLNSVKRHQKVYATMGELMGQ-IHALAIHT 75


>gi|57525996|ref|NP_001003525.1| bolA-like protein 3 [Danio rerio]
 gi|50417823|gb|AAH78189.1| Zgc:100870 protein [Danio rerio]
          Length = 104

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 45/72 (62%), Gaps = 3/72 (4%)

Query: 7   EIEKMIKKGIPQSI-VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN 64
            I +++K+  PQ+  + + D++G  G  Y   I S+EF+GK  +QQHQ+V  +L +++  
Sbjct: 32  RIAQVLKEKFPQATALKVVDISGGCGAMYEIHIESDEFKGKRTVQQHQLVNQALKDEI-K 90

Query: 65  ALHALSIKTSVP 76
           A+H L I T VP
Sbjct: 91  AMHGLRIFTDVP 102


>gi|330801601|ref|XP_003288814.1| hypothetical protein DICPUDRAFT_153091 [Dictyostelium purpureum]
 gi|325081150|gb|EGC34677.1| hypothetical protein DICPUDRAFT_153091 [Dictyostelium purpureum]
          Length = 139

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 6/75 (8%)

Query: 8   IEKMIKKGIPQSIVTIHDL------AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNK 61
           +EK+  K  P  +  I++        G   H+   I+S EF GK  I QH+ + ++L ++
Sbjct: 35  VEKLTNKFTPSHLEVINESYMHSVPRGSETHFKVIIVSNEFDGKTMISQHRSINETLKDE 94

Query: 62  MGNALHALSIKTSVP 76
             N +HALSI ++ P
Sbjct: 95  FKNGVHALSIHSTTP 109


>gi|190575142|ref|YP_001972987.1| putative BolA-like morphology switching protein [Stenotrophomonas
          maltophilia K279a]
 gi|190013064|emb|CAQ46696.1| putative BolA-like morphology switching protein [Stenotrophomonas
          maltophilia K279a]
          Length = 91

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 45/90 (50%), Gaps = 13/90 (14%)

Query: 3  MNPHEIEKM---IKKGIPQSIVTI---------HDLAGDGN-HYAAEIISEEFRGKNRIQ 49
          MN   IE+M   +++ +  S++ I         H  A DG  H+   ++SE F G   + 
Sbjct: 1  MNAERIERMRDALQQALAPSVLEIEDDSHRHAGHAGARDGRGHFNVHVVSERFAGLGPLA 60

Query: 50 QHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
          +H+ VY +LG  M   +HALSI+   P  Q
Sbjct: 61 RHRAVYAALGAMMETDIHALSIRALTPSEQ 90


>gi|307246205|ref|ZP_07528286.1| hypothetical protein appser1_14090 [Actinobacillus
          pleuropneumoniae serovar 1 str. 4074]
 gi|307255185|ref|ZP_07537003.1| hypothetical protein appser9_14210 [Actinobacillus
          pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307259623|ref|ZP_07541347.1| hypothetical protein appser11_14210 [Actinobacillus
          pleuropneumoniae serovar 11 str. 56153]
 gi|306852814|gb|EFM85038.1| hypothetical protein appser1_14090 [Actinobacillus
          pleuropneumoniae serovar 1 str. 4074]
 gi|306862058|gb|EFM94034.1| hypothetical protein appser9_14210 [Actinobacillus
          pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306866268|gb|EFM98132.1| hypothetical protein appser11_14210 [Actinobacillus
          pleuropneumoniae serovar 11 str. 56153]
          Length = 86

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 43/72 (59%), Gaps = 3/72 (4%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P ++E+++K  +P +   IH   G+ +HY   ++S+E    ++++Q Q VY  LG   
Sbjct: 1  MEPKQLEEILKNALPHA-SEIHA-QGENSHYGVIVVSDELAQLSKVKQQQAVYAPLGEYF 58

Query: 63 -GNALHALSIKT 73
            NA+HAL+IK 
Sbjct: 59 TTNAIHALTIKV 70


>gi|255640600|gb|ACU20585.1| unknown [Glycine max]
          Length = 93

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 47/80 (58%), Gaps = 2/80 (2%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          M +   ++E  +K  +  S + + D++G  G  +  EI+SE+F GK  +++H+MV  +L 
Sbjct: 1  MGVTKEQVELSLKAKLNPSHLEVVDISGGCGASFVVEIVSEQFEGKRLLERHRMVNAALE 60

Query: 60 NKMGNALHALSIKTSVPDSQ 79
           +M   +HALSIK +V   Q
Sbjct: 61 EEMKQ-IHALSIKKAVTPEQ 79


>gi|125551040|gb|EAY96749.1| hypothetical protein OsI_18669 [Oryza sativa Indica Group]
          Length = 364

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 31/45 (68%)

Query: 32  HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+   ++SE F+GK+ +++H+ VYD L +++ N LHALSI    P
Sbjct: 317 HFNVRVVSEAFQGKSLLKRHRAVYDLLQDELKNGLHALSIDAKTP 361


>gi|303287552|ref|XP_003063065.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226455701|gb|EEH53004.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 99

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 30/46 (65%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+  E++SE F GK  + +H+MVY  L  ++ + +HALS+KT  P
Sbjct: 49 THFNVEVVSEAFSGKLPVARHRMVYALLDEEIKDGVHALSLKTKTP 94


>gi|154298721|ref|XP_001549782.1| hypothetical protein BC1G_11252 [Botryotinia fuckeliana B05.10]
 gi|150857648|gb|EDN32840.1| hypothetical protein BC1G_11252 [Botryotinia fuckeliana B05.10]
          Length = 178

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 45/71 (63%), Gaps = 2/71 (2%)

Query: 7   EIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
           +I  ++   I  + + + D++G  G+ YA E++SE+FRG N ++Q ++V   LG+++   
Sbjct: 109 KIWSLLYNEIAPTKLQVQDISGGCGSMYAIEVVSEKFRGLNMLKQQRLVNKILGDEI-KG 167

Query: 66  LHALSIKTSVP 76
            H + ++TSVP
Sbjct: 168 WHGVQLRTSVP 178


>gi|90415757|ref|ZP_01223691.1| toluene-tolerance protein, putative [marine gamma proteobacterium
          HTCC2207]
 gi|90333080|gb|EAS48250.1| toluene-tolerance protein, putative [marine gamma proteobacterium
          HTCC2207]
          Length = 79

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 45/75 (60%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MNP +++ +++  IP       ++  +G+H+    I E F GK  +Q+ Q++Y +L +++
Sbjct: 1  MNPEDVKALLENAIPN---CQFEVVSEGSHFNITAIGEVFDGKRPVQRQQLIYAALNSEI 57

Query: 63 GN-ALHALSIKTSVP 76
           + A+HA+++K   P
Sbjct: 58 SSGAMHAVNMKIFTP 72


>gi|157093009|gb|ABV22159.1| BolA-like protein [Perkinsus chesapeaki]
          Length = 103

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 32/51 (62%), Gaps = 4/51 (7%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM----GNALHALSIKTSVPD 77
           H+  E++S+EF+G NR+Q+ +++Y  L N+M    G  +HALS+     D
Sbjct: 45 THFRVEVVSDEFKGLNRVQRQKLMYSILSNEMDSTPGGTIHALSMSCKTAD 95


>gi|307261764|ref|ZP_07543430.1| hypothetical protein appser12_13230 [Actinobacillus
          pleuropneumoniae serovar 12 str. 1096]
 gi|306868582|gb|EFN00393.1| hypothetical protein appser12_13230 [Actinobacillus
          pleuropneumoniae serovar 12 str. 1096]
          Length = 86

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 43/72 (59%), Gaps = 3/72 (4%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P ++E+++K  +P +   IH   G+ +HY   ++S+E    ++++Q Q VY  LG   
Sbjct: 1  MEPKQLEEILKNALPHA-SEIHA-QGENSHYGVIVVSDELAQLSKVKQQQAVYAPLGEYF 58

Query: 63 -GNALHALSIKT 73
            NA+HAL+IK 
Sbjct: 59 KTNAIHALTIKV 70


>gi|125604958|gb|EAZ43994.1| hypothetical protein OsJ_28616 [Oryza sativa Japonica Group]
          Length = 366

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 31/45 (68%)

Query: 32  HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+   ++SE F+GK+ +++H+ VYD L +++ N LHALSI    P
Sbjct: 319 HFNVRVVSEAFQGKSLLKRHRAVYDLLQDELKNGLHALSIDAKTP 363


>gi|30424938|ref|NP_780486.1| bolA-like protein 3 [Mus musculus]
 gi|81900086|sp|Q8CEI1|BOLA3_MOUSE RecName: Full=BolA-like protein 3
 gi|26389531|dbj|BAC25747.1| unnamed protein product [Mus musculus]
 gi|74137567|dbj|BAE35819.1| unnamed protein product [Mus musculus]
 gi|74203481|dbj|BAE20895.1| unnamed protein product [Mus musculus]
 gi|109733093|gb|AAI16950.1| BolA-like 3 (E. coli) [Mus musculus]
 gi|109734219|gb|AAI16948.1| BolA-like 3 (E. coli) [Mus musculus]
 gi|148666663|gb|EDK99079.1| bolA-like 3 (E. coli) [Mus musculus]
          Length = 110

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 45/74 (60%), Gaps = 3/74 (4%)

Query: 7   EIEKMIKKGIPQSI-VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN 64
           ++ +++K+  P++  + + D++G  G  Y  +I SEEF+ K  +QQHQMV  +L  ++  
Sbjct: 38  KVTQVLKEKFPRATAIQVTDISGGCGAMYEIKIESEEFKEKRTVQQHQMVNQALKEEI-K 96

Query: 65  ALHALSIKTSVPDS 78
            +H L I TSVP  
Sbjct: 97  GMHGLRIFTSVPKC 110


>gi|91788446|ref|YP_549398.1| transcriptional regulator BolA [Polaromonas sp. JS666]
 gi|91697671|gb|ABE44500.1| transcriptional regulator, BolA protein family [Polaromonas sp.
          JS666]
          Length = 97

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 30/45 (66%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIK 72
          G G H+   I S  F GK+R+ +H++VYD++ N +   LHAL+I+
Sbjct: 50 GFGTHFRVRIASPAFAGKSRVARHRLVYDAMQNFIDQGLHALAIE 94


>gi|115478278|ref|NP_001062734.1| Os09g0270900 [Oryza sativa Japonica Group]
 gi|48717025|dbj|BAD23715.1| putative plastid protein SufE [Oryza sativa Japonica Group]
 gi|49388898|dbj|BAD26123.1| putative plastid protein SufE [Oryza sativa Japonica Group]
 gi|113630967|dbj|BAF24648.1| Os09g0270900 [Oryza sativa Japonica Group]
          Length = 366

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 31/45 (68%)

Query: 32  HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+   ++SE F+GK+ +++H+ VYD L +++ N LHALSI    P
Sbjct: 319 HFNVRVVSEAFQGKSLLKRHRAVYDLLQDELKNGLHALSIDAKTP 363


>gi|330318580|gb|AEC10959.1| bola-like family protein [Camellia sinensis]
          Length = 90

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 17 PQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          P  +  I    G G  +A EI+SE+F GK  +++H+MV  +L  +M   +HALSIK ++ 
Sbjct: 18 PSHLEVIDTSGGCGASFAIEIVSEKFEGKRLLERHRMVNAALAEEM-KEIHALSIKKALT 76

Query: 77 DSQ 79
            Q
Sbjct: 77 PEQ 79


>gi|224060445|ref|XP_002300203.1| predicted protein [Populus trichocarpa]
 gi|222847461|gb|EEE85008.1| predicted protein [Populus trichocarpa]
          Length = 93

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 44/76 (57%), Gaps = 2/76 (2%)

Query: 1  MSMNPHEIEKMIKKGI-PQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          M +   ++E  +K  + P  +  +    G G  +A EI+SE+F GK  +++H++V  +L 
Sbjct: 1  MGVTKEQVESTLKSKLNPSHLEVVDTSGGCGASFAIEIVSEQFEGKRLLERHRLVNAALV 60

Query: 60 NKMGNALHALSIKTSV 75
           +M   +HALSIK +V
Sbjct: 61 EEM-KEIHALSIKKAV 75


>gi|295676530|ref|YP_003605054.1| BolA family protein [Burkholderia sp. CCGE1002]
 gi|295436373|gb|ADG15543.1| BolA family protein [Burkholderia sp. CCGE1002]
          Length = 103

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 29/45 (64%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          ++  I++  F GK R+ +H+MVYD+L + M   +HAL+I    P+
Sbjct: 52 FSVTIVAVAFAGKPRVARHRMVYDALADAMQRGIHALAITAYTPE 96


>gi|209517044|ref|ZP_03265892.1| BolA family protein [Burkholderia sp. H160]
 gi|209502575|gb|EEA02583.1| BolA family protein [Burkholderia sp. H160]
          Length = 103

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 29/45 (64%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          ++  I++  F GK R+ +H+MVYD+L + M   +HAL+I    P+
Sbjct: 52 FSVTIVAVAFAGKPRVARHRMVYDALADAMQRGIHALAITAYTPE 96


>gi|194220592|ref|XP_001491212.2| PREDICTED: similar to bolA-like 3 [Equus caballus]
          Length = 110

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 46/73 (63%), Gaps = 3/73 (4%)

Query: 7   EIEKMIKKGIPQ-SIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN 64
           ++ +++K+  P+ +++ + D++G  G  Y  +I SEEF+ K  +QQH+MV  +L  ++  
Sbjct: 38  KVTQILKEKFPRATVIKVTDISGGCGAMYEIQIESEEFKEKRTVQQHRMVNQALKEEI-K 96

Query: 65  ALHALSIKTSVPD 77
            +H L I TSVP 
Sbjct: 97  GMHGLRIFTSVPK 109


>gi|159472929|ref|XP_001694597.1| predicted protein [Chlamydomonas reinhardtii]
 gi|158276821|gb|EDP02592.1| predicted protein [Chlamydomonas reinhardtii]
          Length = 91

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 38/58 (65%), Gaps = 1/58 (1%)

Query: 21 VTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHAL-SIKTSVPD 77
           +I D+ GDG H + +++S+ F GKN +Q+ +MVY ++  ++   +HA+ ++ T  P+
Sbjct: 31 CSISDVYGDGRHVSIDVVSKLFEGKNSMQRQRMVYKAIWLELQETVHAVDAMTTKTPE 88


>gi|146413202|ref|XP_001482572.1| hypothetical protein PGUG_05592 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 137

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 32/47 (68%), Gaps = 1/47 (2%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-ALHALSIKTSVP 76
           +H+  EI+S+EF GKN   +H+MVY  L +++ N  +HAL +KT  P
Sbjct: 83  SHFQIEIVSDEFEGKNMPTRHRMVYQLLSDELQNKGVHALQMKTKTP 129


>gi|167854680|ref|ZP_02477460.1| hypothetical protein HPS_01272 [Haemophilus parasuis 29755]
 gi|219870957|ref|YP_002475332.1| morphology/transcription regulator BolA family protein
          [Haemophilus parasuis SH0165]
 gi|167854217|gb|EDS25451.1| hypothetical protein HPS_01272 [Haemophilus parasuis 29755]
 gi|219691161|gb|ACL32384.1| morphology/transcription regulator BolA family protein
          [Haemophilus parasuis SH0165]
          Length = 85

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 41/72 (56%), Gaps = 4/72 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P +IE+++K  +    V +    G+ +HY    +S+ F   ++++Q QM+Y  L    
Sbjct: 1  MEPKQIEEILKNALELDEVYVQ---GENSHYGVIAVSDSFATMSKVKQQQMIYGPLTEFF 57

Query: 63 G-NALHALSIKT 73
            NA+HAL+IKT
Sbjct: 58 ATNAIHALTIKT 69


>gi|190348940|gb|EDK41494.2| hypothetical protein PGUG_05592 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 137

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 32/47 (68%), Gaps = 1/47 (2%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-ALHALSIKTSVP 76
           +H+  EI+S+EF GKN   +H+MVY  L +++ N  +HAL +KT  P
Sbjct: 83  SHFQIEIVSDEFEGKNMPTRHRMVYQLLSDELQNKGVHALQMKTKTP 129


>gi|302680745|ref|XP_003030054.1| hypothetical protein SCHCODRAFT_57108 [Schizophyllum commune
          H4-8]
 gi|300103745|gb|EFI95151.1| hypothetical protein SCHCODRAFT_57108 [Schizophyllum commune
          H4-8]
          Length = 108

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 34/48 (70%), Gaps = 3/48 (6%)

Query: 27 AGDGN---HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSI 71
          AG GN   H++ +++S+ FRGK  IQ+H+M++ +L  ++   LH++S+
Sbjct: 47 AGGGNGETHFSIQVVSDAFRGKTTIQRHRMIHSALSEELAQGLHSISL 94


>gi|307293525|ref|ZP_07573369.1| BolA family protein [Sphingobium chlorophenolicum L-1]
 gi|306879676|gb|EFN10893.1| BolA family protein [Sphingobium chlorophenolicum L-1]
          Length = 95

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 46/82 (56%), Gaps = 13/82 (15%)

Query: 7  EIEKMIKKGI-PQSIVTI-----------HDLAGDGNHYAAEIISEEFRGKNRIQQHQMV 54
          EIE  ++  + P+ +  I           HD +G+ +H+  +I+SE F G+NR+ + ++V
Sbjct: 12 EIEARLRAALTPERLAVIDDSEKHRGHAGHDGSGE-SHFTVDIVSERFTGQNRVARQRLV 70

Query: 55 YDSLGNKMGNALHALSIKTSVP 76
            +L + + + +HAL+IK   P
Sbjct: 71 NAALADLLRDKVHALAIKARAP 92


>gi|86609803|ref|YP_478565.1| BolA protein [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558345|gb|ABD03302.1| BolA protein [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 96

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 31/45 (68%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          Y  +++S  F GK  +Q+H++VY +L   MG ++HAL+++T  P+
Sbjct: 40 YRVQVVSPLFVGKTTLQRHRLVYAALAEHMGRSIHALALQTYSPE 84


>gi|311252371|ref|XP_003125074.1| PREDICTED: hypothetical protein LOC100520299 [Sus scrofa]
          Length = 175

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 45/73 (61%), Gaps = 3/73 (4%)

Query: 6   HEIEKMIKKGIPQSI-VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG 63
            ++ +++K+  P++  + + D++G  G  Y  +I SEEF+ K  +QQHQMV  +L  ++ 
Sbjct: 102 RKVTQILKEKFPRATAIKVTDISGGCGAMYEIQIESEEFKEKRTVQQHQMVNQALKEEI- 160

Query: 64  NALHALSIKTSVP 76
             +H L I TSVP
Sbjct: 161 KGMHGLRIFTSVP 173


>gi|296135909|ref|YP_003643151.1| BolA family protein [Thiomonas intermedia K12]
 gi|295796031|gb|ADG30821.1| BolA family protein [Thiomonas intermedia K12]
          Length = 98

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 43/80 (53%), Gaps = 10/80 (12%)

Query: 7  EIEKMIKKGI-PQSIVTIHDLAGD---------GNHYAAEIISEEFRGKNRIQQHQMVYD 56
           IE ++++ + P+++    D A           G+H+   I+S  F G +R+ +H++VYD
Sbjct: 10 RIETLLQQALKPETLQVTDDSAAHAGHGGFDAMGSHFRVRIVSARFAGASRLARHRLVYD 69

Query: 57 SLGNKMGNALHALSIKTSVP 76
          +L + M + +HAL +    P
Sbjct: 70 ALASMMHHEIHALVLDCQAP 89


>gi|118602177|ref|YP_903392.1| BolA family protein [Candidatus Ruthia magnifica str. Cm
          (Calyptogena magnifica)]
 gi|118567116|gb|ABL01921.1| BolA family protein [Candidatus Ruthia magnifica str. Cm
          (Calyptogena magnifica)]
          Length = 76

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 41/76 (53%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EI+  I+ GI  S VT   + GDG   + +++S  F G   + + +MV   +  ++
Sbjct: 1  MTLEEIQAKIQMGIKNSTVT---MGGDGCSCSTKVVSSIFEGMPLLARQKMVLAVMNEEI 57

Query: 63 GN-ALHALSIKTSVPD 77
           N  LHALSIKT  P+
Sbjct: 58 TNGTLHALSIKTRTPE 73


>gi|78369266|ref|NP_001030529.1| bolA-like protein 3 [Bos taurus]
 gi|110278898|sp|Q3SZ84|BOLA3_BOVIN RecName: Full=BolA-like protein 3
 gi|74267980|gb|AAI03057.1| BolA homolog 3 (E. coli) [Bos taurus]
 gi|296482756|gb|DAA24871.1| bolA-like protein 3 [Bos taurus]
          Length = 110

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 45/73 (61%), Gaps = 3/73 (4%)

Query: 7   EIEKMIKKGIPQSI-VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN 64
           ++ +++K+  P++  + + D++G  G  Y  +I SEEF+ K  +QQHQMV  +L  ++  
Sbjct: 38  KVTQILKEKFPRATAIKVTDISGGCGAMYEIKIESEEFKEKRTVQQHQMVNQALKEEI-K 96

Query: 65  ALHALSIKTSVPD 77
            +H L I TSVP 
Sbjct: 97  GMHGLRIFTSVPK 109


>gi|223041898|ref|ZP_03612084.1| hypothetical protein AM202_0494 [Actinobacillus minor 202]
 gi|223017314|gb|EEF15739.1| hypothetical protein AM202_0494 [Actinobacillus minor 202]
          Length = 86

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 42/71 (59%), Gaps = 3/71 (4%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P ++E+++K  +  +   IH   G+ +HY   ++S+     +R++Q Q VY  LG+  
Sbjct: 1  MEPKQLEEILKAALTDA-TEIHA-QGENSHYGVIVVSDSLAALSRVKQQQAVYAPLGDLF 58

Query: 63 G-NALHALSIK 72
            NA+HAL+IK
Sbjct: 59 ATNAIHALTIK 69


>gi|149910600|ref|ZP_01899238.1| putative BolA/YrbA family protein, transcriptional regulator
          [Moritella sp. PE36]
 gi|149806328|gb|EDM66303.1| putative BolA/YrbA family protein, transcriptional regulator
          [Moritella sp. PE36]
          Length = 85

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 33/51 (64%), Gaps = 1/51 (1%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVPD 77
          G+G+HY    ++E F G NR+++ Q +Y  L  ++  N++HALSIK   P+
Sbjct: 23 GEGSHYEVIAVAEMFVGMNRVKKQQAIYAPLKEQIASNSIHALSIKAYTPE 73


>gi|119468452|ref|ZP_01611543.1| regulator protein [Alteromonadales bacterium TW-7]
 gi|119447960|gb|EAW29225.1| regulator protein [Alteromonadales bacterium TW-7]
          Length = 103

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G  +H+   ++SEEF GK  +Q+H+ + + L  ++ N +HAL+I T  PD
Sbjct: 32 GTDSHFKVIVVSEEFLGKRLLQRHRQINEILKEELANHIHALAIHTYTPD 81


>gi|308809970|ref|XP_003082294.1| BolA (bacterial stress-induced morphogen)-related protein (ISS)
          [Ostreococcus tauri]
 gi|116060762|emb|CAL57240.1| BolA (bacterial stress-induced morphogen)-related protein (ISS)
          [Ostreococcus tauri]
          Length = 75

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query: 7  EIEKMIKKGIPQSIVTIHDL-AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
          EIE+++   +  + + + D+ A  G+ +   I+S +F G  R+Q+H+MV+++LG+ M   
Sbjct: 6  EIERLLTDALAPTELDVVDVSASCGSAFDVSIVSAKFTGVGRLQRHRMVHEALGDVMSR- 64

Query: 66 LHALSIKTSVP 76
          +HA+ I    P
Sbjct: 65 VHAMKIDAKAP 75


>gi|196010595|ref|XP_002115162.1| hypothetical protein TRIADDRAFT_28548 [Trichoplax adhaerens]
 gi|190582545|gb|EDV22618.1| hypothetical protein TRIADDRAFT_28548 [Trichoplax adhaerens]
          Length = 85

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 45/74 (60%), Gaps = 2/74 (2%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          MS++   IE  +K  +  S V + D++G  G+ Y+  I+SE+F GK  +Q+H++V   L 
Sbjct: 1  MSVSADTIENKLKNELNASFVKVEDISGGCGSSYSVIIVSEKFEGKPLLQRHRLVNACLE 60

Query: 60 NKMGNALHALSIKT 73
           ++  ++HA S KT
Sbjct: 61 EEL-KSIHAFSQKT 73


>gi|260596180|ref|YP_003208751.1| hypothetical protein CTU_03880 [Cronobacter turicensis z3032]
 gi|260215357|emb|CBA27358.1| Uncharacterized protein yrbA [Cronobacter turicensis z3032]
          Length = 85

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 3/75 (4%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M  HEI+ ++   +P  +  +H  +GDG+H+    + E F   +R+++ Q VY  L   +
Sbjct: 1  MENHEIQTVLMNALP--LQEVHVSSGDGSHFQVIAVGELFGAMSRVKKQQAVYGPLMEFI 58

Query: 63 G-NALHALSIKTSVP 76
            N +HA+SIKT  P
Sbjct: 59 ADNRIHAVSIKTFTP 73


>gi|307102556|gb|EFN50827.1| hypothetical protein CHLNCDRAFT_15183 [Chlorella variabilis]
          Length = 81

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 29/46 (63%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+  EI+S  F GK  +Q+H+MVY  L  ++   +HAL++KT  P
Sbjct: 34 THFKVEIVSAAFEGKKPVQRHRMVYQLLQAEIDAGVHALALKTKTP 79


>gi|327289726|ref|XP_003229575.1| PREDICTED: bolA-like protein 3-like [Anolis carolinensis]
          Length = 87

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 45/71 (63%), Gaps = 3/71 (4%)

Query: 8  IEKMIKKGIPQSI-VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
          + +++K+  PQ+  + + D++G  G  Y   I SE+F+ K  +QQHQMV ++L  ++  +
Sbjct: 14 VAEILKEKFPQAAAIKVVDISGGCGAMYEIHIESEDFKEKRTVQQHQMVNEALSEEI-KS 72

Query: 66 LHALSIKTSVP 76
          +H L I TSVP
Sbjct: 73 MHGLRIFTSVP 83


>gi|73541087|ref|YP_295607.1| transcriptional regulator BolA [Ralstonia eutropha JMP134]
 gi|72118500|gb|AAZ60763.1| transcriptional regulator BolA [Ralstonia eutropha JMP134]
          Length = 104

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (51%), Gaps = 10/81 (12%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHD----------LAGDGNHYAAEIISEEFRGKNRIQQ 50
          M+ +P  IE M+++ +  S + + D           A  G HY   I+SE F G  R+ +
Sbjct: 1  MAADPATIEAMLREALAPSHLIVRDDSALHAGHAGAASGGGHYDVTIVSERFTGHTRVAR 60

Query: 51 HQMVYDSLGNKMGNALHALSI 71
          H+MVYD+L       +HAL++
Sbjct: 61 HRMVYDALRGLFPTQIHALAV 81


>gi|152972114|ref|YP_001337260.1| BolA family transcriptional regulator [Klebsiella pneumoniae
          subsp. pneumoniae MGH 78578]
 gi|206578425|ref|YP_002236398.1| BolA/YrbA family protein [Klebsiella pneumoniae 342]
 gi|238896697|ref|YP_002921442.1| putative transcriptional regulator [Klebsiella pneumoniae
          NTUH-K2044]
 gi|262042749|ref|ZP_06015903.1| BolA/YrbA family protein [Klebsiella pneumoniae subsp.
          rhinoscleromatis ATCC 13884]
 gi|288933382|ref|YP_003437441.1| BolA family protein [Klebsiella variicola At-22]
 gi|290511567|ref|ZP_06550936.1| yrbA [Klebsiella sp. 1_1_55]
 gi|150956963|gb|ABR78993.1| putative transcriptional regulator (BolA family) [Klebsiella
          pneumoniae subsp. pneumoniae MGH 78578]
 gi|206567483|gb|ACI09259.1| BolA/YrbA family protein [Klebsiella pneumoniae 342]
 gi|238549024|dbj|BAH65375.1| putative transcriptional regulator [Klebsiella pneumoniae subsp.
          pneumoniae NTUH-K2044]
 gi|259039974|gb|EEW41091.1| BolA/YrbA family protein [Klebsiella pneumoniae subsp.
          rhinoscleromatis ATCC 13884]
 gi|288888111|gb|ADC56429.1| BolA family protein [Klebsiella variicola At-22]
 gi|289776560|gb|EFD84559.1| yrbA [Klebsiella sp. 1_1_55]
          Length = 84

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 41/75 (54%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M  HEI+ ++   +P   V +   +GDG+H+    + E F G +R+++ Q VY  L   +
Sbjct: 1  MENHEIQTVLMNALPLQEVHV---SGDGSHFQVIAVGEMFDGMSRVKKQQSVYAPLMEYI 57

Query: 63 G-NALHALSIKTSVP 76
            N +HALSIK   P
Sbjct: 58 ADNRIHALSIKAFTP 72


>gi|294340131|emb|CAZ88502.1| putative BolA protein [Thiomonas sp. 3As]
          Length = 98

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 30/47 (63%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G+H+   I+S  F G +R+ +H++VYD+L + M + +HAL +    P
Sbjct: 43 GSHFRVRIVSARFAGASRLARHRLVYDALASMMHHEIHALVLDCQAP 89


>gi|299751569|ref|XP_001830352.2| hypothetical protein CC1G_01988 [Coprinopsis cinerea okayama7#130]
 gi|298409434|gb|EAU91499.2| hypothetical protein CC1G_01988 [Coprinopsis cinerea okayama7#130]
          Length = 108

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 28  GDG-NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           G G  H+   I+S EF+GK  +Q+H+M+Y  L  +  + LHALS+ T   +
Sbjct: 50  GSGETHFTLNIVSNEFKGKTSMQRHRMIYSLLNEEFASGLHALSLHTKTEE 100


>gi|217970664|ref|YP_002355898.1| BolA family protein [Thauera sp. MZ1T]
 gi|217507991|gb|ACK55002.1| BolA family protein [Thauera sp. MZ1T]
          Length = 95

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 31/44 (70%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G HY   I+SE F+G +R+ + +M+YD++G+ M   +HAL+I+ 
Sbjct: 41 GGHYRVFIVSEAFQGCSRVVRQRMIYDAVGDMMHKDIHALAIRA 84


>gi|73980977|ref|XP_855121.1| PREDICTED: similar to bolA-like 3 [Canis familiaris]
          Length = 110

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 44/72 (61%), Gaps = 3/72 (4%)

Query: 7   EIEKMIKKGIP-QSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN 64
           ++ +++K+  P  + + + D++G  G  Y  +I SEEF+ K  +QQHQMV  +L  ++  
Sbjct: 38  KVTRILKEKFPGATAIKVTDISGGCGAMYEIQIESEEFKEKRTVQQHQMVNQALKEEI-K 96

Query: 65  ALHALSIKTSVP 76
            +H L I TSVP
Sbjct: 97  GMHGLRIFTSVP 108


>gi|90422059|ref|YP_530429.1| BolA-like protein [Rhodopseudomonas palustris BisB18]
 gi|90104073|gb|ABD86110.1| transcriptional regulator BolA [Rhodopseudomonas palustris
          BisB18]
          Length = 91

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G   H+   I+S  F GK+RI++H+MV  +L  ++   LHAL+IK   P
Sbjct: 38 GGETHFRVNIVSAAFAGKSRIERHRMVNATLAEELAGQLHALAIKALAP 86


>gi|150951683|ref|XP_001388039.2| predicted protein [Scheffersomyces stipitis CBS 6054]
 gi|149388801|gb|EAZ64016.2| predicted protein [Pichia stipitis CBS 6054]
          Length = 86

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 50/78 (64%), Gaps = 2/78 (2%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          MS+    ++++I++ +  S+V + D++G  G  +A  I+S  F+GKN++ +H++V ++L 
Sbjct: 1  MSLTADSLKQIIQQRLEASLVQVEDMSGGCGQAFAVIIVSNIFQGKNKLLRHRLVNNALK 60

Query: 60 NKMGNALHALSIKTSVPD 77
           ++  ++HA + K   P+
Sbjct: 61 EEIA-SIHAFTQKGFTPE 77


>gi|113867526|ref|YP_726015.1| stress-induced morphogen (activity unknown) [Ralstonia eutropha
          H16]
 gi|113526302|emb|CAJ92647.1| Stress-induced morphogen (activity unknown) [Ralstonia eutropha
          H16]
          Length = 104

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 43/81 (53%), Gaps = 10/81 (12%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHD----------LAGDGNHYAAEIISEEFRGKNRIQQ 50
          M+ +P  IE M+++ +  S + + D           A  G HY   I+SE F G +R+ +
Sbjct: 1  MAADPATIEAMLREALAPSHLAVRDDSALHAGHAGAASGGGHYDVTIVSERFTGHSRVAR 60

Query: 51 HQMVYDSLGNKMGNALHALSI 71
          H+MVYD+L       +HAL++
Sbjct: 61 HRMVYDALRGLFPAQIHALAV 81


>gi|237809662|ref|YP_002894102.1| BolA family protein [Tolumonas auensis DSM 9187]
 gi|237501923|gb|ACQ94516.1| BolA family protein [Tolumonas auensis DSM 9187]
          Length = 84

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 41/76 (53%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+P EIE +++  +    + +    G+  HY    +S  F G +R+++ Q VY  L   +
Sbjct: 1  MHPTEIESILRAALALDELYVQ---GENGHYKVIAVSSLFAGMSRVKKQQTVYAPLKEHI 57

Query: 63 G-NALHALSIKTSVPD 77
            NA+HALSIK   P+
Sbjct: 58 ASNAIHALSIKAFTPE 73


>gi|118484302|gb|ABK94030.1| unknown [Populus trichocarpa]
          Length = 63

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 32/49 (65%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
           H+  +I+S +F G N +++H++VYD+L  ++ + LHALSI    P  +
Sbjct: 9  THFNVKIVSPKFDGLNLVKRHRLVYDALSEELQSGLHALSIVAKTPQEE 57


>gi|85713788|ref|ZP_01044778.1| BolA-like protein [Nitrobacter sp. Nb-311A]
 gi|85699692|gb|EAQ37559.1| BolA-like protein [Nitrobacter sp. Nb-311A]
          Length = 98

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 32/52 (61%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
          G   H+   I+S+ F GK+R+++H+M+   L  ++   +HAL+I+ + P  Q
Sbjct: 45 GGETHFRIHIVSQAFEGKSRVERHRMINTLLATELAGPVHALAIRATAPGEQ 96


>gi|297667316|ref|XP_002811943.1| PREDICTED: bolA-like protein 3-like [Pongo abelii]
          Length = 107

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 44/71 (61%), Gaps = 3/71 (4%)

Query: 8   IEKMIKKGIPQSI-VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
           + +++K+  P++  + + D++G  G  Y  +I SEEF+ K  +QQHQMV  +L  ++   
Sbjct: 36  VTQILKEKFPRATAIKVTDISGGCGAMYEIKIESEEFKEKRTVQQHQMVNQALKEEI-KG 94

Query: 66  LHALSIKTSVP 76
           +H L I TSVP
Sbjct: 95  MHGLRIFTSVP 105


>gi|85058188|ref|YP_453890.1| hypothetical protein SG0210 [Sodalis glossinidius str.
          'morsitans']
 gi|84778708|dbj|BAE73485.1| conserved hypothetical protein [Sodalis glossinidius str.
          'morsitans']
          Length = 84

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (62%), Gaps = 1/51 (1%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVPD 77
          GDG+H+    +SE+F G +R+++ Q +Y  L   +  N +HALSIK   PD
Sbjct: 23 GDGSHFQVIAVSEQFAGMSRVKKQQTIYAPLMEYISDNRIHALSIKAYTPD 73


>gi|114578132|ref|XP_001153723.1| PREDICTED: hypothetical protein isoform 2 [Pan troglodytes]
          Length = 117

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 44/71 (61%), Gaps = 3/71 (4%)

Query: 8   IEKMIKKGIPQSI-VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
           + +++K+  P++  + + D++G  G  Y  +I SEEF+ K  +QQHQMV  +L  ++   
Sbjct: 46  VTQILKEKFPRATAIKVTDISGGCGAMYEIKIESEEFKEKRTVQQHQMVNQALKEEI-KE 104

Query: 66  LHALSIKTSVP 76
           +H L I TSVP
Sbjct: 105 MHGLRIFTSVP 115


>gi|169600617|ref|XP_001793731.1| hypothetical protein SNOG_03150 [Phaeosphaeria nodorum SN15]
 gi|111068761|gb|EAT89881.1| hypothetical protein SNOG_03150 [Phaeosphaeria nodorum SN15]
          Length = 118

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 44/76 (57%), Gaps = 2/76 (2%)

Query: 3   MNPHEIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNK 61
           + P  IEK +K+G+    V I DL+G  G  Y A I+S +F  K  + +H++V  +L ++
Sbjct: 36  VTPEGIEKKLKEGLGAVYVEIADLSGGCGQMYEAIIVSPQFTKKTTLARHRLVNSTLKDE 95

Query: 62  MGNALHALSIKTSVPD 77
           +  A+HA + K   P+
Sbjct: 96  IA-AIHAWTPKCHTPE 110


>gi|261364793|ref|ZP_05977676.1| BolA protein [Neisseria mucosa ATCC 25996]
 gi|288566816|gb|EFC88376.1| BolA protein [Neisseria mucosa ATCC 25996]
          Length = 89

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPD 77
          G HYA  ++SE F G  RI++ +MV + L +   G  +HALSIK + PD
Sbjct: 37 GGHYAVTVVSEAFTGMKRIERQRMVQNLLQDLFAGGFIHALSIKAATPD 85


>gi|206560347|ref|YP_002231111.1| BolA-like protein [Burkholderia cenocepacia J2315]
 gi|198036388|emb|CAR52284.1| BolA-like protein [Burkholderia cenocepacia J2315]
          Length = 102

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 28/45 (62%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          +   I+S  F GK R+ +H++VYD+L + M   +HAL+I    P+
Sbjct: 51 FTVTIVSSAFAGKPRVARHRLVYDALADAMQRGIHALAIVAYTPE 95


>gi|221488823|gb|EEE27037.1| conserved hypothetical protein [Toxoplasma gondii GT1]
 gi|221509313|gb|EEE34882.1| conserved hypothetical protein [Toxoplasma gondii VEG]
          Length = 106

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDL-AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          +E+ +KK +  + + + D   G G  Y   I+S+ F GK  +Q+H+MV ++L +++ + +
Sbjct: 29 VEEKLKKALSPAFLKLEDKSCGCGAAYDCVIVSDAFDGKKLLQRHRMVNEALKDELPS-I 87

Query: 67 HALSIKTSVPD 77
          HA S++   PD
Sbjct: 88 HAFSMQCHTPD 98


>gi|332239074|ref|XP_003268730.1| PREDICTED: bolA-like protein 3-like isoform 1 [Nomascus leucogenys]
          Length = 107

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 44/71 (61%), Gaps = 3/71 (4%)

Query: 8   IEKMIKKGIPQSI-VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
           + +++K+  P++  + + D++G  G  Y  +I SEEF+ K  +QQHQMV  +L  ++   
Sbjct: 36  VTQILKEKFPRATAIKVTDISGGCGAMYEIKIESEEFKEKRTVQQHQMVNQALKEEI-KG 94

Query: 66  LHALSIKTSVP 76
           +H L I TSVP
Sbjct: 95  MHGLRIFTSVP 105


>gi|107028910|ref|YP_626005.1| BolA-like protein [Burkholderia cenocepacia AU 1054]
 gi|116689932|ref|YP_835555.1| BolA family protein [Burkholderia cenocepacia HI2424]
 gi|170733270|ref|YP_001765217.1| BolA family protein [Burkholderia cenocepacia MC0-3]
 gi|254247980|ref|ZP_04941301.1| BolA-like protein [Burkholderia cenocepacia PC184]
 gi|105898074|gb|ABF81032.1| transcriptional regulator, BolA protein family [Burkholderia
          cenocepacia AU 1054]
 gi|116648021|gb|ABK08662.1| transcriptional regulator, BolA protein family [Burkholderia
          cenocepacia HI2424]
 gi|124872756|gb|EAY64472.1| BolA-like protein [Burkholderia cenocepacia PC184]
 gi|169816512|gb|ACA91095.1| BolA family protein [Burkholderia cenocepacia MC0-3]
          Length = 102

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 28/45 (62%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          +   I+S  F GK R+ +H++VYD+L + M   +HAL+I    P+
Sbjct: 51 FTVTIVSSAFAGKPRVARHRLVYDALADAMQRGIHALAIVAYTPE 95


>gi|254786753|ref|YP_003074182.1| stress-induced morphogen [Teredinibacter turnerae T7901]
 gi|237683611|gb|ACR10875.1| stress-induced morphogen [Teredinibacter turnerae T7901]
          Length = 102

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 31/44 (70%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSI 71
          G   H+ A ++S  F G +R+++HQ+VY +L N++ + +HAL++
Sbjct: 34 GSQTHFKATLVSPAFDGVSRVKRHQLVYGTLANELSSGVHALAL 77


>gi|52424366|ref|YP_087503.1| BolA protein [Mannheimia succiniciproducens MBEL55E]
 gi|52306418|gb|AAU36918.1| BolA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 102

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 31/49 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G  +H+   I+++EF GK ++ +H+M+Y  L   + N +HAL++ T  P
Sbjct: 34 GGESHFKVVIVTDEFEGKPKVVRHRMIYQFLAQDLENGIHALALHTYTP 82


>gi|326522811|dbj|BAJ88451.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 361

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 32/45 (71%)

Query: 32  HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+  +++S+EF GK+ +++H+ VYD L +++ + LHALSI    P
Sbjct: 314 HFNVQVVSKEFEGKSMLKRHRAVYDLLQDELKSGLHALSIDAKTP 358


>gi|326488533|dbj|BAJ93935.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 361

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 32/45 (71%)

Query: 32  HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+  +++S+EF GK+ +++H+ VYD L +++ + LHALSI    P
Sbjct: 314 HFNVQVVSKEFEGKSMLKRHRAVYDLLQDELKSGLHALSIDAKTP 358


>gi|294010098|ref|YP_003543558.1| BolA-like protein [Sphingobium japonicum UT26S]
 gi|292673428|dbj|BAI94946.1| BolA-like protein [Sphingobium japonicum UT26S]
          Length = 95

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 46/82 (56%), Gaps = 13/82 (15%)

Query: 7  EIEKMIKKGI-PQSIVTI-----------HDLAGDGNHYAAEIISEEFRGKNRIQQHQMV 54
          EIE  ++  + P+ +  I           HD +G+ +H+  +I+S+ F G+NR+ + ++V
Sbjct: 12 EIEARLRAALAPERLAVIDDSEKHRGHAGHDGSGE-SHFTVDIVSDRFAGRNRVARQRLV 70

Query: 55 YDSLGNKMGNALHALSIKTSVP 76
            +L + + + +HAL+IK   P
Sbjct: 71 NAALADLLRDKVHALAIKARAP 92


>gi|237837261|ref|XP_002367928.1| BolA-like domain containing protein [Toxoplasma gondii ME49]
 gi|211965592|gb|EEB00788.1| BolA-like domain containing protein [Toxoplasma gondii ME49]
          Length = 91

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDL-AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          +E+ +KK +  + + + D   G G  Y   I+S+ F GK  +Q+H+MV ++L +++  ++
Sbjct: 14 VEEKLKKALSPAFLKLEDKSCGCGAAYDCVIVSDAFDGKKLLQRHRMVNEALKDEL-PSI 72

Query: 67 HALSIKTSVPD 77
          HA S++   PD
Sbjct: 73 HAFSMQCHTPD 83


>gi|290995502|ref|XP_002680334.1| predicted protein [Naegleria gruberi]
 gi|284093954|gb|EFC47590.1| predicted protein [Naegleria gruberi]
          Length = 106

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%)

Query: 22  TIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           T H       H+   ++SE F+GK  +++H+MV D++  +  + LHALSIK   P
Sbjct: 46  TRHSGGAGETHFDLLVVSESFQGKRLLERHRMVNDAVAEEFKSGLHALSIKAKTP 100


>gi|54310331|ref|YP_131351.1| putative BolA/YrbA family protein, transcriptional regulator
          [Photobacterium profundum SS9]
 gi|46914772|emb|CAG21549.1| putative BolA/YrbA family protein,transcriptional regulator
          [Photobacterium profundum SS9]
          Length = 84

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 40/66 (60%), Gaps = 3/66 (4%)

Query: 14 KGIPQSIVTIHDL--AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALS 70
          K I ++ +T+ ++   G+G+HY   ++   F G +R+++ Q VY  L   +  NA+HALS
Sbjct: 7  KQILETALTLDEVIVKGEGSHYEVIVVGAMFDGMSRVKKQQAVYAPLTEHIATNAIHALS 66

Query: 71 IKTSVP 76
          IKT  P
Sbjct: 67 IKTYTP 72


>gi|109103417|ref|XP_001107450.1| PREDICTED: bolA-like protein 3 isoform 3 [Macaca mulatta]
          Length = 107

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 44/71 (61%), Gaps = 3/71 (4%)

Query: 8   IEKMIKKGIPQSI-VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
           + +++K+  P++  + + D++G  G  Y  +I SEEF+ K  +QQHQMV  +L  ++   
Sbjct: 36  VTQILKEKFPRATAIKVTDISGGCGAMYEIKIESEEFKEKRTVQQHQMVNQALKEEI-KE 94

Query: 66  LHALSIKTSVP 76
           +H L I TSVP
Sbjct: 95  MHGLRIFTSVP 105


>gi|121604734|ref|YP_982063.1| BolA family protein [Polaromonas naphthalenivorans CJ2]
 gi|120593703|gb|ABM37142.1| transcriptional regulator, BolA protein family [Polaromonas
          naphthalenivorans CJ2]
          Length = 99

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 31/49 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G G+H+   I S  F GK+R+  H++VYD++ N +   LHAL+I+   P
Sbjct: 50 GMGSHFRVRIASPAFDGKSRVACHRLVYDAMQNFIDQGLHALAIEIIKP 98


>gi|78066681|ref|YP_369450.1| transcriptional regulator BolA [Burkholderia sp. 383]
 gi|77967426|gb|ABB08806.1| transcriptional regulator, BolA protein family [Burkholderia sp.
          383]
          Length = 102

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 28/45 (62%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          +   I+S  F GK R+ +H++VYD+L + M   +HAL+I    P+
Sbjct: 51 FTVTIVSAAFAGKPRVARHRLVYDALADAMQRGIHALAIVAYTPE 95


>gi|213407800|ref|XP_002174671.1| UV-induced protein uvi31 [Schizosaccharomyces japonicus yFS275]
 gi|212002718|gb|EEB08378.1| UV-induced protein uvi31 [Schizosaccharomyces japonicus yFS275]
          Length = 104

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 26 LAGDG-NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTS 74
          LA DG  H+  +++S+EF G NR  +H+++Y  L  +    LHAL I+T+
Sbjct: 47 LAQDGFTHFCLDVVSDEFTGMNRPARHRLIYKLLQPEFDTGLHALQIRTA 96


>gi|78486586|ref|NP_997717.2| bolA-like protein 3 isoform 1 [Homo sapiens]
 gi|55596766|ref|XP_515554.1| PREDICTED: bolA-like protein 3 isoform 3 [Pan troglodytes]
 gi|74726650|sp|Q53S33|BOLA3_HUMAN RecName: Full=BolA-like protein 3
 gi|62702132|gb|AAX93059.1| unknown [Homo sapiens]
 gi|77819903|gb|ABB04094.1| bolA-like 3 [Homo sapiens]
 gi|119620105|gb|EAW99699.1| bolA-like 3 (E. coli), isoform CRA_a [Homo sapiens]
 gi|151555075|gb|AAI48672.1| BolA homolog 3 (E. coli) [synthetic construct]
 gi|157170380|gb|AAI53209.1| BolA homolog 3 (E. coli) [synthetic construct]
          Length = 107

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 44/71 (61%), Gaps = 3/71 (4%)

Query: 8   IEKMIKKGIPQSI-VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
           + +++K+  P++  + + D++G  G  Y  +I SEEF+ K  +QQHQMV  +L  ++   
Sbjct: 36  VTQILKEKFPRATAIKVTDISGGCGAMYEIKIESEEFKEKRTVQQHQMVNQALKEEI-KE 94

Query: 66  LHALSIKTSVP 76
           +H L I TSVP
Sbjct: 95  MHGLRIFTSVP 105


>gi|224120486|ref|XP_002318341.1| predicted protein [Populus trichocarpa]
 gi|222859014|gb|EEE96561.1| predicted protein [Populus trichocarpa]
          Length = 100

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 34/50 (68%), Gaps = 1/50 (2%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          AG+  H+  +I+S +F G N +++H++VYD+L  ++ + LHALSI    P
Sbjct: 50 AGE-THFNVKIVSPKFDGLNLVKRHRLVYDALSEELQSGLHALSIVAKTP 98


>gi|226497740|ref|NP_001151829.1| UV-induced protein uvi31 [Zea mays]
 gi|195649243|gb|ACG44089.1| UV-induced protein uvi31 [Zea mays]
 gi|195650031|gb|ACG44483.1| UV-induced protein uvi31 [Zea mays]
 gi|195657715|gb|ACG48325.1| UV-induced protein uvi31 [Zea mays]
 gi|223944215|gb|ACN26191.1| unknown [Zea mays]
          Length = 102

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 32/46 (69%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+  +++S +F G+N +++H+MVYD L +++ + LHA+SI    P
Sbjct: 52 THFNIKVVSPKFEGQNLVKRHRMVYDLLRDELSSGLHAVSIVAKTP 97


>gi|254567119|ref|XP_002490670.1| BolA-like protein [Pichia pastoris GS115]
 gi|238030466|emb|CAY68390.1| BolA-like protein [Pichia pastoris GS115]
 gi|328351056|emb|CCA37456.1| BolA-like protein 1 [Pichia pastoris CBS 7435]
          Length = 87

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 47/73 (64%), Gaps = 2/73 (2%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          MS+    +E++IK  +  ++V + D++G  G  +A  I+S+ F+GKN++ +H++V  +L 
Sbjct: 1  MSLTVGYLEQIIKDRLEAALVQVQDMSGGCGQAFAVIIVSDVFKGKNKLMRHRIVNKALE 60

Query: 60 NKMGNALHALSIK 72
           ++  A+HA + K
Sbjct: 61 QEIA-AIHAFTQK 72


>gi|195608638|gb|ACG26149.1| UV-induced protein uvi31 [Zea mays]
          Length = 101

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 32/46 (69%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+  +++S +F G+N +++H+MVYD L +++ + LHA+SI    P
Sbjct: 51 THFNIKVVSPKFEGQNLVKRHRMVYDLLRDELSSGLHAVSIVAKTP 96


>gi|329997634|ref|ZP_08302891.1| BolA-like protein [Klebsiella sp. MS 92-3]
 gi|328538944|gb|EGF64998.1| BolA-like protein [Klebsiella sp. MS 92-3]
          Length = 84

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 41/75 (54%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M  HEI+ ++   +P   V +   +GDG+H+    + E F G +R+++ Q +Y  L   +
Sbjct: 1  MENHEIQTVLMNALPLQEVHV---SGDGSHFQVIAVGEMFDGMSRVKKQQSIYAPLMEYI 57

Query: 63 G-NALHALSIKTSVP 76
            N +HALSIK   P
Sbjct: 58 ADNRIHALSIKAFTP 72


>gi|116789887|gb|ABK25426.1| unknown [Picea sitchensis]
          Length = 108

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%)

Query: 27  AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           A    H+  +I+S +F G++ +++H++VYD L  +  N LHALSI    P
Sbjct: 53  AATETHFNLKIVSPKFEGQSLVKRHRLVYDLLSEEFKNGLHALSIVAKTP 102


>gi|301772238|ref|XP_002921544.1| PREDICTED: bolA-like protein 3-like [Ailuropoda melanoleuca]
          Length = 160

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 43/72 (59%), Gaps = 3/72 (4%)

Query: 7   EIEKMIKKGIP-QSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN 64
           ++ +++K+  P  + V + D++G  G  Y   I SEEF+ K  +QQHQMV  +L  ++  
Sbjct: 88  KVTQILKEKFPGATAVQVTDISGGCGAMYEIRIESEEFKEKRTVQQHQMVNQALKEEI-K 146

Query: 65  ALHALSIKTSVP 76
            +H L I TSVP
Sbjct: 147 GMHGLRIFTSVP 158


>gi|289209122|ref|YP_003461188.1| BolA family protein [Thioalkalivibrio sp. K90mix]
 gi|288944753|gb|ADC72452.1| BolA family protein [Thioalkalivibrio sp. K90mix]
          Length = 79

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 49/76 (64%), Gaps = 3/76 (3%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M  +++ ++I+ G+P++   +    G+G  + A ++S +F G N++++HQ VY ++ +++
Sbjct: 1  MEANQVAELIRAGLPEA-EKVEVTGGEGK-FEALVVSPQFAGMNKVRKHQTVYATVRDQI 58

Query: 63 GNA-LHALSIKTSVPD 77
           +  +HALSI+   P+
Sbjct: 59 DSGEVHALSIRALTPE 74


>gi|326936254|ref|XP_003214171.1| PREDICTED: bolA-like protein 3-like, partial [Meleagris
          gallopavo]
          Length = 50

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDS 78
          G G  Y   I SEEFR K  +QQHQMV  +L  ++  ++H L I TSVP S
Sbjct: 1  GCGAMYEIHIESEEFREKRIVQQHQMVNQALSEEI-KSMHGLRIFTSVPKS 50


>gi|302038869|ref|YP_003799191.1| putative protein BolA [Candidatus Nitrospira defluvii]
 gi|300606933|emb|CBK43266.1| putative Protein BolA [Candidatus Nitrospira defluvii]
          Length = 97

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 8  IEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA-L 66
          +   I++  P + VT+ D  G  +H    + S  F GKN + +H++VY +L   M +  +
Sbjct: 23 VTAFIRQVFPDADVTVIDKTGTQDHLIVRVTSGGFLGKNLLDRHRLVYQALAAPMKDGRI 82

Query: 67 HALSIKTSVPD 77
          HAL I    P+
Sbjct: 83 HALEITAKTPE 93


>gi|238918535|ref|YP_002932049.1| hypothetical protein NT01EI_0585 [Edwardsiella ictaluri 93-146]
 gi|238868103|gb|ACR67814.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 84

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 44/75 (58%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MN  +I+ ++ K +  ++  +H + GDG+H+   ++ E F G +R++Q Q VY  L   +
Sbjct: 1  MNNDQIKDVLMKAL--ALQEVH-VTGDGSHFQVIVVGELFAGMSRVKQQQAVYAPLMEFI 57

Query: 63 G-NALHALSIKTSVP 76
            N +HAL+IK   P
Sbjct: 58 ADNRIHALTIKAYTP 72


>gi|256822093|ref|YP_003146056.1| BolA family protein [Kangiella koreensis DSM 16069]
 gi|256795632|gb|ACV26288.1| BolA family protein [Kangiella koreensis DSM 16069]
          Length = 87

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 24 HDLAGDGN-HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          H  A DG  H+   I SE   GK  +QQH+ VYD+LG+ M   +HAL+IK 
Sbjct: 35 HAGARDGKGHFTVIIQSEALEGKRMLQQHRAVYDALGDMMETDIHALAIKV 85


>gi|92116116|ref|YP_575845.1| BolA-like protein [Nitrobacter hamburgensis X14]
 gi|91799010|gb|ABE61385.1| transcriptional regulator, BolA protein family [Nitrobacter
          hamburgensis X14]
          Length = 98

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
          G G H+   I+S  F GK R+ +H+M+   L  ++  ++HAL+I+   P  Q
Sbjct: 45 GGGTHFRINIVSRAFEGKGRVDRHRMINMLLAEELAGSVHALAIRALTPGEQ 96


>gi|28393578|gb|AAO42209.1| unknown protein [Arabidopsis thaliana]
          Length = 371

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 35/52 (67%), Gaps = 2/52 (3%)

Query: 27  AGDG--NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           AGD    H+   I+S+ F+GK+ +++H+++YD L +++ + LHALSI    P
Sbjct: 317 AGDDGETHFNLRIVSDAFQGKSLVKRHRLIYDLLQDELKSGLHALSIVAKTP 368


>gi|15236742|ref|NP_194380.1| CPSUFE (CHLOROPLAST SULFUR E); enzyme activator/ transcription
           regulator [Arabidopsis thaliana]
 gi|115502843|sp|Q84W65|SUFE_ARATH RecName: Full=SufE-like protein, chloroplastic; AltName:
           Full=Protein EMBRYO DEFECTIVE 1374; Flags: Precursor
 gi|2982456|emb|CAA18220.1| putative protein [Arabidopsis thaliana]
 gi|7269502|emb|CAB79505.1| putative protein [Arabidopsis thaliana]
 gi|21536824|gb|AAM61156.1| unknown [Arabidopsis thaliana]
 gi|60543325|gb|AAX22260.1| At4g26500 [Arabidopsis thaliana]
 gi|332659810|gb|AEE85210.1| SufE-like protein [Arabidopsis thaliana]
          Length = 371

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 35/52 (67%), Gaps = 2/52 (3%)

Query: 27  AGDG--NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           AGD    H+   I+S+ F+GK+ +++H+++YD L +++ + LHALSI    P
Sbjct: 317 AGDDGETHFNLRIVSDAFQGKSLVKRHRLIYDLLQDELKSGLHALSIVAKTP 368


>gi|239994343|ref|ZP_04714867.1| BolA-like protein [Alteromonas macleodii ATCC 27126]
          Length = 85

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 50/79 (63%), Gaps = 5/79 (6%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EIEK++K  +   +  +H + G+G+H+    +S+ F G +R+++ Q VY  L +K+
Sbjct: 1  MELSEIEKILKDAL--DLHEVH-VKGEGSHFNIIAVSDAFNGMSRVKRQQAVYAPLADKI 57

Query: 63 GN-ALHALSIKT-SVPDSQ 79
           + ++HA++IKT SV D +
Sbjct: 58 ADGSMHAITIKTFSVKDWE 76


>gi|330793380|ref|XP_003284762.1| hypothetical protein DICPUDRAFT_28210 [Dictyostelium purpureum]
 gi|325085256|gb|EGC38666.1| hypothetical protein DICPUDRAFT_28210 [Dictyostelium purpureum]
          Length = 105

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA-LHALSIKTSVP 76
          G  +H+  +I+SE+F G   I+QH++V   L N +GN+ +HALSI +  P
Sbjct: 34 GSESHFKVKIVSEKFEGLTMIEQHRLVNTILTNYIGNSKIHALSITSRTP 83


>gi|260942261|ref|XP_002615429.1| hypothetical protein CLUG_04311 [Clavispora lusitaniae ATCC
          42720]
 gi|238850719|gb|EEQ40183.1| hypothetical protein CLUG_04311 [Clavispora lusitaniae ATCC
          42720]
          Length = 86

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 47/78 (60%), Gaps = 2/78 (2%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          M++    ++ +I++ +  S+V + D++G  G  +A  I+S  F GKN++ +H++V  +L 
Sbjct: 1  MALTTESLKDIIQERLQASLVQVEDMSGGCGQAFAVVIVSPLFAGKNKLMRHRLVNSALK 60

Query: 60 NKMGNALHALSIKTSVPD 77
           ++  A+HA + K   P+
Sbjct: 61 EEIA-AIHAFTQKGFTPE 77


>gi|300311559|ref|YP_003775651.1| stress-induced morphogen protein [Herbaspirillum seropedicae
          SmR1]
 gi|300074344|gb|ADJ63743.1| stress-induced morphogen protein [Herbaspirillum seropedicae
          SmR1]
          Length = 94

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 28/44 (63%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          Y   ++S+ F GKNR+ +H++VYD L + M   +HAL+I    P
Sbjct: 46 YRIRLVSDLFEGKNRLNRHRLVYDCLSDLMQQEIHALAIVALSP 89


>gi|239815914|ref|YP_002944824.1| BolA family protein [Variovorax paradoxus S110]
 gi|239802491|gb|ACS19558.1| BolA family protein [Variovorax paradoxus S110]
          Length = 93

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIK 72
          G G H+   I S  F GK R+ +H++VYD+L   +   LHA++I+
Sbjct: 47 GRGTHFRVRIASPLFEGKPRVARHRLVYDALQVFIAQGLHAIAIE 91


>gi|320590388|gb|EFX02831.1| bola-like protein [Grosmannia clavigera kw1407]
          Length = 170

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 21  VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           +++ D++G  G+ Y  EI SE FRG N ++Q +MV   LG+ M +  H + +KT VP
Sbjct: 115 LSVRDISGGCGSMYGIEISSERFRGANMLKQQRMVNAVLGDLMKD-WHGVQLKTRVP 170


>gi|156935714|ref|YP_001439630.1| hypothetical protein ESA_03583 [Cronobacter sakazakii ATCC
          BAA-894]
 gi|156533968|gb|ABU78794.1| hypothetical protein ESA_03583 [Cronobacter sakazakii ATCC
          BAA-894]
          Length = 85

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 3/75 (4%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M  HEI+ ++   +P  +  +H  +GDG+H+    + E F   +R+++ Q VY  L   +
Sbjct: 1  MENHEIQTVLMNALP--LQEVHVSSGDGSHFQVIAVGELFGEMSRVKKQQAVYGPLMEFI 58

Query: 63 G-NALHALSIKTSVP 76
            N +HA+SIKT  P
Sbjct: 59 ADNRIHAVSIKTFTP 73


>gi|52425763|ref|YP_088900.1| BolA protein [Mannheimia succiniciproducens MBEL55E]
 gi|52307815|gb|AAU38315.1| BolA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 89

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 44/78 (56%), Gaps = 4/78 (5%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          ++M   EIE+++K+ +    V +    G+  HY   ++SEE    +R++Q Q +Y  L +
Sbjct: 3  ITMETQEIERILKQALNLDEVYVQ---GENAHYGVIVVSEEIAKLSRLKQQQTIYAPLMD 59

Query: 61 KMGNA-LHALSIKTSVPD 77
             +  +HAL+IKT  P+
Sbjct: 60 HFSSGEIHALTIKTFSPE 77


>gi|304313049|ref|YP_003812647.1| Putative cell division protein [gamma proteobacterium HdN1]
 gi|301798782|emb|CBL47015.1| Putative cell division protein [gamma proteobacterium HdN1]
          Length = 110

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 31/43 (72%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
           H+ A I+S++F GK ++ +HQ++Y  L +++ N +HAL++ T
Sbjct: 42 THFKAVIVSDDFAGKRKVARHQVIYGVLAHELANGVHALALHT 84


>gi|296444575|ref|ZP_06886539.1| BolA family protein [Methylosinus trichosporium OB3b]
 gi|296257843|gb|EFH04906.1| BolA family protein [Methylosinus trichosporium OB3b]
          Length = 97

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 28/47 (59%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           H+  E++S  F GK R+++H+M+   L  ++   +HAL+I    PD
Sbjct: 49 THFRVEVVSAVFSGKGRVERHRMINSLLAEELAGGVHALAIDARAPD 95


>gi|303283730|ref|XP_003061156.1| bola-like protein [Micromonas pusilla CCMP1545]
 gi|226457507|gb|EEH54806.1| bola-like protein [Micromonas pusilla CCMP1545]
          Length = 151

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 41/68 (60%), Gaps = 2/68 (2%)

Query: 12  IKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHAL- 69
           I+  +  + V + D++GDG H   +++S+ F GKN I + +MVY ++  +M  + +HA+ 
Sbjct: 81  IQTSLEATFVDVVDMSGDGRHVTIKVVSKAFEGKNPINRQRMVYKAIWEEMQTDKVHAVQ 140

Query: 70  SIKTSVPD 77
            I T  P+
Sbjct: 141 GIVTQTPE 148


>gi|83647972|ref|YP_436407.1| BolA family transcriptional regulator [Hahella chejuensis KCTC
          2396]
 gi|83636015|gb|ABC31982.1| predicted transcriptional regulator, BolA superfamily [Hahella
          chejuensis KCTC 2396]
          Length = 80

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 42/76 (55%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P  +++++++ +    V +    GDG HY    + E F G + +++ Q VY  + + +
Sbjct: 1  MQPEALQEILQEKLSDCEVRVE---GDGYHYQVVAVGERFAGLSPVKKQQTVYSCIHDLI 57

Query: 63 GN-ALHALSIKTSVPD 77
           +  +HA+SIKT  PD
Sbjct: 58 ADGTVHAVSIKTYTPD 73


>gi|254282018|ref|ZP_04956986.1| BolA family protein [gamma proteobacterium NOR51-B]
 gi|219678221|gb|EED34570.1| BolA family protein [gamma proteobacterium NOR51-B]
          Length = 104

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 45/78 (57%), Gaps = 7/78 (8%)

Query: 7  EIEKMIKKGIPQSIVTI------HDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          +IE+ + +G+  S + I      H++  G  +H+   ++S++F G  ++++HQ +Y  LG
Sbjct: 6  QIERSLSEGLSVSRLDIVNESFMHNVPEGSESHFKVTVVSKDFEGVRKVKRHQQIYALLG 65

Query: 60 NKMGNALHALSIKTSVPD 77
          + M   +HAL++ T   D
Sbjct: 66 DLMAGPIHALALHTYTAD 83


>gi|317494029|ref|ZP_07952445.1| BolA protein [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917802|gb|EFV39145.1| BolA protein [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 84

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVPD 77
          + GDG+H+   ++ E+F G +R+++ Q VY  L   +  N +HALSIK   P+
Sbjct: 21 VTGDGSHFQVIVVGEQFAGMSRVKKQQTVYAPLMEYIADNRIHALSIKAFTPE 73


>gi|94498019|ref|ZP_01304582.1| BolA-like protein [Sphingomonas sp. SKA58]
 gi|94422454|gb|EAT07492.1| BolA-like protein [Sphingomonas sp. SKA58]
          Length = 105

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 35/53 (66%), Gaps = 1/53 (1%)

Query: 24  HDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           HD +G+ +H+  EII+E F G +R+ + +MV  +L + + + +HAL+IK   P
Sbjct: 51  HDGSGE-SHFTVEIIAERFTGPSRVARQRMVNAALADLLRDKVHALAIKARAP 102


>gi|298292767|ref|YP_003694706.1| BolA family protein [Starkeya novella DSM 506]
 gi|296929278|gb|ADH90087.1| BolA family protein [Starkeya novella DSM 506]
          Length = 97

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          AG+  H    I++E FRG++RI +H++V   L  ++   LHAL+I+   P
Sbjct: 46 AGELTHLRVRIVAEAFRGQSRIARHRVVNGLLAGEIARGLHALAIEAKAP 95


>gi|311277837|ref|YP_003940068.1| BolA family protein [Enterobacter cloacae SCF1]
 gi|308747032|gb|ADO46784.1| BolA family protein [Enterobacter cloacae SCF1]
          Length = 84

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M  HEI+ ++   +  S+  +H ++GDG+H+    + E F G +R+++ Q VY  L   +
Sbjct: 1  MENHEIQTVLMNAL--SLKEVH-VSGDGSHFQVIAVGEMFDGMSRVKKQQAVYAPLMEYI 57

Query: 63 G-NALHALSIKTSVP 76
            N +HALSIK   P
Sbjct: 58 ADNRIHALSIKAYTP 72


>gi|33151495|ref|NP_872848.1| hypothetical protein HD0254 [Haemophilus ducreyi 35000HP]
 gi|33147715|gb|AAP95237.1| conserved hypothetical protein [Haemophilus ducreyi 35000HP]
          Length = 86

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 42/72 (58%), Gaps = 3/72 (4%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P ++ ++++  +P + V IH   G+ +HY   ++S+E    ++++Q Q VY  L    
Sbjct: 1  MEPTQLAEILRNALPNA-VEIHA-QGENSHYGVIVVSDELAQLSKVKQQQAVYAPLSEYF 58

Query: 63 G-NALHALSIKT 73
            NA+HAL+IK 
Sbjct: 59 ATNAVHALTIKV 70


>gi|88909713|gb|ABD57887.1| BolA-like protein [uncultured Methylocystis sp. GSC357]
          Length = 133

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 34/50 (68%), Gaps = 1/50 (2%)

Query: 29  DG-NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           DG +H+   + S  FRGK+RI++H+++++ L  ++   +HAL++  S P+
Sbjct: 81  DGESHFRVNVTSAAFRGKSRIERHRIIHEILAEELAGRVHALALVASAPE 130


>gi|304310286|ref|YP_003809884.1| Predicted transcriptional regulator, BolA superfamily [gamma
          proteobacterium HdN1]
 gi|301796019|emb|CBL44223.1| Predicted transcriptional regulator, BolA superfamily [gamma
          proteobacterium HdN1]
          Length = 84

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+ + I+  ++ G P + V + DL G  N     ++S+ F GK  +Q+ QMVY  L + +
Sbjct: 1  MDENLIKSRLQTGFPDAEVHV-DLMG--NKAQVVVVSDAFAGKRVVQKQQMVYQQLNDLL 57

Query: 63 GNA-LHALSIKTSVPD 77
           +  LHA+S++T  PD
Sbjct: 58 ASGELHAVSMQTLTPD 73


>gi|189441826|gb|AAI67635.1| LOC100170577 protein [Xenopus (Silurana) tropicalis]
          Length = 171

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 31/49 (63%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           G   H+   ++SE F GK+ IQ+H++V + L +++   +HALSI+   P
Sbjct: 90  GSETHFKVVVVSESFLGKSLIQRHRLVNELLKDELAGPVHALSIQAKTP 138


>gi|87200923|ref|YP_498180.1| transcriptional regulator BolA [Novosphingobium aromaticivorans
          DSM 12444]
 gi|87136604|gb|ABD27346.1| transcriptional regulator, BolA protein family [Novosphingobium
          aromaticivorans DSM 12444]
          Length = 90

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 11/81 (13%)

Query: 7  EIEKMIKKGI-PQSIVTIHDLAG-------DG---NHYAAEIISEEFRGKNRIQQHQMVY 55
          EIE+++     P  +  I+D A        DG   +H+  EI S  F G++R+ + +MV 
Sbjct: 8  EIERLLADAFAPAHLAVINDSASHAGHMGDDGTGESHFTVEIESAAFAGQSRLARQRMVI 67

Query: 56 DSLGNKMGNALHALSIKTSVP 76
           +LG+  G  +HAL+IK   P
Sbjct: 68 KALGDIPGQRVHALAIKARAP 88


>gi|290476804|ref|YP_003469715.1| putative transcriptional regulator [Xenorhabdus bovienii SS-2004]
 gi|289176148|emb|CBJ82953.1| putative transcriptional regulator (BolA family) [Xenorhabdus
          bovienii SS-2004]
          Length = 84

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+  EI++++ K +    V +   +GDG+H+    + E F   +R++Q Q VY  L   +
Sbjct: 1  MDTDEIKEVLMKALALDDVIV---SGDGSHFQVIAVGELFDDLSRVKQQQAVYAPLMEYI 57

Query: 63 G-NALHALSIKTSVP 76
            N +HA+SIKT  P
Sbjct: 58 ADNRIHAVSIKTYTP 72


>gi|332976939|gb|EGK13757.1| regulator of penicillin binding proteins and beta lactamase
          transcription [Psychrobacter sp. 1501(2011)]
          Length = 107

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVY---DSLGNKMGNALHALSIKTSVPD 77
            G  +H+   ++S +F GK R+ +HQ++Y   D+L    G ++HAL+I    PD
Sbjct: 32 FEGKESHFKLTVVSPDFEGKRRVARHQLIYSLMDNLMTSQGGSIHALAIHAYSPD 86


>gi|224122328|ref|XP_002330596.1| predicted protein [Populus trichocarpa]
 gi|222872154|gb|EEF09285.1| predicted protein [Populus trichocarpa]
          Length = 371

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 33/46 (71%)

Query: 32  HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           H+  +++S+EF GK+ +++H+++Y+ L  ++ + LHALSI    PD
Sbjct: 321 HFNVKVVSKEFGGKSLVKRHRLIYNLLQEELESGLHALSIVAKTPD 366


>gi|82703232|ref|YP_412798.1| BolA-like protein [Nitrosospira multiformis ATCC 25196]
 gi|82411297|gb|ABB75406.1| transcriptional regulator, BolA protein family [Nitrosospira
          multiformis ATCC 25196]
          Length = 91

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G HY   I+S +F  K+ + +H++VYD+L   M   +HAL +K   P+
Sbjct: 38 GGHYLLTIVSHQFTCKSALARHRLVYDTLREMMHKNIHALGVKAYTPE 85


>gi|251793147|ref|YP_003007875.1| BolA protein [Aggregatibacter aphrophilus NJ8700]
 gi|247534542|gb|ACS97788.1| BolA protein [Aggregatibacter aphrophilus NJ8700]
          Length = 85

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 43/72 (59%), Gaps = 4/72 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EIE+++K+ +    V +    G+  HY    +S++F G ++++Q QM+Y  L + +
Sbjct: 1  METQEIERILKEALNLDEVYVQ---GEDVHYGVIAVSDQFAGLSKVKQQQMIYAPLLSHI 57

Query: 63 -GNALHALSIKT 73
            N +HALSI+T
Sbjct: 58 SSNEIHALSIRT 69


>gi|19112580|ref|NP_595788.1| BolA domain UV induced protein Uvi31 [Schizosaccharomyces pombe
          972h-]
 gi|3024789|sp|Q12238|UVI31_SCHPO RecName: Full=UV-induced protein uvi31
 gi|1325966|emb|CAA96579.1| uvi31+ [Schizosaccharomyces pombe]
 gi|1381578|gb|AAB02694.1| Uvi31 [Schizosaccharomyces pombe]
 gi|2467268|emb|CAB16898.1| BolA domain UV induced protein Uvi31 [Schizosaccharomyces pombe]
          Length = 102

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 10/65 (15%)

Query: 14 KGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          KG+P +         +  H+  EI+S EF G +R+ +H++VY  L ++    LHAL I +
Sbjct: 44 KGVPDT---------NETHFRLEIVSPEFSGMSRVARHRLVYGLLKDEFDGGLHALQITS 94

Query: 74 S-VPD 77
          S  PD
Sbjct: 95 SKTPD 99


>gi|299132830|ref|ZP_07026025.1| BolA family protein [Afipia sp. 1NLS2]
 gi|298592967|gb|EFI53167.1| BolA family protein [Afipia sp. 1NLS2]
          Length = 88

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 30/49 (61%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G   H+   I+S  F GK+R+++H+M+   L + +   +HAL++KT  P
Sbjct: 38 GGETHFRVHIVSRAFEGKSRVERHRMINAILADDLAGGVHALALKTLAP 86


>gi|332532817|ref|ZP_08408690.1| cell division protein BolA [Pseudoalteromonas haloplanktis
          ANT/505]
 gi|332037663|gb|EGI74114.1| cell division protein BolA [Pseudoalteromonas haloplanktis
          ANT/505]
          Length = 103

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 33/51 (64%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          AG  +H+   ++SE F GK  +Q+H+ + + L +++ N +HAL+I T  PD
Sbjct: 31 AGTESHFKVIVVSEGFTGKRLLQRHREINEILKDELANHIHALAIHTYTPD 81


>gi|221134710|ref|ZP_03561013.1| BolA-like protein [Glaciecola sp. HTCC2999]
          Length = 85

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 44/72 (61%), Gaps = 4/72 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EIE  +K+ +  S+  +H +  DG+H+    +S+ F   +R+++ Q VY  L +K+
Sbjct: 1  MTTEEIETFLKEQL--SLTEVH-VKSDGSHFNIIAVSDAFGDMSRVKRQQFVYAPLTDKI 57

Query: 63 GN-ALHALSIKT 73
           + ++HA+SIKT
Sbjct: 58 ADGSMHAISIKT 69


>gi|225457481|ref|XP_002266348.1| PREDICTED: similar to UV-induced protein uvi31 [Vitis vinifera]
          Length = 105

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          A    H+  +I+S +F G   +++H+MVYD L +++ + LHA+SI    P
Sbjct: 50 APQETHFNLKIVSPKFTGHTLVKRHRMVYDLLADELSSGLHAISIVAKTP 99


>gi|134025482|gb|AAI35598.1| hypothetical protein LOC733564 [Xenopus (Silurana) tropicalis]
          Length = 104

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 44/73 (60%), Gaps = 3/73 (4%)

Query: 6   HEIEKMIKKGIP-QSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG 63
           ++I +++K   P  S V + D++G  G  Y   I SEEF+ K  +QQH+MV ++L  ++ 
Sbjct: 31  YKITQVLKAKFPLASYVRVVDISGGCGAMYEIHIESEEFKDKRTVQQHKMVNEALQEEI- 89

Query: 64  NALHALSIKTSVP 76
            A+H L I T+ P
Sbjct: 90  KAMHGLRIFTTAP 102


>gi|308051136|ref|YP_003914702.1| BolA family transcriptional regulator [Ferrimonas balearica DSM
          9799]
 gi|307633326|gb|ADN77628.1| BolA family protein [Ferrimonas balearica DSM 9799]
          Length = 83

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P EIE  ++  +  + V +     DG+HY    + + F G  ++++ Q VY  L +K+
Sbjct: 1  MEPKEIEARLQAAMTLAEVRV---TADGSHYTILAVGDCFDGLTKVRRQQSVYAPLMDKV 57

Query: 63 GN-ALHALSIKTSVP 76
           +  LHAL+IK   P
Sbjct: 58 TDGTLHALTIKAFTP 72


>gi|226329322|ref|ZP_03804840.1| hypothetical protein PROPEN_03227 [Proteus penneri ATCC 35198]
 gi|225202508|gb|EEG84862.1| hypothetical protein PROPEN_03227 [Proteus penneri ATCC 35198]
          Length = 84

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+ +EI++++   +    V ++   GDG+H+   ++   F G +R++Q Q +Y  L   +
Sbjct: 1  MDTNEIKQVLMDSLSLDEVIVN---GDGSHFQVVVVGAMFEGMSRVKQQQTIYAPLMEYI 57

Query: 63 G-NALHALSIKTSVPD 77
            N +HALSIK   P+
Sbjct: 58 ADNRIHALSIKAYTPE 73


>gi|165976707|ref|YP_001652300.1| transcriptional regulator [Actinobacillus pleuropneumoniae
          serovar 3 str. JL03]
 gi|307250539|ref|ZP_07532483.1| hypothetical protein appser4_13190 [Actinobacillus
          pleuropneumoniae serovar 4 str. M62]
 gi|165876808|gb|ABY69856.1| predicted transcriptional regulator [Actinobacillus
          pleuropneumoniae serovar 3 str. JL03]
 gi|306857432|gb|EFM89544.1| hypothetical protein appser4_13190 [Actinobacillus
          pleuropneumoniae serovar 4 str. M62]
          Length = 86

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 42/72 (58%), Gaps = 3/72 (4%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P ++E+++K  +P +   IH   G+ +HY   ++S+E    ++++Q Q VY  L    
Sbjct: 1  MEPKQLEEILKNALPHA-SEIHA-QGENSHYGVIVVSDELAQLSKVKQQQAVYAPLCEYF 58

Query: 63 -GNALHALSIKT 73
            NA+HAL+IK 
Sbjct: 59 TTNAIHALTIKV 70


>gi|146313260|ref|YP_001178334.1| BolA family protein [Enterobacter sp. 638]
 gi|145320136|gb|ABP62283.1| BolA family protein [Enterobacter sp. 638]
          Length = 84

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M  HEI+ ++   +  S+  +H + GDG+H+    + E F G +R+++ Q VY  L   +
Sbjct: 1  MENHEIQSVLMNAL--SLQEVH-VTGDGSHFQVITVGEIFDGMSRVKKQQAVYAPLMEYI 57

Query: 63 G-NALHALSIKTSVP 76
            N +HALSIK   P
Sbjct: 58 ADNRIHALSIKAYTP 72


>gi|89093959|ref|ZP_01166904.1| toluene-tolerance protein [Oceanospirillum sp. MED92]
 gi|89081845|gb|EAR61072.1| toluene-tolerance protein [Oceanospirillum sp. MED92]
          Length = 80

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 41/76 (53%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   +++++++  +    VT    AG+G  +   ++ E F+G   ++  Q+VY  L   +
Sbjct: 1  MQAEQVKQILESKLENCTVTT---AGEGCDFQVTVVGEMFQGLRPVKCQQLVYACLNEYI 57

Query: 63 GN-ALHALSIKTSVPD 77
           N  +HAL+IKT  P+
Sbjct: 58 ANGTIHALTIKTYTPE 73


>gi|171058522|ref|YP_001790871.1| BolA family protein [Leptothrix cholodnii SP-6]
 gi|170775967|gb|ACB34106.1| BolA family protein [Leptothrix cholodnii SP-6]
          Length = 101

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 30/48 (62%)

Query: 24 HDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSI 71
          H  A  G+H+   I +  F GK+R+ +H++VYDSL   M   +HAL+I
Sbjct: 39 HAGASSGSHFRVTIRAVCFSGKSRVARHRLVYDSLAFLMPRGIHALAI 86


>gi|315125939|ref|YP_004067942.1| regulator protein [Pseudoalteromonas sp. SM9913]
 gi|315014453|gb|ADT67791.1| regulator protein [Pseudoalteromonas sp. SM9913]
          Length = 103

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 34/51 (66%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          AG  +H+   ++SEEF GK  +Q+H+ + + L +++ N +HAL++ T  P+
Sbjct: 31 AGTESHFKVIVVSEEFAGKRLLQRHREINEILKDELANHIHALAMHTYTPE 81


>gi|297737214|emb|CBI26415.3| unnamed protein product [Vitis vinifera]
          Length = 80

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 8  IEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALH 67
          +E  IK+ +    V++ D  GDG H + ++IS  F G++ + + +MVY ++  ++ + +H
Sbjct: 4  MENKIKEHLNAESVSVKDAYGDGRHVSIDVISSAFEGQSAVNRQRMVYKAIWEELQSTVH 63

Query: 68 ALS-IKTSVP 76
          A+  + T  P
Sbjct: 64 AVDQMSTRTP 73


>gi|110833420|ref|YP_692279.1| toluene-tolerance protein [Alcanivorax borkumensis SK2]
 gi|110646531|emb|CAL16007.1| toluene-tolerance protein [Alcanivorax borkumensis SK2]
          Length = 84

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MNP ++  +++ G   + V +    G G+ +   ++SE F G   +++ QMVY ++  ++
Sbjct: 1  MNPEDVITLVEAGFESADVAVE---GGGDRFQIRVVSEAFSGLMPVKRQQMVYATIDEQI 57

Query: 63 -GNALHALSIKTSVP 76
            N +HA+ I T  P
Sbjct: 58 KSNTIHAVQIITFTP 72


>gi|262273840|ref|ZP_06051653.1| protein yrbA [Grimontia hollisae CIP 101886]
 gi|262222255|gb|EEY73567.1| protein yrbA [Grimontia hollisae CIP 101886]
          Length = 85

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 45/75 (60%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P EI+ ++++ +  ++  IH + GDG+H+    I + F G +R+++ Q +Y  L   +
Sbjct: 1  MEPIEIKVILEQAL--TLDEIH-VKGDGSHFEVIAIGDMFDGMSRVKKQQTIYGPLMEHI 57

Query: 63 -GNALHALSIKTSVP 76
            NA+HALSIK   P
Sbjct: 58 RTNAIHALSIKALTP 72


>gi|158425300|ref|YP_001526592.1| hypothetical protein AZC_3676 [Azorhizobium caulinodans ORS 571]
 gi|158332189|dbj|BAF89674.1| conserved hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 93

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H    ++SE FRGK+RI +H++V   L  ++   LHAL+I    P
Sbjct: 46 THLRVRVVSEAFRGKSRIDRHRLVNGLLAGEIAGGLHALAIDAKAP 91


>gi|242062424|ref|XP_002452501.1| hypothetical protein SORBIDRAFT_04g026980 [Sorghum bicolor]
 gi|241932332|gb|EES05477.1| hypothetical protein SORBIDRAFT_04g026980 [Sorghum bicolor]
          Length = 102

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 32/46 (69%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+  +++S +F G++ +++H+MVYD L +++ + LHA+SI    P
Sbjct: 52 THFNVKVVSPKFEGQSLVKRHRMVYDLLRDELSSGLHAVSIVAKTP 97


>gi|197287463|ref|YP_002153335.1| morphoprotein [Proteus mirabilis HI4320]
 gi|227358275|ref|ZP_03842616.1| BolA superfamily transcriptional regulator [Proteus mirabilis
          ATCC 29906]
 gi|194684950|emb|CAR47145.1| putative morphoprotein [Proteus mirabilis HI4320]
 gi|227161611|gb|EEI46648.1| BolA superfamily transcriptional regulator [Proteus mirabilis
          ATCC 29906]
          Length = 84

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+ +EI++++   +    V ++   GDG+H+   ++   F G +R++Q Q +Y  L   +
Sbjct: 1  MDTNEIKQVLMDTLSLDEVIVN---GDGSHFQVVVVGAMFEGMSRVKQQQTIYAPLMEYI 57

Query: 63 G-NALHALSIKTSVPD 77
            N +HALSIK   P+
Sbjct: 58 ADNRIHALSIKAYTPE 73


>gi|284006419|emb|CBA71655.1| transcriptional regulator [Arsenophonus nasoniae]
          Length = 108

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 31/49 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G  +H+   +++E+F  +  + +HQ+VY  L +++ N +HAL++ T  P
Sbjct: 40 GTESHFKVILVTEKFAAQRMVARHQVVYQLLADELSNCVHALALHTYTP 88


>gi|39933578|ref|NP_945854.1| BolA-like protein [Rhodopseudomonas palustris CGA009]
 gi|192288932|ref|YP_001989537.1| BolA family protein [Rhodopseudomonas palustris TIE-1]
 gi|39647424|emb|CAE25945.1| BolA-like protein [Rhodopseudomonas palustris CGA009]
 gi|192282681|gb|ACE99061.1| BolA family protein [Rhodopseudomonas palustris TIE-1]
          Length = 89

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (60%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+   I+S  F GK+R+ +H+MV D L  ++   +HAL+IK   P
Sbjct: 41 THFRVNIVSAAFAGKSRVDRHRMVNDLLAPELKGGVHALAIKAKAP 86


>gi|226501680|ref|NP_001152446.1| LOC100286086 [Zea mays]
 gi|195656367|gb|ACG47651.1| EMB1374 [Zea mays]
          Length = 368

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 29/45 (64%)

Query: 32  HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+   ++S+EF GK+ +++H+ VYD L  ++   LHALSI    P
Sbjct: 321 HFNVRVVSKEFEGKSLLKRHRAVYDLLQEELKTGLHALSIDAKTP 365


>gi|91974771|ref|YP_567430.1| BolA-like protein [Rhodopseudomonas palustris BisB5]
 gi|91681227|gb|ABE37529.1| transcriptional regulator BolA [Rhodopseudomonas palustris BisB5]
          Length = 101

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 30/46 (65%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          +H+   I+S+ F GK+RI +H+M+ + L  ++   LHAL++K   P
Sbjct: 53 SHFRVNIVSDAFAGKSRIDRHRMINELLAAELKGGLHALAVKAKAP 98


>gi|220926501|ref|YP_002501803.1| BolA family protein [Methylobacterium nodulans ORS 2060]
 gi|219951108|gb|ACL61500.1| BolA family protein [Methylobacterium nodulans ORS 2060]
          Length = 93

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G   H+  +++SE F GK+R+++H+MV   L       LHAL+++   P
Sbjct: 38 GGETHFRLDVVSEAFEGKSRVERHRMVNALLDEAFRRGLHALALRARTP 86


>gi|88861152|ref|ZP_01135786.1| putative transcriptional regulator (BolA family) protein
          [Pseudoalteromonas tunicata D2]
 gi|88816874|gb|EAR26695.1| putative transcriptional regulator (BolA family) protein
          [Pseudoalteromonas tunicata D2]
          Length = 84

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P ++E ++K  +  S V +     +G+H+    + E F G +R+++ Q+VY  L   +
Sbjct: 1  MEPSQVESILKDALSLSDVRVK---ANGSHFEVIAVGECFEGVSRVKKQQLVYAPLMADI 57

Query: 63 GN-ALHALSIKTSVP 76
           +  +HALSI+   P
Sbjct: 58 ASGVIHALSIRAFTP 72


>gi|89075255|ref|ZP_01161682.1| putative BolA/YrbA family protein, transcriptional regulator
          [Photobacterium sp. SKA34]
 gi|90580201|ref|ZP_01236008.1| putative BolA/YrbA family protein, transcriptional regulator
          [Vibrio angustum S14]
 gi|89048936|gb|EAR54504.1| putative BolA/YrbA family protein, transcriptional regulator
          [Photobacterium sp. SKA34]
 gi|90438503|gb|EAS63687.1| putative BolA/YrbA family protein, transcriptional regulator
          [Vibrio angustum S14]
          Length = 84

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EI+++++  +    V +    G+G+HY    +S  F G +R+++ Q +Y  L +++
Sbjct: 1  MEISEIKQILENALDLDEVIVK---GEGSHYEVIAVSTIFDGMSRVKKQQTIYGPLMDRI 57

Query: 63 -GNALHALSIKTSVPD 77
            N +HALSIKT  P+
Sbjct: 58 AANDIHALSIKTYTPE 73


>gi|168008029|ref|XP_001756710.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162692306|gb|EDQ78664.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 280

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 32/45 (71%)

Query: 32  HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+  +++SEEF+G + +++H+++Y  L  ++ N LHALS+ T  P
Sbjct: 233 HFNVKVVSEEFQGLSLVKRHRLIYGLLQEELQNGLHALSLVTKTP 277


>gi|312796409|ref|YP_004029331.1| BolA protein [Burkholderia rhizoxinica HKI 454]
 gi|312168184|emb|CBW75187.1| BolA protein [Burkholderia rhizoxinica HKI 454]
          Length = 102

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          Y   I++  F  + R+ +H++VYD+L + M   +HALSI    P+
Sbjct: 51 YTVTIVAAAFDSRTRVARHRLVYDALSDAMQRGIHALSIHAYTPE 95


>gi|297600547|ref|NP_001049402.2| Os03g0219500 [Oryza sativa Japonica Group]
 gi|255674316|dbj|BAF11316.2| Os03g0219500 [Oryza sativa Japonica Group]
          Length = 132

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 31/46 (67%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
            H+   +IS +F G++ +++H+MVYD L +++ + LHA+SI    P
Sbjct: 82  THFNIRVISPKFEGQSLVKRHRMVYDLLTDELNSGLHAISIVAKTP 127


>gi|268590736|ref|ZP_06124957.1| BolA/YrbA family protein [Providencia rettgeri DSM 1131]
 gi|291313508|gb|EFE53961.1| BolA/YrbA family protein [Providencia rettgeri DSM 1131]
          Length = 84

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 45/77 (58%), Gaps = 8/77 (10%)

Query: 3  MNPHEIEKMI--KKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M+ +EI++++  K  + ++IVT     GDG+H+    + + F G +R++Q Q +Y  L  
Sbjct: 1  MDTNEIKQVLMEKLSLNEAIVT-----GDGSHFQVIAVGDMFDGMSRVKQQQAIYAPLME 55

Query: 61 KMG-NALHALSIKTSVP 76
           +  N +HALSIK   P
Sbjct: 56 YIADNRIHALSIKAYTP 72


>gi|146306723|ref|YP_001187188.1| transcriptional regulator BolA [Pseudomonas mendocina ymp]
 gi|145574924|gb|ABP84456.1| transcriptional regulator, BolA protein family [Pseudomonas
          mendocina ymp]
          Length = 97

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G   HY A I+S  F G N +++HQ VY ++G  MG  +HAL++ T  P
Sbjct: 31 GLETHYKAVIVSPAFAGLNAVKRHQKVYATVGELMGQ-IHALALHTYTP 78


>gi|77165850|ref|YP_344375.1| BolA-like protein [Nitrosococcus oceani ATCC 19707]
 gi|254433554|ref|ZP_05047062.1| BolA-like protein [Nitrosococcus oceani AFC27]
 gi|76884164|gb|ABA58845.1| transcriptional regulator, BolA protein family [Nitrosococcus
          oceani ATCC 19707]
 gi|207089887|gb|EDZ67158.1| BolA-like protein [Nitrosococcus oceani AFC27]
          Length = 93

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 29/44 (65%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          Y   I++E F GK+ +++H+MVY ++   +G  +HALSIK   P
Sbjct: 44 YQVTIVAEAFNGKSLLERHRMVYSAVQEGIGQDIHALSIKAYTP 87


>gi|89094026|ref|ZP_01166970.1| regulator protein [Oceanospirillum sp. MED92]
 gi|89081700|gb|EAR60928.1| regulator protein [Oceanospirillum sp. MED92]
          Length = 105

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 33/49 (67%)

Query: 23 IHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSI 71
          +H    + +H+   ++S++F+GK  +Q+HQ +Y  + ++M N +HAL++
Sbjct: 28 MHSGPANDSHFKLTVVSDDFKGKRLVQRHQQIYGLMSDRMNNPIHALAM 76


>gi|302845674|ref|XP_002954375.1| bola-like protein [Volvox carteri f. nagariensis]
 gi|300260305|gb|EFJ44525.1| bola-like protein [Volvox carteri f. nagariensis]
          Length = 101

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 46/85 (54%), Gaps = 7/85 (8%)

Query: 1   MSMNPHEIEKMIKKGIPQSIVTIHDL------AGDGNHYAAEIISEEFRGKNRIQQHQMV 54
            +++  E EK I   +  S+ ++  +       G G  Y   I++E+F+G++ ++QHQ+V
Sbjct: 17  CTVSASEAEKAIANKLKASLKSVQQVEVQDTSGGCGAMYRISIVAEDFKGQSIVKQHQLV 76

Query: 55  YDSLGNKMGNALHALSIKTSVPDSQ 79
           +  L   +    H L+++TS P +Q
Sbjct: 77  HKILAEDL-RQWHGLTLQTSAPPAQ 100


>gi|159489852|ref|XP_001702905.1| predicted protein [Chlamydomonas reinhardtii]
 gi|158270928|gb|EDO96758.1| predicted protein [Chlamydomonas reinhardtii]
          Length = 100

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
            H+  E+ S+ F+G   +++HQ++Y  L ++    LHALS+ T  P  Q
Sbjct: 52  THFRLEVTSDAFKGLTLVKRHQLIYGLLSDEFKAGLHALSMTTKTPAEQ 100


>gi|225431595|ref|XP_002282721.1| PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
 gi|296088614|emb|CBI37605.3| unnamed protein product [Vitis vinifera]
          Length = 93

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 17 PQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          P  +  I    G G  +A EI+SE+F GK  +++H+MV  +L  ++   +HALSIK ++ 
Sbjct: 18 PSHLEVIDTSGGCGASFAIEIVSEQFEGKRLLERHRMVNAALQEELKQ-IHALSIKKALT 76

Query: 77 DSQ 79
            Q
Sbjct: 77 PEQ 79


>gi|108706882|gb|ABF94677.1| BolA-like protein, expressed [Oryza sativa Japonica Group]
 gi|108706883|gb|ABF94678.1| BolA-like protein, expressed [Oryza sativa Japonica Group]
 gi|108706884|gb|ABF94679.1| BolA-like protein, expressed [Oryza sativa Japonica Group]
 gi|149391321|gb|ABR25678.1| uv-induced protein uvi31 [Oryza sativa Indica Group]
 gi|215765366|dbj|BAG87063.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|218192349|gb|EEC74776.1| hypothetical protein OsI_10551 [Oryza sativa Indica Group]
 gi|222624475|gb|EEE58607.1| hypothetical protein OsJ_09945 [Oryza sativa Japonica Group]
          Length = 102

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 31/46 (67%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+   +IS +F G++ +++H+MVYD L +++ + LHA+SI    P
Sbjct: 52 THFNIRVISPKFEGQSLVKRHRMVYDLLTDELNSGLHAISIVAKTP 97


>gi|297799356|ref|XP_002867562.1| ATSUFE/CPSUFE/EMB1374 [Arabidopsis lyrata subsp. lyrata]
 gi|297313398|gb|EFH43821.1| ATSUFE/CPSUFE/EMB1374 [Arabidopsis lyrata subsp. lyrata]
          Length = 368

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 34/52 (65%), Gaps = 2/52 (3%)

Query: 27  AGDG--NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           AGD    H+   I+S+ F+GK+ +++H+++YD L  ++ + LHALSI    P
Sbjct: 314 AGDDGETHFNLRIVSDVFQGKSLVKRHRLIYDLLQEELKSGLHALSIVAKTP 365


>gi|260219455|emb|CBA26300.1| Uncharacterized protein in cobS 5'region [Curvibacter putative
          symbiont of Hydra magnipapillata]
          Length = 98

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 32/52 (61%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDS 78
          +G G H+  +I S  F G +R+ +H++VYDSL + +   LHAL+I+     S
Sbjct: 42 SGVGTHFRVKIASPLFTGVSRVARHRLVYDSLQDFIDQGLHALAIEAEASPS 93


>gi|294085476|ref|YP_003552236.1| BolA family protein [Candidatus Puniceispirillum marinum
          IMCC1322]
 gi|292665051|gb|ADE40152.1| BolA family protein [Candidatus Puniceispirillum marinum
          IMCC1322]
          Length = 86

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 30/48 (62%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSV 75
          G   H+   I S +F GK+R+QQH+MV + L +++ N +HAL +  S 
Sbjct: 38 GGETHFKLTITSPQFNGKSRVQQHRMVNNLLADELANGIHALEMHLSA 85


>gi|301618210|ref|XP_002938520.1| PREDICTED: bolA-like protein 1 [Xenopus (Silurana) tropicalis]
          Length = 187

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 31/49 (63%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           G   H+   ++SE F GK+ IQ+H++V + L +++   +HALSI+   P
Sbjct: 106 GSETHFKVVVVSESFLGKSLIQRHRLVNELLKDELAGPVHALSIQAKTP 154


>gi|238893383|ref|YP_002918117.1| putative regulator of murein genes [Klebsiella pneumoniae
          NTUH-K2044]
 gi|238545699|dbj|BAH62050.1| possible regulator of murein genes [Klebsiella pneumoniae subsp.
          pneumoniae NTUH-K2044]
          Length = 102

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 46/76 (60%), Gaps = 3/76 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTI--HDL-AGDGNHYAAEIISEEFRGKNRIQQHQMVYDS 57
          M+ +   +E+   + I +S + +  H++ AG  +H+   ++S+ F G+  + +H+M+Y +
Sbjct: 1  MNRSKQNLEQRSTRCISKSWMKVIRHNVPAGSESHFKVVLVSDRFTGERFLNRHRMIYGT 60

Query: 58 LGNKMGNALHALSIKT 73
          L  ++ N +HAL++ T
Sbjct: 61 LTEELSNTVHALALHT 76


>gi|254460732|ref|ZP_05074148.1| BolA protein [Rhodobacterales bacterium HTCC2083]
 gi|206677321|gb|EDZ41808.1| BolA protein [Rhodobacteraceae bacterium HTCC2083]
          Length = 86

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 32/49 (65%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G  +HY   I +E F GK+RI +H+MV+ +LG ++   +HAL++   VP
Sbjct: 38 GGESHYNLRIRAEVFEGKSRIARHRMVHAALGPELIGRIHALALDLDVP 86


>gi|294634668|ref|ZP_06713201.1| BolA/YrbA family protein [Edwardsiella tarda ATCC 23685]
 gi|291091914|gb|EFE24475.1| BolA/YrbA family protein [Edwardsiella tarda ATCC 23685]
          Length = 84

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVPD 77
          + GDG+H+   ++ E F G +R++Q Q VY  L   +  N +HAL+IK   P+
Sbjct: 21 VTGDGSHFQVIVVGELFAGMSRVKQQQAVYAPLMEYIADNRIHALTIKAYTPE 73


>gi|149199094|ref|ZP_01876134.1| BolA/YrbA family protein [Lentisphaera araneosa HTCC2155]
 gi|149137883|gb|EDM26296.1| BolA/YrbA family protein [Lentisphaera araneosa HTCC2155]
          Length = 84

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NA 65
          +IE+ I   +P + V I D   DG H+   +IS  F G   ++QH++V ++L  K   + 
Sbjct: 4  QIEQAILAVLPDAQVHIVD--PDGAHFQGLVISPSFVGVPLLKQHKLVMNALKEKFATDT 61

Query: 66 LHALSIKTSVPD 77
          +HAL +KT  P+
Sbjct: 62 VHALQLKTFTPE 73


>gi|192362166|ref|YP_001982666.1| cell division protein BolA [Cellvibrio japonicus Ueda107]
 gi|190688331|gb|ACE86009.1| cell division protein BolA [Cellvibrio japonicus Ueda107]
          Length = 117

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 30/49 (61%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G  +H+   I S +F GK ++Q+HQ +Y  L +++   +HAL++ T  P
Sbjct: 48 GSESHFKVVISSNQFEGKRQVQRHQAIYACLADELKQGVHALALHTYSP 96


>gi|225454591|ref|XP_002264335.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 161

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 38/62 (61%)

Query: 8   IEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALH 67
           +E  IK+ +    V++ D  GDG H + ++IS  F G++ + + +MVY ++  ++ + +H
Sbjct: 85  MENKIKEHLNAESVSVKDAYGDGRHVSIDVISSAFEGQSAVNRQRMVYKAIWEELQSTVH 144

Query: 68  AL 69
           A+
Sbjct: 145 AV 146


>gi|281209879|gb|EFA84047.1| bolA family protein [Polysphondylium pallidum PN500]
          Length = 85

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 45/74 (60%), Gaps = 2/74 (2%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          M++   ++E  +K G P S + + D++G  G  ++  I S++F G + +++H+M  D +G
Sbjct: 1  MTVTVEQLENTLKSGFPDSNIIVEDVSGGCGAKFSIVIGSDKFEGVSLLERHRMANDVIG 60

Query: 60 NKMGNALHALSIKT 73
            M + +HA++ KT
Sbjct: 61 ELMKD-IHAINFKT 73


>gi|168006488|ref|XP_001755941.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162692871|gb|EDQ79226.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 65

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 34/47 (72%), Gaps = 1/47 (2%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVP 76
           H+  +++SE+F+G+N +++H++VYD L +++    +HALS+ T  P
Sbjct: 17 THFNVKVVSEQFQGRNLLKRHRLVYDLLRDELQEGGVHALSLNTKTP 63


>gi|257205892|emb|CAX82597.1| transcription regulator 90.1 [Schistosoma japonicum]
          Length = 80

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 42/69 (60%), Gaps = 1/69 (1%)

Query: 8  IEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALH 67
          IE+ + +  P  I  +    G G  +  +++S+EF GK+ +Q+H++V+  L  +M  ++H
Sbjct: 5  IERKLSQLNPLHIEVVDFSDGCGLKFDVKVVSQEFEGKSLVQRHRIVHKQLEEEM-KSIH 63

Query: 68 ALSIKTSVP 76
          AL++KT  P
Sbjct: 64 ALTLKTLTP 72


>gi|224827300|ref|ZP_03700393.1| BolA family protein [Lutiella nitroferrum 2002]
 gi|224600513|gb|EEG06703.1| BolA family protein [Lutiella nitroferrum 2002]
          Length = 82

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 12 IKKGIPQSIVTIH-DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHAL 69
          +K+ I   +   H ++ GDG+H+ A ++SE F GK  I +H++V + +  ++  N +HAL
Sbjct: 7  VKQYIAAGLDCTHLEVEGDGHHFYAVVVSEAFAGKRLIDRHRLVKEVIKEQLQSNEIHAL 66

Query: 70 SI-KTSVPD 77
          SI K   P+
Sbjct: 67 SIVKAQTPE 75


>gi|159043752|ref|YP_001532546.1| BolA family protein [Dinoroseobacter shibae DFL 12]
 gi|157911512|gb|ABV92945.1| BolA family protein [Dinoroseobacter shibae DFL 12]
          Length = 85

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 31/45 (68%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIK 72
          G  +H+   I+SE+F G +RI +H+ V+D+LG  +   +HAL++K
Sbjct: 38 GGESHWNVRIVSEKFEGMSRIARHRAVHDALGKDLVGRIHALALK 82


>gi|302677895|ref|XP_003028630.1| hypothetical protein SCHCODRAFT_59433 [Schizophyllum commune
          H4-8]
 gi|300102319|gb|EFI93727.1| hypothetical protein SCHCODRAFT_59433 [Schizophyllum commune
          H4-8]
          Length = 77

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          M+++  ++E  I+  IP + + I D + G G  YA  ++S  F GKN + +H+MV + L 
Sbjct: 1  MAIDTTQLEAAIRNAIPVAHLEIEDQSSGCGESYAIILVSPAFEGKNTLARHRMVNEMLK 60

Query: 60 NKMGNALHALS 70
          N++   +HA S
Sbjct: 61 NEIAQ-MHAFS 70


>gi|148244295|ref|YP_001218989.1| hypothetical protein COSY_0131 [Candidatus Vesicomyosocius
          okutanii HA]
 gi|146326122|dbj|BAF61265.1| conserved hypothetical protein [Candidatus Vesicomyosocius
          okutanii HA]
          Length = 76

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 42/76 (55%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EI++ I+ GI  S V +    GDG   + ++IS  F G + + + +MV   +  ++
Sbjct: 1  MTLEEIKEKIELGIENSTVIME---GDGCSCSTKVISPIFEGMSLLARQKMVLAVMNKEI 57

Query: 63 GN-ALHALSIKTSVPD 77
           N  LHALSIKT  P+
Sbjct: 58 INGTLHALSIKTRTPE 73


>gi|332716414|ref|YP_004443880.1| stress induced morphogen [Agrobacterium sp. H13-3]
 gi|325063099|gb|ADY66789.1| stress induced morphogen [Agrobacterium sp. H13-3]
          Length = 93

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 43/81 (53%), Gaps = 12/81 (14%)

Query: 8  IEKMIKKGI-PQSIVTIH----------DLAGDG-NHYAAEIISEEFRGKNRIQQHQMVY 55
          IE  +++   PQ +V I           D+ G G  H   +I+SE F GK+RI++H+ + 
Sbjct: 7  IETKLRQSFSPQRLVVIDESQMHAGHQPDITGTGETHMRVQIVSESFAGKSRIERHRAIN 66

Query: 56 DSLGNKMGNALHALSIKTSVP 76
            L  ++   LHAL+I+ + P
Sbjct: 67 ALLKPELDAGLHALAIEAAAP 87


>gi|226945537|ref|YP_002800610.1| BolA-like protein [Azotobacter vinelandii DJ]
 gi|226720464|gb|ACO79635.1| BolA-like protein [Azotobacter vinelandii DJ]
          Length = 102

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 29/47 (61%), Gaps = 1/47 (2%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           HY A I+S +F G   +++HQ VY  LG  MG  +HAL++ T  P+
Sbjct: 35 THYKAVIVSPQFAGLGEVKRHQKVYAVLGELMGQ-MHALALHTYTPE 80


>gi|156052445|ref|XP_001592149.1| hypothetical protein SS1G_06388 [Sclerotinia sclerotiorum 1980]
 gi|154704168|gb|EDO03907.1| hypothetical protein SS1G_06388 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 157

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 37/57 (64%), Gaps = 2/57 (3%)

Query: 21  VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           + + D++G  G+ Y  E++SE+FRG N ++Q ++V   LG ++    H + ++TSVP
Sbjct: 102 LQVQDISGGCGSMYGIEVVSEKFRGLNMLKQQRLVNKVLGEEI-KGWHGVQLRTSVP 157


>gi|213584873|ref|ZP_03366699.1| hypothetical protein SentesTyph_28010 [Salmonella enterica subsp.
          enterica serovar Typhi str. E98-0664]
          Length = 90

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M  HEI+ ++   +  S+  +H ++GDG+H+    + E F G +R+++ Q VY  L   +
Sbjct: 14 MENHEIQSVLMNAL--SLQEVH-VSGDGSHFQVIAVGEMFDGMSRVKKQQTVYGPLMEYI 70

Query: 63 G-NALHALSIKTSVP 76
            N +HA+SIK   P
Sbjct: 71 ADNRIHAVSIKAYTP 85


>gi|161616317|ref|YP_001590282.1| hypothetical protein SPAB_04125 [Salmonella enterica subsp.
          enterica serovar Paratyphi B str. SPB7]
 gi|168243143|ref|ZP_02668075.1| protein YrbA [Salmonella enterica subsp. enterica serovar
          Heidelberg str. SL486]
 gi|168262680|ref|ZP_02684653.1| protein YrbA [Salmonella enterica subsp. enterica serovar Hadar
          str. RI_05P066]
 gi|194445146|ref|YP_002042566.1| hypothetical protein SNSL254_A3569 [Salmonella enterica subsp.
          enterica serovar Newport str. SL254]
 gi|194450760|ref|YP_002047337.1| hypothetical protein SeHA_C3605 [Salmonella enterica subsp.
          enterica serovar Heidelberg str. SL476]
 gi|194469585|ref|ZP_03075569.1| protein YrbA [Salmonella enterica subsp. enterica serovar
          Kentucky str. CVM29188]
 gi|194737647|ref|YP_002116258.1| protein YrbA [Salmonella enterica subsp. enterica serovar
          Schwarzengrund str. CVM19633]
 gi|195873606|ref|ZP_02697384.2| protein YrbA [Salmonella enterica subsp. enterica serovar Newport
          str. SL317]
 gi|197247651|ref|YP_002148233.1| protein YrbA [Salmonella enterica subsp. enterica serovar Agona
          str. SL483]
 gi|197264710|ref|ZP_03164784.1| protein YrbA [Salmonella enterica subsp. enterica serovar
          Saintpaul str. SARA23]
 gi|197301020|ref|ZP_02663067.2| protein YrbA [Salmonella enterica subsp. enterica serovar
          Schwarzengrund str. SL480]
 gi|198243584|ref|YP_002217279.1| hypothetical protein SeD_A3667 [Salmonella enterica subsp.
          enterica serovar Dublin str. CT_02021853]
 gi|200388834|ref|ZP_03215446.1| protein YrbA [Salmonella enterica subsp. enterica serovar Virchow
          str. SL491]
 gi|204931205|ref|ZP_03221999.1| protein YrbA [Salmonella enterica subsp. enterica serovar Javiana
          str. GA_MM04042433]
 gi|205357194|ref|ZP_02345796.2| protein YrbA [Salmonella enterica subsp. enterica serovar
          Saintpaul str. SARA29]
 gi|205358085|ref|ZP_02575592.2| protein YrbA [Salmonella enterica subsp. enterica serovar
          4,[5],12:i:- str. CVM23701]
 gi|205358493|ref|ZP_02656976.2| protein YrbA [Salmonella enterica subsp. enterica serovar
          Kentucky str. CDC 191]
 gi|205359709|ref|ZP_02831623.2| protein YrbA [Salmonella enterica subsp. enterica serovar
          Weltevreden str. HI_N05-537]
 gi|213612906|ref|ZP_03370732.1| protein YrbA [Salmonella enterica subsp. enterica serovar Typhi
          str. E98-2068]
 gi|238910102|ref|ZP_04653939.1| protein YrbA [Salmonella enterica subsp. enterica serovar
          Tennessee str. CDC07-0191]
 gi|161365681|gb|ABX69449.1| hypothetical protein SPAB_04125 [Salmonella enterica subsp.
          enterica serovar Paratyphi B str. SPB7]
 gi|194403809|gb|ACF64031.1| protein YrbA [Salmonella enterica subsp. enterica serovar Newport
          str. SL254]
 gi|194409064|gb|ACF69283.1| protein YrbA [Salmonella enterica subsp. enterica serovar
          Heidelberg str. SL476]
 gi|194455949|gb|EDX44788.1| protein YrbA [Salmonella enterica subsp. enterica serovar
          Kentucky str. CVM29188]
 gi|194713149|gb|ACF92370.1| protein YrbA [Salmonella enterica subsp. enterica serovar
          Schwarzengrund str. CVM19633]
 gi|195633546|gb|EDX51960.1| protein YrbA [Salmonella enterica subsp. enterica serovar Newport
          str. SL317]
 gi|197211354|gb|ACH48751.1| protein YrbA [Salmonella enterica subsp. enterica serovar Agona
          str. SL483]
 gi|197242965|gb|EDY25585.1| protein YrbA [Salmonella enterica subsp. enterica serovar
          Saintpaul str. SARA23]
 gi|197289139|gb|EDY28508.1| protein YrbA [Salmonella enterica subsp. enterica serovar
          Schwarzengrund str. SL480]
 gi|197938100|gb|ACH75433.1| protein YrbA [Salmonella enterica subsp. enterica serovar Dublin
          str. CT_02021853]
 gi|199605932|gb|EDZ04477.1| protein YrbA [Salmonella enterica subsp. enterica serovar Virchow
          str. SL491]
 gi|204319972|gb|EDZ05178.1| protein YrbA [Salmonella enterica subsp. enterica serovar Javiana
          str. GA_MM04042433]
 gi|205323239|gb|EDZ11078.1| protein YrbA [Salmonella enterica subsp. enterica serovar
          Saintpaul str. SARA29]
 gi|205327627|gb|EDZ14391.1| protein YrbA [Salmonella enterica subsp. enterica serovar
          4,[5],12:i:- str. CVM23701]
 gi|205333769|gb|EDZ20533.1| protein YrbA [Salmonella enterica subsp. enterica serovar
          Kentucky str. CDC 191]
 gi|205337732|gb|EDZ24496.1| protein YrbA [Salmonella enterica subsp. enterica serovar
          Heidelberg str. SL486]
 gi|205343278|gb|EDZ30042.1| protein YrbA [Salmonella enterica subsp. enterica serovar
          Weltevreden str. HI_N05-537]
 gi|205348310|gb|EDZ34941.1| protein YrbA [Salmonella enterica subsp. enterica serovar Hadar
          str. RI_05P066]
 gi|321225268|gb|EFX50327.1| YrbA protein [Salmonella enterica subsp. enterica serovar
          Typhimurium str. TN061786]
 gi|322615312|gb|EFY12233.1| protein YrbA [Salmonella enterica subsp. enterica serovar
          Montevideo str. 315996572]
 gi|322631381|gb|EFY28141.1| protein YrbA [Salmonella enterica subsp. enterica serovar
          Montevideo str. 515920-1]
 gi|322664171|gb|EFY60369.1| protein YrbA [Salmonella enterica subsp. enterica serovar
          Montevideo str. 81038-01]
 gi|322684904|gb|EFY80902.1| protein YrbA [Salmonella enterica subsp. enterica serovar
          Montevideo str. 446600]
 gi|323195891|gb|EFZ81062.1| protein YrbA [Salmonella enterica subsp. enterica serovar
          Montevideo str. 609458-1]
 gi|323221230|gb|EGA05656.1| protein YrbA [Salmonella enterica subsp. enterica serovar
          Montevideo str. MB102109-0047]
 gi|323246924|gb|EGA30890.1| protein YrbA [Salmonella enterica subsp. enterica serovar
          Montevideo str. IA_2009159199]
 gi|323269419|gb|EGA52874.1| protein YrbA [Salmonella enterica subsp. enterica serovar
          Montevideo str. IA_2010008287]
          Length = 84

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M  HEI+ ++   +  S+  +H ++GDG+H+    + E F G +R+++ Q VY  L   +
Sbjct: 1  MENHEIQSVLMNAL--SLQEVH-VSGDGSHFQVIAVGEMFDGMSRVKKQQTVYGPLMEYI 57

Query: 63 G-NALHALSIKTSVP 76
            N +HA+SIK   P
Sbjct: 58 ADNRIHAVSIKAYTP 72


>gi|144900250|emb|CAM77114.1| BolA-like protein [Magnetospirillum gryphiswaldense MSR-1]
          Length = 96

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 28/47 (59%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           H+   ++S  F GK+R+++H+MV   L  ++   +HAL + T  PD
Sbjct: 48 THFKVAVVSAAFAGKSRVERHRMVNTLLAEELAGPVHALQLVTKTPD 94


>gi|194366460|ref|YP_002029070.1| BolA family protein [Stenotrophomonas maltophilia R551-3]
 gi|194349264|gb|ACF52387.1| BolA family protein [Stenotrophomonas maltophilia R551-3]
          Length = 91

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 45/90 (50%), Gaps = 13/90 (14%)

Query: 3  MNPHEIEKM---IKKGIPQSIVTIHD---------LAGDGN-HYAAEIISEEFRGKNRIQ 49
          MN   IE++   +++ +  S++ I D          A DG  H+   ++S+ F G   + 
Sbjct: 1  MNAERIERIRDALQQALTPSVLEIEDDSHRHAGHAGARDGRGHFNVHVVSDRFAGLGPLA 60

Query: 50 QHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
          +H+ VY +LG  M   +HALSI+   P  Q
Sbjct: 61 RHRAVYTALGAMMETDIHALSIRALTPSEQ 90


>gi|226477888|emb|CAX72651.1| transcription regulator [Schistosoma japonicum]
          Length = 93

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 42/69 (60%), Gaps = 1/69 (1%)

Query: 8  IEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALH 67
          IE+ + +  P  I  +    G G  +  +++S+EF GK+ +Q+H++V+  L  +M  ++H
Sbjct: 18 IERKLSQLNPLHIEVVDFSDGCGLKFDVKVVSQEFEGKSLVQRHRIVHKQLEEEM-KSIH 76

Query: 68 ALSIKTSVP 76
          AL++KT  P
Sbjct: 77 ALTLKTLTP 85


>gi|16762070|ref|NP_457687.1| hypothetical protein STY3487 [Salmonella enterica subsp. enterica
          serovar Typhi str. CT18]
 gi|16766603|ref|NP_462218.1| transcriptional regulator [Salmonella enterica subsp. enterica
          serovar Typhimurium str. LT2]
 gi|29143559|ref|NP_806901.1| hypothetical protein t3225 [Salmonella enterica subsp. enterica
          serovar Typhi str. Ty2]
 gi|56415237|ref|YP_152312.1| hypothetical protein SPA3175 [Salmonella enterica subsp. enterica
          serovar Paratyphi A str. ATCC 9150]
 gi|62181816|ref|YP_218233.1| BolA family transcriptional regulator [Salmonella enterica subsp.
          enterica serovar Choleraesuis str. SC-B67]
 gi|197364167|ref|YP_002143804.1| hypothetical protein SSPA2963 [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. AKU_12601]
 gi|205354209|ref|YP_002228010.1| hypothetical protein SG3198 [Salmonella enterica subsp. enterica
          serovar Gallinarum str. 287/91]
 gi|207858556|ref|YP_002245207.1| hypothetical protein SEN3141 [Salmonella enterica subsp. enterica
          serovar Enteritidis str. P125109]
 gi|213028329|ref|ZP_03342776.1| hypothetical protein Salmonelentericaenterica_40940 [Salmonella
          enterica subsp. enterica serovar Typhi str. 404ty]
 gi|213053030|ref|ZP_03345908.1| hypothetical protein Salmoneentericaenterica_09003 [Salmonella
          enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213426649|ref|ZP_03359399.1| hypothetical protein SentesTyphi_14168 [Salmonella enterica
          subsp. enterica serovar Typhi str. E02-1180]
 gi|213646985|ref|ZP_03377038.1| hypothetical protein SentesTy_06556 [Salmonella enterica subsp.
          enterica serovar Typhi str. J185]
 gi|213857283|ref|ZP_03384254.1| hypothetical protein SentesT_19080 [Salmonella enterica subsp.
          enterica serovar Typhi str. M223]
 gi|224585105|ref|YP_002638904.1| hypothetical protein SPC_3378 [Salmonella enterica subsp.
          enterica serovar Paratyphi C strain RKS4594]
 gi|289803532|ref|ZP_06534161.1| hypothetical protein Salmonellaentericaenterica_02862 [Salmonella
          enterica subsp. enterica serovar Typhi str. AG3]
 gi|289825818|ref|ZP_06544986.1| hypothetical protein Salmonellentericaenterica_10446 [Salmonella
          enterica subsp. enterica serovar Typhi str. E98-3139]
 gi|25300382|pir||AC0904 conserved hypothetical protein STY3487 [imported] - Salmonella
          enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16421865|gb|AAL22177.1| putative BolA family transcriptional regulator [Salmonella
          enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|16504373|emb|CAD07825.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Typhi]
 gi|29139194|gb|AAO70761.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Typhi str. Ty2]
 gi|56129494|gb|AAV79000.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. ATCC 9150]
 gi|62129449|gb|AAX67152.1| putative transcriptional regulator (BolA family) [Salmonella
          enterica subsp. enterica serovar Choleraesuis str.
          SC-B67]
 gi|197095644|emb|CAR61212.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. AKU_12601]
 gi|205273990|emb|CAR38996.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Gallinarum str. 287/91]
 gi|206710359|emb|CAR34717.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Enteritidis str. P125109]
 gi|224469633|gb|ACN47463.1| hypothetical protein SPC_3378 [Salmonella enterica subsp.
          enterica serovar Paratyphi C strain RKS4594]
 gi|261248473|emb|CBG26310.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Typhimurium str. D23580]
 gi|267995506|gb|ACY90391.1| putative transcriptional regulator [Salmonella enterica subsp.
          enterica serovar Typhimurium str. 14028S]
 gi|301159857|emb|CBW19376.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Typhimurium str. SL1344]
 gi|312914335|dbj|BAJ38309.1| hypothetical protein STMDT12_C33660 [Salmonella enterica subsp.
          enterica serovar Typhimurium str. T000240]
 gi|320087753|emb|CBY97517.1| Uncharacterized protein yrbA [Salmonella enterica subsp. enterica
          serovar Weltevreden str. 2007-60-3289-1]
 gi|322618329|gb|EFY15220.1| hypothetical protein SEEM971_03345 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 495297-1]
 gi|322622866|gb|EFY19710.1| hypothetical protein SEEM973_10080 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 495297-3]
 gi|322626812|gb|EFY23609.1| hypothetical protein SEEM974_16969 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 495297-4]
 gi|322635352|gb|EFY32066.1| hypothetical protein SEEM202_21318 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 515920-2]
 gi|322643351|gb|EFY39915.1| hypothetical protein SEEM954_06163 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 531954]
 gi|322647077|gb|EFY43578.1| hypothetical protein SEEM054_06193 [Salmonella enterica subsp.
          enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322648880|gb|EFY45325.1| hypothetical protein SEEM675_09082 [Salmonella enterica subsp.
          enterica serovar Montevideo str. OH_2009072675]
 gi|322655072|gb|EFY51383.1| hypothetical protein SEEM965_16431 [Salmonella enterica subsp.
          enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322657675|gb|EFY53943.1| hypothetical protein SEEM19N_17131 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 19N]
 gi|322667454|gb|EFY63616.1| hypothetical protein SEEM507_15355 [Salmonella enterica subsp.
          enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674702|gb|EFY70794.1| hypothetical protein SEEM877_12169 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 414877]
 gi|322675665|gb|EFY71738.1| hypothetical protein SEEM867_11179 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 366867]
 gi|322682301|gb|EFY78324.1| hypothetical protein SEEM180_00812 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 413180]
 gi|322716305|gb|EFZ07876.1| BolA-like protein [Salmonella enterica subsp. enterica serovar
          Choleraesuis str. A50]
 gi|323131668|gb|ADX19098.1| putative transcriptional regulator [Salmonella enterica subsp.
          enterica serovar Typhimurium str. 4/74]
 gi|323199008|gb|EFZ84105.1| hypothetical protein SEEM501_06361 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 556150-1]
 gi|323204292|gb|EFZ89301.1| hypothetical protein SEEM460_13137 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 609460]
 gi|323207639|gb|EFZ92586.1| hypothetical protein SEEM020_13782 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 507440-20]
 gi|323211308|gb|EFZ96152.1| hypothetical protein SEEM6152_16870 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 556152]
 gi|323214750|gb|EFZ99499.1| hypothetical protein SEEM0077_18969 [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB101509-0077]
 gi|323224029|gb|EGA08322.1| hypothetical protein SEEM0055_21830 [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB110209-0055]
 gi|323230322|gb|EGA14441.1| hypothetical protein SEEM0052_18674 [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB111609-0052]
 gi|323233298|gb|EGA17392.1| hypothetical protein SEEM3312_09501 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 2009083312]
 gi|323239335|gb|EGA23385.1| hypothetical protein SEEM5258_07035 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 2009085258]
 gi|323242414|gb|EGA26440.1| hypothetical protein SEEM1156_15697 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 315731156]
 gi|323254143|gb|EGA37963.1| hypothetical protein SEEM8282_00520 [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008282]
 gi|323255260|gb|EGA39037.1| hypothetical protein SEEM8283_18807 [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008283]
 gi|323262723|gb|EGA46279.1| hypothetical protein SEEM8284_03166 [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008284]
 gi|323264033|gb|EGA47541.1| hypothetical protein SEEM8285_04150 [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008285]
 gi|326625058|gb|EGE31403.1| BolA-like protein [Salmonella enterica subsp. enterica serovar
          Dublin str. 3246]
 gi|326629331|gb|EGE35674.1| hypothetical protein SG9_3242 [Salmonella enterica subsp.
          enterica serovar Gallinarum str. 9]
 gi|332990166|gb|AEF09149.1| putative transcriptional regulator [Salmonella enterica subsp.
          enterica serovar Typhimurium str. UK-1]
          Length = 97

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M  HEI+ ++   +  S+  +H ++GDG+H+    + E F G +R+++ Q VY  L   +
Sbjct: 14 MENHEIQSVLMNAL--SLQEVH-VSGDGSHFQVIAVGEMFDGMSRVKKQQTVYGPLMEYI 70

Query: 63 G-NALHALSIKTSVP 76
            N +HA+SIK   P
Sbjct: 71 ADNRIHAVSIKAYTP 85


>gi|183221290|ref|YP_001839286.1| putative BolA-like protein [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Paris)']
 gi|167779712|gb|ABZ98010.1| Putative BolA-like protein [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Paris)']
          Length = 84

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+  ++IS++FR +  ++QH+ VY  LG +    LHAL +  S P
Sbjct: 36 THFRIKLISDQFRDQTTVEQHRKVYSVLGPEFKKGLHALEMDLSAP 81


>gi|209694105|ref|YP_002262033.1| hypothetical protein VSAL_I0510 [Aliivibrio salmonicida LFI1238]
 gi|208008056|emb|CAQ78195.1| conserved hypothetical protein [Aliivibrio salmonicida LFI1238]
          Length = 85

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+  EI++++   +   +  IH + G+G+H+    + E F G NR+++ Q +Y  L   +
Sbjct: 1  MDSAEIKELLDAAL--QLQEIH-VKGEGSHFEVIAVDESFNGMNRVKKQQTIYGPLMEHI 57

Query: 63 G-NALHALSIKTSVPD 77
            N +HALSIK   P+
Sbjct: 58 STNTIHALSIKAFTPE 73


>gi|254429771|ref|ZP_05043478.1| BolA-like protein [Alcanivorax sp. DG881]
 gi|196195940|gb|EDX90899.1| BolA-like protein [Alcanivorax sp. DG881]
          Length = 84

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 40/75 (53%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MNP E++ ++  G   + V +    G G+ +   ++SE F G   +++ Q+VY ++  ++
Sbjct: 1  MNPEEVQALVDAGFDNADVAVE---GGGDRFQIRVVSEAFAGLMPVKRQQLVYATIDEQI 57

Query: 63 -GNALHALSIKTSVP 76
            N +HA+ I    P
Sbjct: 58 KSNTIHAVQIIAFTP 72


>gi|171463574|ref|YP_001797687.1| BolA family protein [Polynucleobacter necessarius subsp.
          necessarius STIR1]
 gi|171193112|gb|ACB44073.1| BolA family protein [Polynucleobacter necessarius subsp.
          necessarius STIR1]
          Length = 94

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G H+  EI++ EF+G N + +H  VY++L   +   +HAL+I    PD
Sbjct: 43 GGHFRLEIVTPEFKGLNLVARHIAVYNALNRYIPKDIHALTINAMAPD 90


>gi|94501780|ref|ZP_01308293.1| predicted transcriptional regulator, BolA superfamily protein
          [Oceanobacter sp. RED65]
 gi|94426088|gb|EAT11083.1| predicted transcriptional regulator, BolA superfamily protein
          [Oceanobacter sp. RED65]
          Length = 80

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 44/72 (61%), Gaps = 4/72 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+P  +++++ + +    V++    GDG  Y   +I + F G N +++ Q VY +L +K+
Sbjct: 1  MSPEALQELLAERLSDCQVSVD---GDGYQYQITVIGDVFEGLNTVKRQQHVYGALNDKI 57

Query: 63 GN-ALHALSIKT 73
           + ++HA++IKT
Sbjct: 58 TDGSVHAVTIKT 69


>gi|159185831|ref|NP_356987.2| stress induced morphogen [Agrobacterium tumefaciens str. C58]
 gi|159140965|gb|AAK89772.2| stress induced morphogen [Agrobacterium tumefaciens str. C58]
          Length = 93

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 25 DLAGDG-NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          D+ G G  H   +I+SE F GK+RI++H+ +   L  ++   LHAL+I+ + P
Sbjct: 35 DMTGTGETHMRVQIVSESFSGKSRIERHRAINALLKPELDAGLHALAIEAAAP 87


>gi|116783960|gb|ABK23160.1| unknown [Picea sitchensis]
          Length = 173

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 40/70 (57%), Gaps = 1/70 (1%)

Query: 8   IEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALH 67
           ++  IK+ +    V + D  GDG H + ++IS  F G++ + + +MVY ++  ++ N +H
Sbjct: 95  MQNKIKEQLNADEVIVKDAYGDGRHVSIDVISSAFEGQSHVNRQRMVYKAIWEELQNTVH 154

Query: 68  AL-SIKTSVP 76
           A+  + T  P
Sbjct: 155 AVDQMTTKTP 164


>gi|189911381|ref|YP_001962936.1| BolA family transcriptional regulator [Leptospira biflexa serovar
          Patoc strain 'Patoc 1 (Ames)']
 gi|167776057|gb|ABZ94358.1| Transcriptional regulator, BolA-family [Leptospira biflexa
          serovar Patoc strain 'Patoc 1 (Ames)']
          Length = 96

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+  ++IS++FR +  ++QH+ VY  LG +    LHAL +  S P
Sbjct: 48 THFRIKLISDQFRDQTTVEQHRKVYSVLGPEFKKGLHALEMDLSAP 93


>gi|302765202|ref|XP_002966022.1| hypothetical protein SELMODRAFT_439428 [Selaginella moellendorffii]
 gi|300166836|gb|EFJ33442.1| hypothetical protein SELMODRAFT_439428 [Selaginella moellendorffii]
          Length = 351

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 45/82 (54%), Gaps = 13/82 (15%)

Query: 8   IEKMIKKGIPQSIVTIHDLA-------------GDGNHYAAEIISEEFRGKNRIQQHQMV 54
           IEK +++ +  +++ + D++             G   H+  ++++ EF G++ +++H+ V
Sbjct: 266 IEKKLQEALAPTVLEVEDVSHQHAGHAAVRGTTGGETHFNVKVVAAEFEGQSVVKRHRRV 325

Query: 55  YDSLGNKMGNALHALSIKTSVP 76
           Y  L +++ + LHALSI    P
Sbjct: 326 YQLLEDELKSGLHALSIVAKAP 347


>gi|27764549|gb|AAO23079.1| unknown [Glycine max]
          Length = 104

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 31/46 (67%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+   I+S +F G++ +++H+++YD L +++ + LHALSI    P
Sbjct: 52 THFNLNIVSPKFEGQSLVKRHRLIYDLLADELQSGLHALSIVAKTP 97


>gi|88800102|ref|ZP_01115672.1| stress-induced morphogen [Reinekea sp. MED297]
 gi|88777228|gb|EAR08433.1| stress-induced morphogen [Reinekea sp. MED297]
          Length = 100

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          A    H+   ++SE+FRG   +++HQ VY  L +++   +HAL++    PD
Sbjct: 32 ANSETHFKVTLVSEQFRGMRAVKRHQSVYGLLKDELAGPVHALALHLYTPD 82


>gi|90413011|ref|ZP_01221009.1| putative BolA/YrbA family protein, transcriptional regulator
          [Photobacterium profundum 3TCK]
 gi|90326026|gb|EAS42465.1| putative BolA/YrbA family protein, transcriptional regulator
          [Photobacterium profundum 3TCK]
          Length = 84

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 39/66 (59%), Gaps = 3/66 (4%)

Query: 14 KGIPQSIVTIHDL--AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALS 70
          K I ++ +T+ ++   G+G+HY    +   F G +R+++ Q VY  L   +  NA+HALS
Sbjct: 7  KQILETALTLDEVIVKGEGSHYEVIAVGAMFDGMSRVKKQQTVYAPLMEHIATNAIHALS 66

Query: 71 IKTSVP 76
          IKT  P
Sbjct: 67 IKTYTP 72


>gi|319786323|ref|YP_004145798.1| BolA family protein [Pseudoxanthomonas suwonensis 11-1]
 gi|317464835|gb|ADV26567.1| BolA family protein [Pseudoxanthomonas suwonensis 11-1]
          Length = 106

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           HY A ++S+ F GK  IQ+HQ VY ++G  M   +HAL++ T  P
Sbjct: 35 THYKAVVVSDAFDGKRLIQRHQAVYAAMGGLM-QQIHALALHTYTP 79


>gi|221107609|ref|XP_002161313.1| PREDICTED: similar to LOC100170577 protein [Hydra magnipapillata]
          Length = 109

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   H+   ++S+EF GK  IQ+H+++ D L  ++   +HALSI+   P+
Sbjct: 40 GAETHFKVVVVSKEFDGKPLIQRHRLINDLLKQELLAGVHALSIQAKTPE 89


>gi|193222334|emb|CAL61894.2| Putative stress-induced morphogen BolA protein [Herminiimonas
          arsenicoxydans]
          Length = 89

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 28/44 (63%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          +   IIS +F  ++RI++H++VYD L + M   +HAL+I    P
Sbjct: 43 FRLRIISTQFEKQSRIKRHRLVYDCLDDMMQTEIHALAITALAP 86


>gi|58037151|ref|NP_081251.1| bolA-like protein 1 [Mus musculus]
 gi|59797965|sp|Q9D8S9|BOLA1_MOUSE RecName: Full=BolA-like protein 1
 gi|12841442|dbj|BAB25210.1| unnamed protein product [Mus musculus]
 gi|20380458|gb|AAH27558.1| BolA-like 1 (E. coli) [Mus musculus]
 gi|148706924|gb|EDL38871.1| bolA-like 1 (E. coli), isoform CRA_a [Mus musculus]
 gi|148706925|gb|EDL38872.1| bolA-like 1 (E. coli), isoform CRA_a [Mus musculus]
 gi|148706926|gb|EDL38873.1| bolA-like 1 (E. coli), isoform CRA_a [Mus musculus]
          Length = 137

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 31/50 (62%)

Query: 27  AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           AG   H+   ++S  F G + +Q+H++V+++L  ++   +HAL+I+   P
Sbjct: 62  AGSETHFRVAVVSSRFEGMSPLQRHRLVHEALSEELAGPVHALAIQAKTP 111


>gi|134094944|ref|YP_001100019.1| BolA protein [Herminiimonas arsenicoxydans]
          Length = 85

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 28/44 (63%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          +   IIS +F  ++RI++H++VYD L + M   +HAL+I    P
Sbjct: 39 FRLRIISTQFEKQSRIKRHRLVYDCLDDMMQTEIHALAITALAP 82


>gi|91791865|ref|YP_561516.1| BolA-like protein [Shewanella denitrificans OS217]
 gi|91713867|gb|ABE53793.1| BolA-like protein [Shewanella denitrificans OS217]
          Length = 83

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA-LHALSIKTSVP 76
          + DG+HY    + E F G +R++Q Q +Y  L   + +  LHAL+IKT  P
Sbjct: 22 SADGSHYKVVAVGECFDGMSRVKQQQAIYGPLNEYIASGELHALTIKTFTP 72


>gi|330994811|ref|ZP_08318733.1| SufE-like protein [Gluconacetobacter sp. SXCC-1]
 gi|329758072|gb|EGG74594.1| SufE-like protein [Gluconacetobacter sp. SXCC-1]
          Length = 104

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
          +HY   ++S  F G  R+Q+ +MV+D L  +    +HALS+    PD Q
Sbjct: 50 SHYNVLVVSPAFEGVGRVQRSRMVHDLLAAEFAGGMHALSLVLRTPDEQ 98


>gi|291386512|ref|XP_002709670.1| PREDICTED: bolA homolog 3-like [Oryctolagus cuniculus]
          Length = 97

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 44/71 (61%), Gaps = 3/71 (4%)

Query: 8  IEKMIKKGIPQSI-VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
          + +++++  P++  + + D++G  G  Y  +I SE+F+ K  +QQHQMV  +L  ++   
Sbjct: 26 VTQILREKFPRATAIKVTDISGGCGAMYEIKIESEDFKEKRTVQQHQMVNQALKEEI-KE 84

Query: 66 LHALSIKTSVP 76
          +H L I TSVP
Sbjct: 85 MHGLRIFTSVP 95


>gi|302776630|ref|XP_002971468.1| hypothetical protein SELMODRAFT_441524 [Selaginella moellendorffii]
 gi|300160600|gb|EFJ27217.1| hypothetical protein SELMODRAFT_441524 [Selaginella moellendorffii]
          Length = 352

 Score = 43.1 bits (100), Expect = 0.011,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 45/82 (54%), Gaps = 13/82 (15%)

Query: 8   IEKMIKKGIPQSIVTIHDLA-------------GDGNHYAAEIISEEFRGKNRIQQHQMV 54
           IEK +++ +  +++ + D++             G   H+  ++++ EF G++ +++H+ V
Sbjct: 267 IEKKLQEALAPTVLEVEDVSHQHAGHAAVRGTTGGETHFNVKVVAAEFEGQSVVKRHRRV 326

Query: 55  YDSLGNKMGNALHALSIKTSVP 76
           Y  L +++ + LHALSI    P
Sbjct: 327 YQLLEDELKSGLHALSIVAKAP 348


>gi|147773413|emb|CAN60268.1| hypothetical protein VITISV_029393 [Vitis vinifera]
          Length = 90

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
          G G  +A EI+SE+F GK  +++H+MV  +L  ++   +HALSIK ++   Q
Sbjct: 26 GCGASFAIEIVSEQFEGKRLLERHRMVNAALQEELKQ-IHALSIKKALTPEQ 76


>gi|114777424|ref|ZP_01452421.1| hypothetical protein SPV1_14029 [Mariprofundus ferrooxydans PV-1]
 gi|114552206|gb|EAU54708.1| hypothetical protein SPV1_14029 [Mariprofundus ferrooxydans PV-1]
          Length = 90

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSI 71
          G HY   I  E F GK+R+Q H+MV+ +L +    ++HALSI
Sbjct: 41 GGHYHVRITGEHFAGKSRLQCHRMVHQALASLFPKSIHALSI 82


>gi|302893168|ref|XP_003045465.1| hypothetical protein NECHADRAFT_79560 [Nectria haematococca mpVI
           77-13-4]
 gi|256726391|gb|EEU39752.1| hypothetical protein NECHADRAFT_79560 [Nectria haematococca mpVI
           77-13-4]
          Length = 131

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 46/79 (58%), Gaps = 4/79 (5%)

Query: 2   SMNPHE--IEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSL 58
           SM P E  I +++ + +  S + + D++G  G+ YA +I S  F+G+  ++Q +MV  +L
Sbjct: 52  SMTPAESAIAEILAEKLSPSELLVQDVSGGCGSMYAIDITSAAFKGQTILKQQRMVNAAL 111

Query: 59  GNKMGNALHALSIKTSVPD 77
           G+ +    H + I+T VP 
Sbjct: 112 GD-LVKGWHGVQIRTKVPS 129


>gi|127514227|ref|YP_001095424.1| BolA family protein [Shewanella loihica PV-4]
 gi|126639522|gb|ABO25165.1| BolA family protein [Shewanella loihica PV-4]
          Length = 83

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 44/75 (58%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M  +EIE+++ + +  ++  +H ++ DG HY    + E F G +R++Q QM+Y  L   +
Sbjct: 1  MECNEIEQLLSQAL--TLDEVH-VSQDGTHYKIVAVGECFDGVSRVKQQQMIYGPLMEHV 57

Query: 63 GN-ALHALSIKTSVP 76
           + ALHA++I    P
Sbjct: 58 TSGALHAITINAFTP 72


>gi|159466014|ref|XP_001691204.1| hypothetical protein CHLREDRAFT_115146 [Chlamydomonas
          reinhardtii]
 gi|158279176|gb|EDP04937.1| predicted protein [Chlamydomonas reinhardtii]
          Length = 93

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 28/46 (60%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+  E++SE F G  ++++ +MVY  L ++    LHAL++ T  P
Sbjct: 43 THFKVEVVSEAFEGLTQVKRQRMVYQLLADEFNMGLHALALVTRTP 88


>gi|332030094|gb|EGI69919.1| BolA-like protein 3 [Acromyrmex echinatior]
          Length = 101

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 47/78 (60%), Gaps = 6/78 (7%)

Query: 6   HEIEKMI---KKGIPQS-IVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
           H  EKMI   +   PQ+ ++ + D++G  G  +   +++ EF+G N ++QHQ++   L  
Sbjct: 25  HAEEKMISILRNRFPQAQLIEVTDVSGGCGAMFDINVVASEFKGLNTVKQHQIINKVLKE 84

Query: 61  KMGNALHALSIKTSVPDS 78
           ++ + +H L I+TS+P +
Sbjct: 85  EIKD-MHGLRIRTSIPQT 101


>gi|115392007|ref|NP_001065244.1| bolA-like protein 1 [Rattus norvegicus]
 gi|114803731|gb|ABI81220.1| unknown [Rattus norvegicus]
 gi|149030608|gb|EDL85645.1| bolA-like 1 (E. coli) (predicted) [Rattus norvegicus]
          Length = 137

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 31/50 (62%)

Query: 27  AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           AG   H+   ++S  F G + +Q+H++V+++L  ++   +HAL+I+   P
Sbjct: 62  AGSETHFRVAVVSSRFEGMSPLQRHRLVHEALSEELAGPVHALAIQAKTP 111


>gi|300114811|ref|YP_003761386.1| BolA family protein [Nitrosococcus watsonii C-113]
 gi|299540748|gb|ADJ29065.1| BolA family protein [Nitrosococcus watsonii C-113]
          Length = 93

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 29/44 (65%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          Y   I+++ F GK+ +++H+MVY ++   MG  +HALSIK   P
Sbjct: 44 YRVIIVAQAFSGKSLLERHRMVYKAVQEGMGQDIHALSIKAYTP 87


>gi|262404627|ref|ZP_06081182.1| cell division protein BolA [Vibrio sp. RC586]
 gi|262349659|gb|EEY98797.1| cell division protein BolA [Vibrio sp. RC586]
          Length = 106

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G  +H+   IISE F G   + +H++V  +L +++ N +HAL+I T  P+
Sbjct: 33 GSESHFKVTIISECFEGLRLVARHRLVNQTLSDELANHIHALAIHTYTPE 82


>gi|110635396|ref|YP_675604.1| transcriptional regulator BolA [Mesorhizobium sp. BNC1]
 gi|110286380|gb|ABG64439.1| transcriptional regulator, BolA protein family [Chelativorans sp.
          BNC1]
          Length = 100

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 23 IHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          + D  G+  H+   I+S  F GK RI++H+ V + L  ++   LHAL+I+ + P
Sbjct: 42 VFDGTGE-THFRVRIVSAAFAGKTRIERHRAVNEVLAEELKRGLHALAIEPAAP 94


>gi|238231352|ref|NP_001154110.1| BolA-like protein 3 [Oncorhynchus mykiss]
 gi|225704098|gb|ACO07895.1| BolA-like protein 3 [Oncorhynchus mykiss]
          Length = 105

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 3/71 (4%)

Query: 8   IEKMIKKGIPQSI-VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
           I +++K+  P +  + + D++G  G  Y   I S EF+GK  IQQHQ+V  +L  ++   
Sbjct: 34  IAQLLKEKFPSATSLKVVDISGGCGAMYEVHIESNEFKGKRTIQQHQLVNQALKEEI-QG 92

Query: 66  LHALSIKTSVP 76
           +H L I T VP
Sbjct: 93  MHGLRIFTDVP 103


>gi|329899112|ref|ZP_08272519.1| BolA-like protein [gamma proteobacterium IMCC3088]
 gi|328920678|gb|EGG28158.1| BolA-like protein [gamma proteobacterium IMCC3088]
          Length = 77

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+   +E ++  G+P+  VT+ +    G HY    +  EF G   +++ Q+VY  + + +
Sbjct: 1  MDAQTLEDIVAAGLPECDVTVTE---QGGHYTIHAVGAEFEGLRAVKRQQLVYAVVADLI 57

Query: 63 -GNALHALSIKTSVP 76
              +HA++I+   P
Sbjct: 58 AAGTIHAVNIRAKTP 72


>gi|157148761|ref|YP_001456080.1| hypothetical protein CKO_04593 [Citrobacter koseri ATCC BAA-895]
 gi|157085966|gb|ABV15644.1| hypothetical protein CKO_04593 [Citrobacter koseri ATCC BAA-895]
          Length = 97

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M  HEI+ ++   +  S+  +H ++GDG+H+    + E F G +R+++ Q VY  L   +
Sbjct: 14 MENHEIQSVLMSAL--SLQEVH-VSGDGSHFQVIAVGEMFDGMSRVKKQQSVYGPLMEFI 70

Query: 63 G-NALHALSIKTSVP 76
            N +HA+SIK   P
Sbjct: 71 ADNRIHAVSIKAYTP 85


>gi|255089915|ref|XP_002506879.1| predicted protein [Micromonas sp. RCC299]
 gi|226522152|gb|ACO68137.1| predicted protein [Micromonas sp. RCC299]
          Length = 90

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+    +SE F G N + +H++VY  L  ++ + +HALS+KT  P
Sbjct: 43 THFKVYCVSEAFAGMNMVARHRLVYGLLDQEIKDGVHALSLKTKTP 88


>gi|209883231|ref|YP_002287088.1| BolA family protein [Oligotropha carboxidovorans OM5]
 gi|209871427|gb|ACI91223.1| BolA family protein [Oligotropha carboxidovorans OM5]
          Length = 88

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G   H+   I++  F GK+RI++H+MV   L       LHAL++K   P
Sbjct: 38 GGETHFRIHIVARAFEGKSRIERHRMVNALLAESFAGGLHALALKAQAP 86


>gi|307206133|gb|EFN84213.1| Protein bolA-like protein [Harpegnathos saltator]
          Length = 112

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G  +H+   ++SE+F  +  I++HQM+YD L  ++   +HALSI    P+
Sbjct: 42 GSESHFKVVVVSEKFDKQPLIKRHQMIYDLLQTELEEDIHALSIVAKTPE 91


>gi|255629267|gb|ACU14978.1| unknown [Glycine max]
          Length = 157

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 8   IEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALH 67
           ++  IK+ +    V++ D  GDG H + ++++  F G++ + + +MVY ++  ++   +H
Sbjct: 82  MQNKIKEQLNAESVSVKDAYGDGRHVSIDVVATAFEGQSAVNRQRMVYKAIWEELQTVVH 141

Query: 68  ALS-IKTSVP 76
           A+  + TS P
Sbjct: 142 AVDQMTTSTP 151


>gi|284008696|emb|CBA75360.1| morphoprotein [Arsenophonus nasoniae]
          Length = 96

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVP 76
          GDG+H+    + E F G +RI+Q Q++Y  L   +  N +HALSIK   P
Sbjct: 35 GDGSHFQIIAVGEMFNGMSRIKQQQVIYAPLMEYIADNRIHALSIKAYTP 84


>gi|241763912|ref|ZP_04761955.1| BolA family protein [Acidovorax delafieldii 2AN]
 gi|241366807|gb|EER61239.1| BolA family protein [Acidovorax delafieldii 2AN]
          Length = 91

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (60%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G G H+   I S  F GK R+ QH++VYD+L   +   +HA++I+ 
Sbjct: 45 GYGTHFRVRIASPLFAGKGRVAQHRLVYDALQEFIDQGVHAIAIEV 90


>gi|307129925|ref|YP_003881941.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Dickeya dadantii 3937]
 gi|306527454|gb|ADM97384.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Dickeya dadantii 3937]
          Length = 104

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 31/50 (62%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          AG  +H+   ++SE F G+  I +H+ +Y  L +++  A+HAL++ T  P
Sbjct: 32 AGSESHFKVVLVSECFTGERVIGRHRAIYRVLADELAGAVHALALHTYTP 81


>gi|126305563|ref|XP_001375418.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 118

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 43/71 (60%), Gaps = 3/71 (4%)

Query: 8   IEKMIKKGIPQSI-VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
           + +++++  P++  + + D++G  G  Y   I SEEF+ K  +QQHQMV  +L  ++   
Sbjct: 47  VTQVLQEKFPRAAAIRVTDISGGCGAMYEIHIESEEFKDKRTVQQHQMVNQALKEEI-KG 105

Query: 66  LHALSIKTSVP 76
           +H L I TS+P
Sbjct: 106 MHGLRIFTSIP 116


>gi|327480302|gb|AEA83612.1| transcriptional regulator BolA [Pseudomonas stutzeri DSM 4166]
          Length = 98

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   HY A I+SE+F G N +++HQ  Y ++G  M   +HAL++ T  P+
Sbjct: 31 GLETHYKAVIVSEQFAGLNSVKRHQKAYAAMGPLM-QQIHALALHTYTPE 79


>gi|126175852|ref|YP_001052001.1| BolA family protein [Shewanella baltica OS155]
 gi|304411200|ref|ZP_07392815.1| BolA family protein [Shewanella baltica OS183]
 gi|307306495|ref|ZP_07586238.1| BolA family protein [Shewanella baltica BA175]
 gi|125999057|gb|ABN63132.1| BolA family protein [Shewanella baltica OS155]
 gi|304350393|gb|EFM14796.1| BolA family protein [Shewanella baltica OS183]
 gi|306910786|gb|EFN41214.1| BolA family protein [Shewanella baltica BA175]
          Length = 85

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA-LHALSIKTSVP 76
          + DG+HY    + E F G +R++Q Q +Y  L   + +  LHAL+IKT  P
Sbjct: 22 SSDGSHYKVIAVGECFDGMSRVKQQQAIYAPLAAHIASGELHALTIKTFTP 72


>gi|300724960|ref|YP_003714285.1| putative BolA family transcriptional regulator [Xenorhabdus
          nematophila ATCC 19061]
 gi|297631502|emb|CBJ92209.1| putative transcriptional regulator (BolA family) [Xenorhabdus
          nematophila ATCC 19061]
          Length = 84

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+  EI+K++ + +    V +   +GDG+H+    + + F G +R++Q Q +Y  L   +
Sbjct: 1  MDTDEIKKVLMERLVLDDVIV---SGDGSHFQVIAVGDIFDGLSRVKQQQTIYAPLMEYI 57

Query: 63 G-NALHALSIKTSVP 76
            N +HALSIK   P
Sbjct: 58 ADNRIHALSIKAYTP 72


>gi|283788171|ref|YP_003368036.1| hypothetical protein ROD_46301 [Citrobacter rodentium ICC168]
 gi|282951625|emb|CBG91325.1| conserved hypothetical protein [Citrobacter rodentium ICC168]
          Length = 105

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 44/75 (58%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M  +EI++++   +  S+  +H ++GDG+H+    + E F G +R+++ Q +Y  L   +
Sbjct: 22 MENNEIQRVLMNAL--SLQEVH-VSGDGSHFQVIAVGEMFDGMSRVKKQQTIYAPLMEYI 78

Query: 63 G-NALHALSIKTSVP 76
            N +HALSIK   P
Sbjct: 79 ADNRIHALSIKAYTP 93


>gi|319793856|ref|YP_004155496.1| bola family protein [Variovorax paradoxus EPS]
 gi|315596319|gb|ADU37385.1| BolA family protein [Variovorax paradoxus EPS]
          Length = 92

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (60%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G G H+   I S  F GK R+ +H++VYD+L   +   LHA++I+ 
Sbjct: 46 GYGTHFRVRIASPLFEGKPRVARHRLVYDALQVFIAQGLHAIAIEV 91


>gi|42562768|ref|NP_564702.2| BolA-like family protein [Arabidopsis thaliana]
 gi|51968914|dbj|BAD43149.1| BolA like protein [Arabidopsis thaliana]
 gi|332195178|gb|AEE33299.1| BolA-like-like protein [Arabidopsis thaliana]
          Length = 160

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 30/48 (62%)

Query: 29  DGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           D  H+  +I+S+ F G N +++H++VY  L  ++   LHALSI +  P
Sbjct: 106 DETHFNVKIVSKGFEGMNLVKRHRLVYHLLREELDTGLHALSIVSKTP 153


>gi|307102595|gb|EFN50866.1| hypothetical protein CHLNCDRAFT_141798 [Chlorella variabilis]
          Length = 96

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          ++E+ ++  +    + + +LAG G  +A  I+SE F GK  +++H++V  +L   M + +
Sbjct: 6  DVEERLRTELDVQDLKVQELAGCGTSFALYIVSESFAGKRLLERHKLVNLALAPLMPH-I 64

Query: 67 HALSIKTS 74
          HALSIK +
Sbjct: 65 HALSIKKA 72


>gi|159163196|pdb|1V60|A Chain A, Solution Structure Of Bola1 Protein From Mus Musculus
          Length = 123

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 31/50 (62%)

Query: 27  AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           AG   H+   ++S  F G + +Q+H++V+++L  ++   +HAL+I+   P
Sbjct: 57  AGSETHFRVAVVSSRFEGMSPLQRHRLVHEALSEELAGPVHALAIQAKTP 106


>gi|24372683|ref|NP_716725.1| bolA protein [Shewanella oneidensis MR-1]
 gi|24346735|gb|AAN54170.1|AE015554_5 bolA protein [Shewanella oneidensis MR-1]
          Length = 97

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 28/42 (66%)

Query: 32 HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          H+   +IS+EF G   + +H++V + L N++ N +HALSI T
Sbjct: 36 HFKVVVISDEFEGLRLLARHRLVNNCLANELANGVHALSIHT 77


>gi|24375436|ref|NP_719479.1| BolA/YrbA family protein [Shewanella oneidensis MR-1]
 gi|24350280|gb|AAN56923.1|AE015826_8 BolA/YrbA family protein [Shewanella oneidensis MR-1]
          Length = 83

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA-LHALSIKTSVP 76
          + DG+HY    + E F G +R++Q Q +Y  L + + +  LHAL+IKT  P
Sbjct: 22 SSDGSHYKVIAVGECFDGMSRVKQQQTIYAPLMSYIASGELHALTIKTFTP 72


>gi|51969538|dbj|BAD43461.1| BolA like protein [Arabidopsis thaliana]
          Length = 159

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 30/48 (62%)

Query: 29  DGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           D  H+  +I+S+ F G N +++H++VY  L  ++   LHALSI +  P
Sbjct: 105 DETHFNVKIVSKGFEGMNLVKRHRLVYHLLREELDTGLHALSIVSKTP 152


>gi|261344892|ref|ZP_05972536.1| BolA/YrbA family protein [Providencia rustigianii DSM 4541]
 gi|282567032|gb|EFB72567.1| BolA/YrbA family protein [Providencia rustigianii DSM 4541]
          Length = 84

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 8/77 (10%)

Query: 3  MNPHEIEKMI--KKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M  +EI++++  K  + ++IVT     GDG+H+    +   F G +R++Q Q +Y  L  
Sbjct: 1  METNEIKQVLMEKLSLDEAIVT-----GDGSHFQVIAVGSLFDGMSRVKQQQAIYAPLME 55

Query: 61 KMG-NALHALSIKTSVP 76
           +  N +HALSIK   P
Sbjct: 56 YIADNRIHALSIKAYTP 72


>gi|152988778|ref|YP_001350006.1| morphogene protein BolA [Pseudomonas aeruginosa PA7]
 gi|150963936|gb|ABR85961.1| morphogene protein BolA [Pseudomonas aeruginosa PA7]
          Length = 101

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 6/62 (9%)

Query: 21 VTIHDLA-----GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSV 75
          V +HD +     G   H+   ++S +F G N +++HQ VY +LG  MG   HAL++ T  
Sbjct: 19 VEVHDESHMHSRGLETHFKVVLVSPQFAGLNSVKRHQKVYATLGGLMGE-FHALALHTYT 77

Query: 76 PD 77
          P+
Sbjct: 78 PE 79


>gi|75674598|ref|YP_317019.1| BolA-like protein [Nitrobacter winogradskyi Nb-255]
 gi|74419468|gb|ABA03667.1| transcriptional regulator, BolA protein family [Nitrobacter
          winogradskyi Nb-255]
          Length = 91

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 31/52 (59%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
          G   H+   I+S+ F GK+R+++H+M+   L  ++   +HAL+I+   P  Q
Sbjct: 38 GGETHFRIHIVSQAFEGKSRVERHRMINTLLAAELDGPIHALAIRAMAPGEQ 89


>gi|322834657|ref|YP_004214684.1| BolA family protein [Rahnella sp. Y9602]
 gi|321169858|gb|ADW75557.1| BolA family protein [Rahnella sp. Y9602]
          Length = 84

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVPD 77
          + GDG+H+ A ++   F G +R+++ Q VY  L   +  N +HALSIK   P+
Sbjct: 21 ITGDGSHFQAIVVGAMFDGMSRVKKQQTVYAPLMEYIADNRIHALSIKAYTPE 73


>gi|300681474|emb|CBH32568.1| BolA-like protein domain containing protein,expressed [Triticum
          aestivum]
          Length = 97

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 17 PQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          P  +V      G G  Y  E++S++F GK  +++H+MV  +L   M   +HA+SIK   P
Sbjct: 18 PTHLVVTDTSGGCGASYEIEVVSDKFEGKRLLERHRMVNTALAPLMAE-IHAVSIKALTP 76


>gi|14488092|gb|AAK63866.1|AF389294_1 AT1g55800/F14J16_13 [Arabidopsis thaliana]
 gi|23505763|gb|AAN28741.1| At1g55800/F14J16_13 [Arabidopsis thaliana]
 gi|62318906|dbj|BAD93986.1| BolA like protein [Arabidopsis thaliana]
          Length = 109

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 30/48 (62%)

Query: 29  DGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           D  H+  +I+S+ F G N +++H++VY  L  ++   LHALSI +  P
Sbjct: 55  DETHFNVKIVSKGFEGMNLVKRHRLVYHLLREELDTGLHALSIVSKTP 102


>gi|296104903|ref|YP_003615049.1| BolA family transcriptional regulator [Enterobacter cloacae
          subsp. cloacae ATCC 13047]
 gi|295059362|gb|ADF64100.1| BolA family transcriptional regulator [Enterobacter cloacae
          subsp. cloacae ATCC 13047]
          Length = 84

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 41/75 (54%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M  HEI+ ++   +  S+   H + GDG+H+    + E F G +R+++ Q VY  L   +
Sbjct: 1  MENHEIQTVLMNAL--SLQEAH-VTGDGSHFQVIAVGEMFDGMSRVKKQQAVYAPLMEYI 57

Query: 63 G-NALHALSIKTSVP 76
            N +HALSIK   P
Sbjct: 58 ADNRIHALSIKAFTP 72


>gi|288936836|ref|YP_003440895.1| BolA family protein [Klebsiella variicola At-22]
 gi|288891545|gb|ADC59863.1| BolA family protein [Klebsiella variicola At-22]
          Length = 104

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 31/47 (65%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+M+Y +L  ++ N +HAL++ T
Sbjct: 32 AGSESHFKVVLVSDRFTGERFLNRHRMIYGTLTEELSNTVHALALHT 78


>gi|51969256|dbj|BAD43320.1| BolA like protein [Arabidopsis thaliana]
          Length = 146

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 30/48 (62%)

Query: 29  DGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           D  H+  +I+S+ F G N +++H++VY  L  ++   LHALSI +  P
Sbjct: 92  DETHFNVKIVSKGFEGMNLVKRHRLVYHLLREELDTGLHALSIVSKTP 139


>gi|225431597|ref|XP_002282729.1| PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
          Length = 125

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
           G G  +A EI+SE+F GK  +++H+MV  +L  ++   +HALSIK ++   Q
Sbjct: 61  GCGASFAIEIVSEQFEGKRLLERHRMVNAALQEELKQ-IHALSIKKALTPEQ 111


>gi|152968970|ref|YP_001334079.1| transcriptional regulator BolA [Klebsiella pneumoniae subsp.
          pneumoniae MGH 78578]
 gi|206580724|ref|YP_002240085.1| protein BolA [Klebsiella pneumoniae 342]
 gi|262042471|ref|ZP_06015630.1| regulator of penicillin binding proteins and beta lactamase
          transcription [Klebsiella pneumoniae subsp.
          rhinoscleromatis ATCC 13884]
 gi|290510108|ref|ZP_06549478.1| BolA protein [Klebsiella sp. 1_1_55]
 gi|330011531|ref|ZP_08307117.1| protein BolA [Klebsiella sp. MS 92-3]
 gi|150953819|gb|ABR75849.1| possible regulator of murein genes [Klebsiella pneumoniae subsp.
          pneumoniae MGH 78578]
 gi|206569782|gb|ACI11558.1| protein BolA [Klebsiella pneumoniae 342]
 gi|259040175|gb|EEW41287.1| regulator of penicillin binding proteins and beta lactamase
          transcription [Klebsiella pneumoniae subsp.
          rhinoscleromatis ATCC 13884]
 gi|289776824|gb|EFD84822.1| BolA protein [Klebsiella sp. 1_1_55]
 gi|328534148|gb|EGF60783.1| protein BolA [Klebsiella sp. MS 92-3]
          Length = 105

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 31/47 (65%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+M+Y +L  ++ N +HAL++ T
Sbjct: 33 AGSESHFKVVLVSDRFTGERFLNRHRMIYGTLTEELSNTVHALALHT 79


>gi|32394618|gb|AAM94007.1| BolA [Griffithsia japonica]
          Length = 129

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA-LHALSIKTSVP 76
           GD +H+A  ++SE F G + +Q+H+++Y  L  +M +  +HAL I+   P
Sbjct: 77  GDESHFAVSVVSEAFEGLSIVQRHRVIYTLLNEEMSSGHIHALQIEAKTP 126


>gi|329297307|ref|ZP_08254643.1| BolA family protein [Plautia stali symbiont]
          Length = 85

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 42/75 (56%), Gaps = 3/75 (4%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   E++ ++ + +P  +  +H L+ DG+H+    + E F   +R+++ Q VY  L   +
Sbjct: 1  MENSEVQAVLMQALP--LEEVHVLSNDGSHFQVIAVGEMFGELSRVKKQQAVYAPLMEYI 58

Query: 63 G-NALHALSIKTSVP 76
            N +HA+SIKT  P
Sbjct: 59 ADNRIHAVSIKTYTP 73


>gi|7705638|ref|NP_057158.1| bolA-like protein 1 [Homo sapiens]
 gi|8134821|sp|Q9Y3E2|BOLA1_HUMAN RecName: Full=BolA-like protein 1; AltName: Full=hBolA
 gi|4929755|gb|AAD34138.1|AF151901_1 CGI-143 protein [Homo sapiens]
 gi|39645419|gb|AAH63405.1| BolA homolog 1 (E. coli) [Homo sapiens]
 gi|55960994|emb|CAI12571.1| bolA homolog 1 (E. coli) [Homo sapiens]
 gi|119573984|gb|EAW53599.1| bolA-like 1 (E. coli), isoform CRA_a [Homo sapiens]
 gi|119573985|gb|EAW53600.1| bolA-like 1 (E. coli), isoform CRA_a [Homo sapiens]
 gi|119573986|gb|EAW53601.1| bolA-like 1 (E. coli), isoform CRA_a [Homo sapiens]
 gi|119573987|gb|EAW53602.1| bolA-like 1 (E. coli), isoform CRA_a [Homo sapiens]
 gi|189053597|dbj|BAG35849.1| unnamed protein product [Homo sapiens]
 gi|312153196|gb|ADQ33110.1| bolA homolog 1 (E. coli) [synthetic construct]
          Length = 137

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 30/49 (61%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           G   H+   ++S  F G + +Q+H++V+ +L  ++G  +HAL+I+   P
Sbjct: 63  GSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTP 111


>gi|256821880|ref|YP_003145843.1| BolA family protein [Kangiella koreensis DSM 16069]
 gi|256795419|gb|ACV26075.1| BolA family protein [Kangiella koreensis DSM 16069]
          Length = 81

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 32/51 (62%), Gaps = 1/51 (1%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA-LHALSIKTSVPD 77
          GDG+H+   I+S+ F G   +++ QMVY ++   + +  +HAL+IK   P+
Sbjct: 22 GDGSHFQVIIVSKAFEGLRSVKKQQMVYATVNEHIASGDIHALTIKAYTPE 72


>gi|113205758|ref|NP_001037940.1| bolA homolog 3 [Xenopus (Silurana) tropicalis]
 gi|89266975|emb|CAJ82173.1| novel protein [Xenopus (Silurana) tropicalis]
          Length = 104

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 44/73 (60%), Gaps = 3/73 (4%)

Query: 6   HEIEKMIKKGIP-QSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG 63
           ++I +++K   P  S V + D++G  G  Y   I SEEF+ K  +QQH+MV ++L  ++ 
Sbjct: 31  YKITQVLKAKFPLASHVRVVDISGGCGAMYEIHIESEEFKDKRTVQQHKMVNEALQEEI- 89

Query: 64  NALHALSIKTSVP 76
            A+H L I T+ P
Sbjct: 90  KAMHGLRIFTTAP 102


>gi|285018097|ref|YP_003375808.1| hypothetical protein XALc_1313 [Xanthomonas albilineans GPE PC73]
 gi|283473315|emb|CBA15820.1| conserved hypothetical protein [Xanthomonas albilineans]
          Length = 94

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 24 HDLAGDG-NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDS 78
          H  A DG  H+   ++S  F G   + +H+ VY +LG+ M   +HALSI+  VP +
Sbjct: 37 HAGARDGRGHFNVRVVSAAFAGMGPLARHRAVYAALGDMMQTDIHALSIRAEVPGA 92


>gi|255569025|ref|XP_002525482.1| UV-induced protein uvi31, putative [Ricinus communis]
 gi|223535219|gb|EEF36897.1| UV-induced protein uvi31, putative [Ricinus communis]
          Length = 111

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 31/49 (63%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
           H+  +I+S +F  +  +++H+MVYD+L +++   LHALSI    P  +
Sbjct: 51 THFNLKIVSPKFHQQTLVKRHRMVYDALADELRCGLHALSIVAKTPREE 99


>gi|42522849|ref|NP_968229.1| BolA-like protein [Bdellovibrio bacteriovorus HD100]
 gi|39574045|emb|CAE79222.1| BolA-like protein [Bdellovibrio bacteriovorus HD100]
          Length = 110

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          A    H+   ++SE F GK+RI + +MV D L +++ + LHAL+ K   P
Sbjct: 34 ANSETHFKVLVVSEAFEGKSRIDRQRMVNDLLKSELQSGLHALTQKALTP 83


>gi|313105734|ref|ZP_07791997.1| morphogene protein BolA [Pseudomonas aeruginosa 39016]
 gi|310878499|gb|EFQ37093.1| morphogene protein BolA [Pseudomonas aeruginosa 39016]
          Length = 101

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   H+   ++S +F G N +++HQ VY +LG  MG   HAL++ T  P+
Sbjct: 31 GLETHFKVVLVSPQFAGLNAVRRHQKVYATLGGLMGE-FHALALHTFTPE 79


>gi|170744531|ref|YP_001773186.1| BolA family protein [Methylobacterium sp. 4-46]
 gi|168198805|gb|ACA20752.1| BolA family protein [Methylobacterium sp. 4-46]
          Length = 96

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 29/49 (59%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G   H+  +++S+ F GK+R+++H+MV   L       LHAL+++   P
Sbjct: 38 GGETHFRLDVVSQAFEGKSRVERHRMVNALLDEAFRRGLHALALRARTP 86


>gi|113969028|ref|YP_732821.1| BolA family protein [Shewanella sp. MR-4]
 gi|114048827|ref|YP_739377.1| BolA family protein [Shewanella sp. MR-7]
 gi|117919135|ref|YP_868327.1| BolA family protein [Shewanella sp. ANA-3]
 gi|113883712|gb|ABI37764.1| BolA family protein [Shewanella sp. MR-4]
 gi|113890269|gb|ABI44320.1| BolA family protein [Shewanella sp. MR-7]
 gi|117611467|gb|ABK46921.1| BolA family protein [Shewanella sp. ANA-3]
          Length = 83

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA-LHALSIKTSVP 76
          + DG+HY    + E F G +R++Q Q +Y  L + + +  LHAL+IKT  P
Sbjct: 22 SSDGSHYKVIAVGECFDGMSRVKQQQAIYAPLMSYIASGELHALTIKTFTP 72


>gi|312881886|ref|ZP_07741653.1| protein yrbA [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309370465|gb|EFP97950.1| protein yrbA [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 84

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+  E+++++ + +   +  +H + G+G+HY    +   F G NR+++ Q++Y  L   +
Sbjct: 1  MDSTEVQQILSQAL--ELEELH-VKGEGSHYEVIAVDVRFEGMNRVKKQQLIYAPLMEYI 57

Query: 63 -GNALHALSIKTSVPD 77
            N +HA+SIK   PD
Sbjct: 58 QRNDIHAVSIKAYTPD 73


>gi|146417069|ref|XP_001484504.1| hypothetical protein PGUG_03885 [Meyerozyma guilliermondii ATCC
          6260]
 gi|146391629|gb|EDK39787.1| hypothetical protein PGUG_03885 [Meyerozyma guilliermondii ATCC
          6260]
          Length = 85

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 46/78 (58%), Gaps = 2/78 (2%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          MS+    ++ +I+  +  ++V + D++G  G  +A  I+S  F GKN++ +H++V  +L 
Sbjct: 1  MSLTADTLKSLIEDKLEATLVQVEDMSGGCGQAFAVIIVSPLFVGKNKLARHRLVNSALK 60

Query: 60 NKMGNALHALSIKTSVPD 77
           ++ + +HA + K   P+
Sbjct: 61 EEIAS-IHAFTQKGFTPE 77


>gi|15596054|ref|NP_249548.1| morphogene protein BolA [Pseudomonas aeruginosa PAO1]
 gi|107100314|ref|ZP_01364232.1| hypothetical protein PaerPA_01001339 [Pseudomonas aeruginosa
          PACS2]
 gi|218893176|ref|YP_002442045.1| morphogene protein BolA [Pseudomonas aeruginosa LESB58]
 gi|254239209|ref|ZP_04932532.1| morphogene protein BolA [Pseudomonas aeruginosa C3719]
 gi|254245143|ref|ZP_04938465.1| morphogene protein BolA [Pseudomonas aeruginosa 2192]
 gi|9946754|gb|AAG04246.1|AE004520_9 morphogene protein BolA [Pseudomonas aeruginosa PAO1]
 gi|126171140|gb|EAZ56651.1| morphogene protein BolA [Pseudomonas aeruginosa C3719]
 gi|126198521|gb|EAZ62584.1| morphogene protein BolA [Pseudomonas aeruginosa 2192]
 gi|218773404|emb|CAW29216.1| morphogene protein BolA [Pseudomonas aeruginosa LESB58]
          Length = 101

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   H+   ++S +F G N +++HQ VY +LG  MG   HAL++ T  P+
Sbjct: 31 GLETHFKVVLVSPQFAGLNAVKRHQKVYATLGGLMGE-FHALALHTFTPE 79


>gi|319425066|gb|ADV53140.1| BolA family protein [Shewanella putrefaciens 200]
          Length = 85

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA-LHALSIKTSVP 76
          + DG+HY    + E F G +R++Q Q +Y  L   + +  LHAL+IKT  P
Sbjct: 22 SSDGSHYKVIAVGECFDGMSRVKQQQTIYAPLTAHIASGELHALTIKTFTP 72


>gi|68467345|ref|XP_722334.1| hypothetical protein CaO19.12483 [Candida albicans SC5314]
 gi|68467574|ref|XP_722220.1| hypothetical protein CaO19.5016 [Candida albicans SC5314]
 gi|46444176|gb|EAL03453.1| hypothetical protein CaO19.5016 [Candida albicans SC5314]
 gi|46444301|gb|EAL03577.1| hypothetical protein CaO19.12483 [Candida albicans SC5314]
          Length = 121

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-ALHALSIKTSVPD 77
           +H+  EI+S+ F GK+   +H++VY  L N++ N  +HAL +KT  P+
Sbjct: 67  SHFRLEIVSDVFEGKSLSARHRLVYSLLANELKNDGVHALQMKTKTPE 114


>gi|238878248|gb|EEQ41886.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 121

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-ALHALSIKTSVPD 77
           +H+  EI+S+ F GK+   +H++VY  L N++ N  +HAL +KT  P+
Sbjct: 67  SHFRLEIVSDVFEGKSLPARHRLVYSLLANELKNDGVHALQMKTKTPE 114


>gi|116048780|ref|YP_792420.1| morphogene protein BolA [Pseudomonas aeruginosa UCBPP-PA14]
 gi|296390790|ref|ZP_06880265.1| morphogene protein BolA [Pseudomonas aeruginosa PAb1]
 gi|115584001|gb|ABJ10016.1| morphogene protein BolA [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 101

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   H+   ++S +F G N +++HQ VY +LG  MG   HAL++ T  P+
Sbjct: 31 GLETHFKVVLVSPQFAGLNAVKRHQKVYATLGGLMGE-FHALALHTFTPE 79


>gi|49075120|gb|AAT49449.1| PA0857 [synthetic construct]
          Length = 102

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   H+   ++S +F G N +++HQ VY +LG  MG   HAL++ T  P+
Sbjct: 31 GLETHFKVVLVSPQFAGLNAVKRHQKVYATLGGLMGE-FHALALHTFTPE 79


>gi|115441257|ref|NP_001044908.1| Os01g0866600 [Oryza sativa Japonica Group]
 gi|56785200|dbj|BAD81918.1| BolA-like protein [Oryza sativa Japonica Group]
 gi|113534439|dbj|BAF06822.1| Os01g0866600 [Oryza sativa Japonica Group]
 gi|125528496|gb|EAY76610.1| hypothetical protein OsI_04560 [Oryza sativa Indica Group]
 gi|125572760|gb|EAZ14275.1| hypothetical protein OsJ_04200 [Oryza sativa Japonica Group]
          Length = 94

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 33/52 (63%), Gaps = 1/52 (1%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
          G G  Y  E++SE+F GK  +++H+MV  +L   M   +HA+SIK ++  +Q
Sbjct: 29 GCGASYEIEVVSEKFEGKRLLERHRMVNTALAPHMAE-IHAVSIKKALTPAQ 79


>gi|325117736|emb|CBZ53287.1| putative BolA-like domain containing protein [Neospora caninum
          Liverpool]
          Length = 89

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDL-AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          +E  +++ +  +++ + D   G G  +   I+SE F GK  +Q+H+MV ++L +++ + +
Sbjct: 12 VEAKLQQALSPALLKLEDKSCGCGAAFDCVIVSEAFDGKKLLQRHRMVNEALKDELPS-I 70

Query: 67 HALSIKTSVPD 77
          HA SI+   P+
Sbjct: 71 HAFSIQCHTPE 81


>gi|300024673|ref|YP_003757284.1| BolA family protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526494|gb|ADJ24963.1| BolA family protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 100

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 31/46 (67%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          +H+   +IS  F GK+R+++H++V D L N++   +HAL++ T  P
Sbjct: 43 SHFRILVISGAFAGKSRVERHRIVNDLLKNEISGGIHALALATLAP 88


>gi|170727955|ref|YP_001761981.1| BolA family protein [Shewanella woodyi ATCC 51908]
 gi|169813302|gb|ACA87886.1| BolA family protein [Shewanella woodyi ATCC 51908]
          Length = 99

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           H+   I SE F GK  + +H+ V ++L  +  N LHALS+ T  PD
Sbjct: 37 THFKVIITSEFFEGKRLLARHRAVNEALATEFANGLHALSMHTYSPD 83


>gi|294788197|ref|ZP_06753440.1| BolA protein [Simonsiella muelleri ATCC 29453]
 gi|294483628|gb|EFG31312.1| BolA protein [Simonsiella muelleri ATCC 29453]
          Length = 88

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-ALHALSIKTSVPD 77
          G HYA  ++SE+F G +R+Q+ ++V D L +   +  +HALSI    PD
Sbjct: 36 GGHYAILLVSEQFVGVSRLQRQRVVQDLLADLFADKKIHALSIVAKTPD 84


>gi|218549897|ref|YP_002383688.1| transcriptional regulator BolA [Escherichia fergusonii ATCC
          35469]
 gi|218357438|emb|CAQ90077.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Escherichia fergusonii ATCC
          35469]
 gi|324114662|gb|EGC08630.1| BolA protein [Escherichia fergusonii B253]
 gi|325498274|gb|EGC96133.1| transcriptional regulator BolA [Escherichia fergusonii ECD227]
          Length = 105

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+M+Y +L  ++   +HAL++ T
Sbjct: 33 AGSESHFKVVLVSDRFTGERFLNRHRMIYSTLAEELSTTVHALALHT 79


>gi|326403905|ref|YP_004283987.1| hypothetical protein ACMV_17580 [Acidiphilium multivorum AIU301]
 gi|325050767|dbj|BAJ81105.1| hypothetical protein ACMV_17580 [Acidiphilium multivorum AIU301]
          Length = 97

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           HY  ++++E FRG NR+ + + V ++L  +    LHALS+    PD
Sbjct: 49 THYRLKMVAEAFRGMNRVARQRAVNEALKAEFETGLHALSLDLKTPD 95


>gi|320173746|gb|EFW48929.1| Cell division protein BolA [Shigella dysenteriae CDC 74-1112]
          Length = 105

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+M+Y +L  ++   +HAL++ T
Sbjct: 33 AGSESHFKVVLVSDRFTGERFLNRHRMIYSTLAEELSTTVHALALHT 79


>gi|291086509|ref|ZP_06356004.2| BolA/YrbA family protein [Citrobacter youngae ATCC 29220]
 gi|291067627|gb|EFE05736.1| BolA/YrbA family protein [Citrobacter youngae ATCC 29220]
          Length = 97

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M  +EI+ ++   +  S+  +H ++GDG+H+    + E F G +R+++ Q VY  L   +
Sbjct: 14 MENNEIQSVLMNAL--SLQEVH-VSGDGSHFQVIAVGEMFEGMSRVKKQQSVYGPLMEYI 70

Query: 63 G-NALHALSIKTSVP 76
            N +HALSIK   P
Sbjct: 71 ADNRIHALSIKAFTP 85


>gi|18416103|ref|NP_568217.1| BolA-like family protein [Arabidopsis thaliana]
 gi|9758961|dbj|BAB09404.1| unnamed protein product [Arabidopsis thaliana]
 gi|21593245|gb|AAM65194.1| unknown [Arabidopsis thaliana]
 gi|27808606|gb|AAO24583.1| At5g09830 [Arabidopsis thaliana]
 gi|110736310|dbj|BAF00125.1| hypothetical protein [Arabidopsis thaliana]
 gi|332004070|gb|AED91453.1| BolA-like family protein [Arabidopsis thaliana]
          Length = 93

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 31/45 (68%), Gaps = 1/45 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIK 72
          G G+ +  E++SE+F GK  +++H+MV  +L  +M   +HALSIK
Sbjct: 28 GCGSSFEVEVVSEQFEGKRLLERHRMVNAALEEEM-KEIHALSIK 71


>gi|307544524|ref|YP_003897003.1| hypothetical protein HELO_1934 [Halomonas elongata DSM 2581]
 gi|307216548|emb|CBV41818.1| hypothetical protein HELO_1934 [Halomonas elongata DSM 2581]
          Length = 84

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+P E++ +++  +      I    G+G  +    + E F G +R+++ Q++Y +L  ++
Sbjct: 1  MHPSEVKALLESRLDDCEFHIQ---GEGCDFQVVAVGEVFEGLSRVKRQQLIYGALSEEI 57

Query: 63 GN-ALHALSIKTSVP 76
           + ALHA++I+T  P
Sbjct: 58 ASGALHAVTIRTYTP 72


>gi|120600239|ref|YP_964813.1| BolA family protein [Shewanella sp. W3-18-1]
 gi|146291831|ref|YP_001182255.1| BolA family protein [Shewanella putrefaciens CN-32]
 gi|152999236|ref|YP_001364917.1| BolA family protein [Shewanella baltica OS185]
 gi|160873849|ref|YP_001553165.1| BolA family protein [Shewanella baltica OS195]
 gi|217971909|ref|YP_002356660.1| BolA family protein [Shewanella baltica OS223]
 gi|120560332|gb|ABM26259.1| BolA family protein [Shewanella sp. W3-18-1]
 gi|145563521|gb|ABP74456.1| BolA family protein [Shewanella putrefaciens CN-32]
 gi|151363854|gb|ABS06854.1| BolA family protein [Shewanella baltica OS185]
 gi|160859371|gb|ABX47905.1| BolA family protein [Shewanella baltica OS195]
 gi|217497044|gb|ACK45237.1| BolA family protein [Shewanella baltica OS223]
 gi|315266076|gb|ADT92929.1| BolA family protein [Shewanella baltica OS678]
          Length = 85

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA-LHALSIKTSVP 76
          + DG+HY    + E F G +R++Q Q +Y  L   + +  LHAL+IKT  P
Sbjct: 22 SSDGSHYKVIAVGECFDGMSRVKQQQAIYAPLTAHIASGELHALTIKTFTP 72


>gi|119477361|ref|ZP_01617552.1| predicted transcriptional regulator, BolA superfamily protein
          [marine gamma proteobacterium HTCC2143]
 gi|119449287|gb|EAW30526.1| predicted transcriptional regulator, BolA superfamily protein
          [marine gamma proteobacterium HTCC2143]
          Length = 78

 Score = 42.4 bits (98), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 45/72 (62%), Gaps = 4/72 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P +++K+++  +P   +   ++AG+G+H    ++ + F G N +++ Q+VY  L   +
Sbjct: 1  MQPDQVKKILQLQLPDCDI---EVAGEGSHIDVTVVGDVFEGLNAVKKQQLVYAGLNPLI 57

Query: 63 GN-ALHALSIKT 73
           + ++HA+++KT
Sbjct: 58 ADGSIHAVNMKT 69


>gi|170767812|ref|ZP_02902265.1| protein BolA [Escherichia albertii TW07627]
 gi|170123300|gb|EDS92231.1| protein BolA [Escherichia albertii TW07627]
          Length = 105

 Score = 42.4 bits (98), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+M+Y +L  ++   +HAL++ T
Sbjct: 33 AGSESHFKVVLVSDRFTGERFLNRHRMIYSTLAEELSTTVHALALHT 79


>gi|168026201|ref|XP_001765621.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162683259|gb|EDQ69671.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 267

 Score = 42.4 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 31/45 (68%)

Query: 32  HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+  ++IS EF+G + +++H+++Y  L  ++ N LHALS+ T  P
Sbjct: 220 HFNVKVISGEFQGLSLVKRHRLIYGLLQEELQNGLHALSLITKTP 264


>gi|255079122|ref|XP_002503141.1| BolA like protein [Micromonas sp. RCC299]
 gi|226518407|gb|ACO64399.1| BolA like protein [Micromonas sp. RCC299]
          Length = 131

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 41/74 (55%), Gaps = 5/74 (6%)

Query: 8   IEKM---IKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-G 63
           IE+M   I+ G+    V + D++GD  H   ++++  F GKN + + +MVY  +  +M  
Sbjct: 52  IEQMKAKIRVGLDAQFVDVVDMSGDARHVGIQVVANAFEGKNPVNRQRMVYKCIWEEMQT 111

Query: 64  NALHAL-SIKTSVP 76
           + +HA+   +T  P
Sbjct: 112 DRVHAVQRCETKTP 125


>gi|116783057|gb|ABK22779.1| unknown [Picea sitchensis]
 gi|116790177|gb|ABK25529.1| unknown [Picea sitchensis]
          Length = 93

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 17 PQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          P  +  I    G G  ++ E++S +F GK  +++H+MV  +L  ++   +HALSIK +V 
Sbjct: 18 PTYLNVIDTSGGCGASFSIEVVSAQFEGKKLLERHRMVNSALAEEL-KEIHALSIKKAVT 76

Query: 77 DSQ 79
            Q
Sbjct: 77 PQQ 79


>gi|209551169|ref|YP_002283086.1| BolA family protein [Rhizobium leguminosarum bv. trifolii
          WSM2304]
 gi|209536925|gb|ACI56860.1| BolA family protein [Rhizobium leguminosarum bv. trifolii
          WSM2304]
          Length = 93

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 41/80 (51%), Gaps = 11/80 (13%)

Query: 9  EKMIKKGIPQSIVTIH----------DLAGDG-NHYAAEIISEEFRGKNRIQQHQMVYDS 57
          EK+++   P+ +  +           D+ G G  H    I+S +F G +R+ +H+ + D 
Sbjct: 9  EKLVEAFAPERLSVVDESHLHAGHQPDITGTGETHMRVRIVSAKFSGMSRLARHRAITDL 68

Query: 58 LGNKMGNALHALSIKTSVPD 77
          L  ++   LHAL+++ + PD
Sbjct: 69 LKPELDAGLHALAVEPAAPD 88


>gi|114319878|ref|YP_741561.1| transcriptional regulator BolA [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226272|gb|ABI56071.1| transcriptional regulator, BolA protein family [Alkalilimnicola
          ehrlichii MLHE-1]
          Length = 92

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-ALHALSIKTSVPD 77
          Y   ++S +F G N +Q+H+ VY ++G+ M N  +HAL IK   PD
Sbjct: 45 YQVRVVSPDFAGLNTLQRHRKVYGAMGDAMRNDIIHALGIKALTPD 90


>gi|317046708|ref|YP_004114356.1| BolA family protein [Pantoea sp. At-9b]
 gi|316948325|gb|ADU67800.1| BolA family protein [Pantoea sp. At-9b]
          Length = 85

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 42/75 (56%), Gaps = 3/75 (4%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   E++ ++ + +P  +  +H L+ DG+H+    + E F   +R+++ Q VY  L   +
Sbjct: 1  MENSEVQAVLMQALP--LDEVHVLSNDGSHFQVIAVGELFGELSRVKKQQAVYAPLMEYI 58

Query: 63 G-NALHALSIKTSVP 76
            N +HA+SIKT  P
Sbjct: 59 ADNRIHAVSIKTYTP 73


>gi|332140257|ref|YP_004425995.1| BolA-like protein [Alteromonas macleodii str. 'Deep ecotype']
 gi|327550279|gb|AEA96997.1| BolA-like protein [Alteromonas macleodii str. 'Deep ecotype']
          Length = 85

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 49/79 (62%), Gaps = 5/79 (6%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EIEK++K  +   +  +H + G+G+H+    +S+ F   +R+++ Q VY  L +K+
Sbjct: 1  MELSEIEKILKDAL--DLHEVH-VKGEGSHFNIIAVSDAFNEMSRVKRQQAVYAPLADKI 57

Query: 63 GN-ALHALSIKT-SVPDSQ 79
           + ++HA++IKT SV D +
Sbjct: 58 ADGSMHAITIKTFSVKDWE 76


>gi|38703868|ref|NP_308516.2| transcriptional regulator BolA [Escherichia coli O157:H7 str.
          Sakai]
 gi|89107305|ref|AP_001085.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Escherichia coli str. K-12
          substr. W3110]
 gi|90111135|ref|NP_414969.4| stationary-phase morphogene, transcriptional repressor for mreB;
          also regulator for dacA, dacC, and ampC [Escherichia
          coli str. K-12 substr. MG1655]
 gi|110640695|ref|YP_668423.1| transcriptional regulator BolA [Escherichia coli 536]
 gi|157155498|ref|YP_001461621.1| transcriptional regulator BolA [Escherichia coli E24377A]
 gi|157159961|ref|YP_001457279.1| transcriptional regulator BolA [Escherichia coli HS]
 gi|161367637|ref|NP_286177.2| transcriptional regulator BolA [Escherichia coli O157:H7 EDL933]
 gi|161485941|ref|NP_706328.2| transcriptional regulator BolA [Shigella flexneri 2a str. 301]
 gi|161486292|ref|NP_752482.2| transcriptional regulator BolA [Escherichia coli CFT073]
 gi|161486534|ref|NP_836108.2| transcriptional regulator BolA [Shigella flexneri 2a str. 2457T]
 gi|161950162|ref|YP_402006.2| transcriptional regulator BolA [Shigella dysenteriae Sd197]
 gi|161984977|ref|YP_406870.2| transcriptional regulator BolA [Shigella boydii Sb227]
 gi|161986570|ref|YP_309429.2| transcriptional regulator BolA [Shigella sonnei Ss046]
 gi|162138477|ref|YP_539492.2| transcriptional regulator BolA [Escherichia coli UTI89]
 gi|162317585|ref|YP_851608.2| transcriptional regulator BolA [Escherichia coli APEC O1]
 gi|168754538|ref|ZP_02779545.1| protein BolA [Escherichia coli O157:H7 str. EC4401]
 gi|168768388|ref|ZP_02793395.1| protein BolA [Escherichia coli O157:H7 str. EC4486]
 gi|168783303|ref|ZP_02808310.1| protein BolA [Escherichia coli O157:H7 str. EC4076]
 gi|168786284|ref|ZP_02811291.1| protein BolA [Escherichia coli O157:H7 str. EC869]
 gi|170021193|ref|YP_001726147.1| transcriptional regulator BolA [Escherichia coli ATCC 8739]
 gi|170080021|ref|YP_001729341.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Escherichia coli str. K-12
          substr. DH10B]
 gi|170681580|ref|YP_001742578.1| transcriptional regulator BolA [Escherichia coli SMS-3-5]
 gi|187733173|ref|YP_001879145.1| transcriptional regulator BolA [Shigella boydii CDC 3083-94]
 gi|188495085|ref|ZP_03002355.1| protein BolA [Escherichia coli 53638]
 gi|191174688|ref|ZP_03036153.1| protein BolA [Escherichia coli F11]
 gi|194430600|ref|ZP_03063058.1| protein BolA [Escherichia coli B171]
 gi|194432559|ref|ZP_03064845.1| protein BolA [Shigella dysenteriae 1012]
 gi|194440212|ref|ZP_03072248.1| protein BolA [Escherichia coli 101-1]
 gi|195938499|ref|ZP_03083881.1| transcriptional regulator BolA [Escherichia coli O157:H7 str.
          EC4024]
 gi|208808269|ref|ZP_03250606.1| protein BolA [Escherichia coli O157:H7 str. EC4206]
 gi|208814999|ref|ZP_03256178.1| protein BolA [Escherichia coli O157:H7 str. EC4045]
 gi|208822990|ref|ZP_03263308.1| protein BolA [Escherichia coli O157:H7 str. EC4042]
 gi|209395922|ref|YP_002269082.1| protein BolA [Escherichia coli O157:H7 str. EC4115]
 gi|215485516|ref|YP_002327947.1| transcriptional regulator BolA [Escherichia coli O127:H6 str.
          E2348/69]
 gi|217324850|ref|ZP_03440934.1| protein BolA [Escherichia coli O157:H7 str. TW14588]
 gi|218553001|ref|YP_002385914.1| transcriptional regulator BolA [Escherichia coli IAI1]
 gi|218557344|ref|YP_002390257.1| transcriptional regulator BolA [Escherichia coli S88]
 gi|218688298|ref|YP_002396510.1| transcriptional regulator BolA [Escherichia coli ED1a]
 gi|218693898|ref|YP_002401565.1| transcriptional regulator BolA [Escherichia coli 55989]
 gi|218698653|ref|YP_002406282.1| transcriptional regulator BolA [Escherichia coli IAI39]
 gi|218703718|ref|YP_002411237.1| transcriptional regulator BolA [Escherichia coli UMN026]
 gi|227884555|ref|ZP_04002360.1| protein BolA [Escherichia coli 83972]
 gi|238899723|ref|YP_002925519.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Escherichia coli BW2952]
 gi|254160504|ref|YP_003043612.1| transcriptional regulator BolA [Escherichia coli B str. REL606]
 gi|254791619|ref|YP_003076456.1| transcriptional regulator BolA [Escherichia coli O157:H7 str.
          TW14359]
 gi|256020405|ref|ZP_05434270.1| transcriptional regulator BolA [Shigella sp. D9]
 gi|256023948|ref|ZP_05437813.1| transcriptional regulator BolA [Escherichia sp. 4_1_40B]
 gi|260842636|ref|YP_003220414.1| regulator of penicillin binding proteins and beta-lactamase
          transcription [Escherichia coli O103:H2 str. 12009]
 gi|260853658|ref|YP_003227549.1| regulator of penicillin binding proteins and beta-lactamase
          transcription [Escherichia coli O26:H11 str. 11368]
 gi|260866596|ref|YP_003232998.1| regulator of penicillin binding proteins and beta-lactamase
          transcription [Escherichia coli O111:H- str. 11128]
 gi|261223916|ref|ZP_05938197.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Escherichia coli O157:H7
          str. FRIK2000]
 gi|261256370|ref|ZP_05948903.1| regulator of penicillin binding proteins and beta-lactamase
          transcription [Escherichia coli O157:H7 str. FRIK966]
 gi|291281342|ref|YP_003498160.1| transcriptional regulator BolA [Escherichia coli O55:H7 str.
          CB9615]
 gi|293403555|ref|ZP_06647646.1| transcriptional regulator BolA [Escherichia coli FVEC1412]
 gi|293418505|ref|ZP_06660940.1| transcriptional regulator BolA [Escherichia coli B088]
 gi|297516112|ref|ZP_06934498.1| transcriptional regulator BolA [Escherichia coli OP50]
 gi|298379167|ref|ZP_06989048.1| transcriptional regulator BolA [Escherichia coli FVEC1302]
 gi|300818234|ref|ZP_07098445.1| BolA-like protein [Escherichia coli MS 107-1]
 gi|300900505|ref|ZP_07118672.1| BolA-like protein [Escherichia coli MS 198-1]
 gi|300903298|ref|ZP_07121226.1| BolA-like protein [Escherichia coli MS 84-1]
 gi|300918183|ref|ZP_07134790.1| BolA-like protein [Escherichia coli MS 115-1]
 gi|300924161|ref|ZP_07140153.1| BolA-like protein [Escherichia coli MS 182-1]
 gi|300930263|ref|ZP_07145676.1| BolA-like protein [Escherichia coli MS 187-1]
 gi|300937051|ref|ZP_07151917.1| BolA-like protein [Escherichia coli MS 21-1]
 gi|300947913|ref|ZP_07162061.1| BolA-like protein [Escherichia coli MS 116-1]
 gi|300958002|ref|ZP_07170166.1| BolA-like protein [Escherichia coli MS 175-1]
 gi|300997377|ref|ZP_07181717.1| BolA-like protein [Escherichia coli MS 200-1]
 gi|301022572|ref|ZP_07186444.1| BolA-like protein [Escherichia coli MS 69-1]
 gi|301025670|ref|ZP_07189188.1| BolA-like protein [Escherichia coli MS 196-1]
 gi|301049641|ref|ZP_07196590.1| BolA-like protein [Escherichia coli MS 185-1]
 gi|301301585|ref|ZP_07207720.1| BolA-like protein [Escherichia coli MS 124-1]
 gi|301330699|ref|ZP_07223301.1| BolA-like protein [Escherichia coli MS 78-1]
 gi|301647360|ref|ZP_07247172.1| BolA-like protein [Escherichia coli MS 146-1]
 gi|306813099|ref|ZP_07447292.1| transcriptional regulator BolA [Escherichia coli NC101]
 gi|307137078|ref|ZP_07496434.1| transcriptional regulator BolA [Escherichia coli H736]
 gi|309794833|ref|ZP_07689254.1| BolA-like protein [Escherichia coli MS 145-7]
 gi|312964541|ref|ZP_07778797.1| protein bolA [Escherichia coli 2362-75]
 gi|312970530|ref|ZP_07784711.1| protein bolA [Escherichia coli 1827-70]
 gi|331640954|ref|ZP_08342089.1| protein BolA [Escherichia coli H736]
 gi|331645610|ref|ZP_08346714.1| protein BolA [Escherichia coli M605]
 gi|331656491|ref|ZP_08357453.1| protein BolA [Escherichia coli TA206]
 gi|331661815|ref|ZP_08362738.1| protein BolA [Escherichia coli TA143]
 gi|331666789|ref|ZP_08367663.1| protein BolA [Escherichia coli TA271]
 gi|331676106|ref|ZP_08376818.1| protein BolA [Escherichia coli H591]
 gi|331681829|ref|ZP_08382462.1| protein BolA [Escherichia coli H299]
 gi|78099827|sp|P0ABE3|BOLA_ECOL6 RecName: Full=Protein BolA
 gi|78099828|sp|P0ABE2|BOLA_ECOLI RecName: Full=Protein BolA
 gi|78099829|sp|P0ABE4|BOLA_SHIFL RecName: Full=Protein BolA
 gi|85674575|dbj|BAE76215.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Escherichia coli str. K12
          substr. W3110]
 gi|87081740|gb|AAC73538.2| stationary-phase morphogene, transcriptional repressor for mreB;
          also regulator for dacA, dacC, and ampC [Escherichia
          coli str. K-12 substr. MG1655]
 gi|110342287|gb|ABG68524.1| BolA protein [Escherichia coli 536]
 gi|157065641|gb|ABV04896.1| protein BolA [Escherichia coli HS]
 gi|157077528|gb|ABV17236.1| protein BolA [Escherichia coli E24377A]
 gi|169756121|gb|ACA78820.1| BolA family protein [Escherichia coli ATCC 8739]
 gi|169887856|gb|ACB01563.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Escherichia coli str. K-12
          substr. DH10B]
 gi|170519298|gb|ACB17476.1| protein BolA [Escherichia coli SMS-3-5]
 gi|187430165|gb|ACD09439.1| protein BolA [Shigella boydii CDC 3083-94]
 gi|188490284|gb|EDU65387.1| protein BolA [Escherichia coli 53638]
 gi|188999407|gb|EDU68393.1| protein BolA [Escherichia coli O157:H7 str. EC4076]
 gi|189358003|gb|EDU76422.1| protein BolA [Escherichia coli O157:H7 str. EC4401]
 gi|189362485|gb|EDU80904.1| protein BolA [Escherichia coli O157:H7 str. EC4486]
 gi|189373467|gb|EDU91883.1| protein BolA [Escherichia coli O157:H7 str. EC869]
 gi|190905031|gb|EDV64705.1| protein BolA [Escherichia coli F11]
 gi|194411357|gb|EDX27721.1| protein BolA [Escherichia coli B171]
 gi|194419120|gb|EDX35203.1| protein BolA [Shigella dysenteriae 1012]
 gi|194420851|gb|EDX36902.1| protein BolA [Escherichia coli 101-1]
 gi|208728070|gb|EDZ77671.1| protein BolA [Escherichia coli O157:H7 str. EC4206]
 gi|208731647|gb|EDZ80335.1| protein BolA [Escherichia coli O157:H7 str. EC4045]
 gi|208737183|gb|EDZ84867.1| protein BolA [Escherichia coli O157:H7 str. EC4042]
 gi|209157322|gb|ACI34755.1| protein BolA [Escherichia coli O157:H7 str. EC4115]
 gi|215263588|emb|CAS07918.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Escherichia coli O127:H6
          str. E2348/69]
 gi|217321071|gb|EEC29495.1| protein BolA [Escherichia coli O157:H7 str. TW14588]
 gi|218350630|emb|CAU96322.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Escherichia coli 55989]
 gi|218359769|emb|CAQ97310.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Escherichia coli IAI1]
 gi|218364113|emb|CAR01778.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Escherichia coli S88]
 gi|218368639|emb|CAR16378.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Escherichia coli IAI39]
 gi|218425862|emb|CAR06668.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Escherichia coli ED1a]
 gi|218430815|emb|CAR11689.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Escherichia coli UMN026]
 gi|222032230|emb|CAP74969.1| Protein bolA [Escherichia coli LF82]
 gi|227838641|gb|EEJ49107.1| protein BolA [Escherichia coli 83972]
 gi|238863433|gb|ACR65431.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Escherichia coli BW2952]
 gi|242376216|emb|CAQ30907.1| BolA transcriptional dual regulator [Escherichia coli BL21(DE3)]
 gi|253972405|gb|ACT38076.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Escherichia coli B str.
          REL606]
 gi|253976615|gb|ACT42285.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Escherichia coli BL21(DE3)]
 gi|254591019|gb|ACT70380.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Escherichia coli O157:H7
          str. TW14359]
 gi|257752307|dbj|BAI23809.1| regulator of penicillin binding proteins and beta-lactamase
          transcription [Escherichia coli O26:H11 str. 11368]
 gi|257757783|dbj|BAI29280.1| regulator of penicillin binding proteins and beta-lactamase
          transcription [Escherichia coli O103:H2 str. 12009]
 gi|257762952|dbj|BAI34447.1| regulator of penicillin binding proteins and beta-lactamase
          transcription [Escherichia coli O111:H- str. 11128]
 gi|281177605|dbj|BAI53935.1| putative transcriptional regulator [Escherichia coli SE15]
 gi|281599774|gb|ADA72758.1| Protein bolA [Shigella flexneri 2002017]
 gi|284920245|emb|CBG33304.1| putative transcriptional regulator [Escherichia coli 042]
 gi|290761215|gb|ADD55176.1| transcriptional regulator BolA [Escherichia coli O55:H7 str.
          CB9615]
 gi|291325033|gb|EFE64448.1| transcriptional regulator BolA [Escherichia coli B088]
 gi|291429408|gb|EFF02428.1| transcriptional regulator BolA [Escherichia coli FVEC1412]
 gi|294491782|gb|ADE90538.1| protein BolA [Escherichia coli IHE3034]
 gi|298280280|gb|EFI21784.1| transcriptional regulator BolA [Escherichia coli FVEC1302]
 gi|299880024|gb|EFI88235.1| BolA-like protein [Escherichia coli MS 196-1]
 gi|300298578|gb|EFJ54963.1| BolA-like protein [Escherichia coli MS 185-1]
 gi|300304196|gb|EFJ58716.1| BolA-like protein [Escherichia coli MS 200-1]
 gi|300315269|gb|EFJ65053.1| BolA-like protein [Escherichia coli MS 175-1]
 gi|300355986|gb|EFJ71856.1| BolA-like protein [Escherichia coli MS 198-1]
 gi|300397453|gb|EFJ80991.1| BolA-like protein [Escherichia coli MS 69-1]
 gi|300404593|gb|EFJ88131.1| BolA-like protein [Escherichia coli MS 84-1]
 gi|300414634|gb|EFJ97944.1| BolA-like protein [Escherichia coli MS 115-1]
 gi|300419614|gb|EFK02925.1| BolA-like protein [Escherichia coli MS 182-1]
 gi|300452513|gb|EFK16133.1| BolA-like protein [Escherichia coli MS 116-1]
 gi|300457882|gb|EFK21375.1| BolA-like protein [Escherichia coli MS 21-1]
 gi|300461835|gb|EFK25328.1| BolA-like protein [Escherichia coli MS 187-1]
 gi|300529125|gb|EFK50187.1| BolA-like protein [Escherichia coli MS 107-1]
 gi|300843082|gb|EFK70842.1| BolA-like protein [Escherichia coli MS 124-1]
 gi|300843360|gb|EFK71120.1| BolA-like protein [Escherichia coli MS 78-1]
 gi|301074505|gb|EFK89311.1| BolA-like protein [Escherichia coli MS 146-1]
 gi|305853862|gb|EFM54301.1| transcriptional regulator BolA [Escherichia coli NC101]
 gi|307552341|gb|ADN45116.1| BolA transcriptional regulator [Escherichia coli ABU 83972]
 gi|307628096|gb|ADN72400.1| transcriptional regulator BolA [Escherichia coli UM146]
 gi|308121486|gb|EFO58748.1| BolA-like protein [Escherichia coli MS 145-7]
 gi|309700696|emb|CBI99992.1| putative transcriptional regulator [Escherichia coli ETEC H10407]
 gi|310337179|gb|EFQ02317.1| protein bolA [Escherichia coli 1827-70]
 gi|312290775|gb|EFR18652.1| protein bolA [Escherichia coli 2362-75]
 gi|312945012|gb|ADR25839.1| transcriptional regulator BolA [Escherichia coli O83:H1 str. NRG
          857C]
 gi|313646939|gb|EFS11396.1| protein bolA [Shigella flexneri 2a str. 2457T]
 gi|315135117|dbj|BAJ42276.1| conserved hypothetical protein [Escherichia coli DH1]
 gi|315256262|gb|EFU36230.1| BolA-like protein [Escherichia coli MS 85-1]
 gi|315289848|gb|EFU49238.1| BolA-like protein [Escherichia coli MS 110-3]
 gi|315294232|gb|EFU53583.1| BolA-like protein [Escherichia coli MS 153-1]
 gi|315299558|gb|EFU58806.1| BolA-like protein [Escherichia coli MS 16-3]
 gi|315616625|gb|EFU97242.1| protein bolA [Escherichia coli 3431]
 gi|320178284|gb|EFW53258.1| Cell division protein BolA [Shigella boydii ATCC 9905]
 gi|320192850|gb|EFW67490.1| Cell division protein BolA [Escherichia coli O157:H7 str. EC1212]
 gi|320197092|gb|EFW71711.1| Cell division protein BolA [Escherichia coli WV_060327]
 gi|320201678|gb|EFW76254.1| Cell division protein BolA [Escherichia coli EC4100B]
 gi|320638429|gb|EFX08143.1| transcriptional regulator BolA [Escherichia coli O157:H7 str.
          G5101]
 gi|320643809|gb|EFX12932.1| transcriptional regulator BolA [Escherichia coli O157:H- str.
          493-89]
 gi|320649160|gb|EFX17738.1| transcriptional regulator BolA [Escherichia coli O157:H- str. H
          2687]
 gi|320656053|gb|EFX23969.1| transcriptional regulator BolA [Escherichia coli O55:H7 str.
          3256-97 TW 07815]
 gi|320661203|gb|EFX28634.1| transcriptional regulator BolA [Escherichia coli O55:H7 str. USDA
          5905]
 gi|320665179|gb|EFX32272.1| transcriptional regulator BolA [Escherichia coli O157:H7 str.
          LSU-61]
 gi|323153470|gb|EFZ39724.1| protein bolA [Escherichia coli EPECa14]
 gi|323160455|gb|EFZ46403.1| protein bolA [Escherichia coli E128010]
 gi|323184735|gb|EFZ70106.1| protein bolA [Escherichia coli 1357]
 gi|323191354|gb|EFZ76617.1| protein bolA [Escherichia coli RN587/1]
 gi|323938620|gb|EGB34869.1| BolA protein [Escherichia coli E1520]
 gi|323943241|gb|EGB39397.1| BolA protein [Escherichia coli E482]
 gi|323945339|gb|EGB41395.1| BolA protein [Escherichia coli H120]
 gi|323952953|gb|EGB48821.1| BolA protein [Escherichia coli H252]
 gi|323958628|gb|EGB54331.1| BolA protein [Escherichia coli H263]
 gi|323963424|gb|EGB58986.1| BolA protein [Escherichia coli H489]
 gi|323965121|gb|EGB60580.1| BolA protein [Escherichia coli M863]
 gi|323972288|gb|EGB67498.1| BolA protein [Escherichia coli TA007]
 gi|323976081|gb|EGB71174.1| BolA protein [Escherichia coli TW10509]
 gi|324010066|gb|EGB79285.1| BolA-like protein [Escherichia coli MS 57-2]
 gi|324016705|gb|EGB85924.1| BolA-like protein [Escherichia coli MS 117-3]
 gi|324116922|gb|EGC10835.1| BolA protein [Escherichia coli E1167]
 gi|326341198|gb|EGD64990.1| Cell division protein BolA [Escherichia coli O157:H7 str. 1044]
 gi|326346027|gb|EGD69766.1| Cell division protein BolA [Escherichia coli O157:H7 str. 1125]
 gi|327254762|gb|EGE66378.1| protein bolA [Escherichia coli STEC_7v]
 gi|330910228|gb|EGH38738.1| cell division protein BolA [Escherichia coli AA86]
 gi|331037752|gb|EGI09972.1| protein BolA [Escherichia coli H736]
 gi|331045772|gb|EGI17898.1| protein BolA [Escherichia coli M605]
 gi|331054739|gb|EGI26748.1| protein BolA [Escherichia coli TA206]
 gi|331060237|gb|EGI32201.1| protein BolA [Escherichia coli TA143]
 gi|331066013|gb|EGI37897.1| protein BolA [Escherichia coli TA271]
 gi|331076164|gb|EGI47446.1| protein BolA [Escherichia coli H591]
 gi|331081031|gb|EGI52196.1| protein BolA [Escherichia coli H299]
 gi|332094590|gb|EGI99636.1| protein bolA [Shigella boydii 5216-82]
 gi|332098676|gb|EGJ03642.1| protein bolA [Shigella boydii 3594-74]
 gi|332341798|gb|AEE55132.1| transcriptional regulator protein BolA [Escherichia coli UMNK88]
 gi|332760725|gb|EGJ91013.1| protein bolA [Shigella flexneri 4343-70]
 gi|332761561|gb|EGJ91843.1| protein bolA [Shigella flexneri 2747-71]
 gi|333007841|gb|EGK27317.1| protein bolA [Shigella flexneri K-218]
 gi|333010895|gb|EGK30321.1| protein bolA [Shigella flexneri K-272]
 gi|333021970|gb|EGK41218.1| protein bolA [Shigella flexneri K-304]
          Length = 105

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+M+Y +L  ++   +HAL++ T
Sbjct: 33 AGSESHFKVVLVSDRFTGERFLNRHRMIYSTLAEELSTTVHALALHT 79


>gi|209917651|ref|YP_002291735.1| transcriptional regulator BolA [Escherichia coli SE11]
 gi|253774577|ref|YP_003037408.1| transcriptional regulator BolA [Escherichia coli
          'BL21-Gold(DE3)pLysS AG']
 gi|300820321|ref|ZP_07100473.1| BolA-like protein [Escherichia coli MS 119-7]
 gi|300988011|ref|ZP_07178491.1| BolA-like protein [Escherichia coli MS 45-1]
 gi|307312187|ref|ZP_07591823.1| BolA family protein [Escherichia coli W]
 gi|309787026|ref|ZP_07681638.1| protein bolA [Shigella dysenteriae 1617]
 gi|209910910|dbj|BAG75984.1| putative transcriptional regulator [Escherichia coli SE11]
 gi|253325621|gb|ACT30223.1| BolA family protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|260450378|gb|ACX40800.1| BolA family protein [Escherichia coli DH1]
 gi|300407563|gb|EFJ91101.1| BolA-like protein [Escherichia coli MS 45-1]
 gi|300527106|gb|EFK48175.1| BolA-like protein [Escherichia coli MS 119-7]
 gi|306907689|gb|EFN38191.1| BolA family protein [Escherichia coli W]
 gi|308924604|gb|EFP70099.1| protein bolA [Shigella dysenteriae 1617]
 gi|315059715|gb|ADT74042.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Escherichia coli W]
 gi|320186064|gb|EFW60809.1| Cell division protein BolA [Shigella flexneri CDC 796-83]
 gi|323379720|gb|ADX51988.1| BolA family protein [Escherichia coli KO11]
 gi|324010648|gb|EGB79867.1| BolA-like protein [Escherichia coli MS 60-1]
          Length = 104

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+M+Y +L  ++   +HAL++ T
Sbjct: 32 AGSESHFKVVLVSDRFTGERFLNRHRMIYSTLAEELSTTVHALALHT 78


>gi|237707571|ref|ZP_04538052.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|293408584|ref|ZP_06652423.1| conserved hypothetical protein [Escherichia coli B354]
 gi|293413690|ref|ZP_06656339.1| bolA protein [Escherichia coli B185]
 gi|331651372|ref|ZP_08352397.1| protein BolA [Escherichia coli M718]
 gi|331671982|ref|ZP_08372778.1| protein BolA [Escherichia coli TA280]
 gi|332281585|ref|ZP_08393998.1| conserved hypothetical protein [Shigella sp. D9]
 gi|12513294|gb|AAG54785.1|AE005222_10 possible regulator of murein genes [Escherichia coli O157:H7 str.
          EDL933]
 gi|26106841|gb|AAN79026.1|AE016756_209 BolA protein [Escherichia coli CFT073]
 gi|41070|emb|CAA35633.1| unnamed protein product [Escherichia coli]
 gi|1773119|gb|AAB40191.1| bolA [Escherichia coli]
 gi|13359946|dbj|BAB33912.1| putative regulator of murein genes [Escherichia coli O157:H7 str.
          Sakai]
 gi|24050609|gb|AAN42035.1| possible regulator of murein genes [Shigella flexneri 2a str.
          301]
 gi|30040181|gb|AAP15914.1| possible regulator of murein genes [Shigella flexneri 2a str.
          2457T]
 gi|73854487|gb|AAZ87194.1| possible regulator of murein genes [Shigella sonnei Ss046]
 gi|81239807|gb|ABB60517.1| possible regulator of murein genes [Shigella dysenteriae Sd197]
 gi|81244334|gb|ABB65042.1| possible regulator of murein genes [Shigella boydii Sb227]
 gi|91071080|gb|ABE05961.1| BolA transcriptional regulator [Escherichia coli UTI89]
 gi|115511819|gb|ABI99893.1| regulator of penicillin binding proteins and beta lactamase
          transcription [Escherichia coli APEC O1]
 gi|209743874|gb|ACI70244.1| putative regulator of murein genes [Escherichia coli]
 gi|209743876|gb|ACI70245.1| putative regulator of murein genes [Escherichia coli]
 gi|209743878|gb|ACI70246.1| putative regulator of murein genes [Escherichia coli]
 gi|209743880|gb|ACI70247.1| putative regulator of murein genes [Escherichia coli]
 gi|209743882|gb|ACI70248.1| putative regulator of murein genes [Escherichia coli]
 gi|226898781|gb|EEH85040.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|291433748|gb|EFF06721.1| bolA protein [Escherichia coli B185]
 gi|291471762|gb|EFF14245.1| conserved hypothetical protein [Escherichia coli B354]
 gi|331051113|gb|EGI23165.1| protein BolA [Escherichia coli M718]
 gi|331070971|gb|EGI42330.1| protein BolA [Escherichia coli TA280]
 gi|332103937|gb|EGJ07283.1| conserved hypothetical protein [Shigella sp. D9]
          Length = 116

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+M+Y +L  ++   +HAL++ T
Sbjct: 44 AGSESHFKVVLVSDRFTGERFLNRHRMIYSTLAEELSTTVHALALHT 90


>gi|66821713|ref|XP_644296.1| bolA family protein [Dictyostelium discoideum AX4]
 gi|74861509|sp|Q86KD0|Y7416_DICDI RecName: Full=BolA-like protein DDB_G0274169
 gi|60472024|gb|EAL69977.1| bolA family protein [Dictyostelium discoideum AX4]
          Length = 114

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA-LHALSIKTSVP 76
          G  +H+  +I+SE+F   + I+QH++V + L N +GN  +HALSI +  P
Sbjct: 38 GSESHFKVKIVSEKFETLSMIEQHRLVNEILKNFIGNGKIHALSITSRTP 87


>gi|328769188|gb|EGF79232.1| hypothetical protein BATDEDRAFT_89896 [Batrachochytrium
          dendrobatidis JAM81]
          Length = 101

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 31/51 (60%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          L     H+   I+S+ F  K+ +Q+H++VY+ L  ++ + +HALS+ T  P
Sbjct: 42 LRSTETHFRVVIVSDAFASKSLVQRHKLVYEILDQEINSGVHALSLVTKTP 92


>gi|296532535|ref|ZP_06895248.1| BolA family protein [Roseomonas cervicalis ATCC 49957]
 gi|296267136|gb|EFH13048.1| BolA family protein [Roseomonas cervicalis ATCC 49957]
          Length = 96

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 31/50 (62%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   HY   +I+ +FRG +R+ + + V+ +L  + G+ LHALS++   P+
Sbjct: 39 GGETHYNLVVIAPDFRGMSRVARSRAVHAALAAEFGSGLHALSLRLLTPE 88


>gi|294635322|ref|ZP_06713819.1| BolA protein [Edwardsiella tarda ATCC 23685]
 gi|291091298|gb|EFE23859.1| BolA protein [Edwardsiella tarda ATCC 23685]
          Length = 108

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 31/47 (65%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG   H+   ++S+ F+G+  +Q+H+ +Y +L  +M + +HAL++ T
Sbjct: 32 AGSETHFKVVMVSDRFQGERFLQRHRAIYGALAEEMADGVHALALHT 78


>gi|209882072|ref|XP_002142473.1| BolA-like domain-containing protein [Cryptosporidium muris RN66]
 gi|209558079|gb|EEA08124.1| BolA-like domain-containing protein [Cryptosporidium muris RN66]
          Length = 84

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 43/71 (60%), Gaps = 6/71 (8%)

Query: 8  IEKMIKKGIPQSI----VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          +E +I + I +S+    + I DL+   G  +   I+S++F GK  +++H++V  SLGN  
Sbjct: 5  MESLISEKITRSLNPEKLEILDLSNSCGAIFNLTIVSDKFEGKKLLERHRLVNSSLGNTY 64

Query: 63 GNALHALSIKT 73
           N +HALSIK 
Sbjct: 65 -NQIHALSIKC 74


>gi|298715641|emb|CBJ28167.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 130

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 42/73 (57%), Gaps = 4/73 (5%)

Query: 4   NPHE--IEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
           +P E  I  +++  I  S   +HD++G  G+ Y  E+ S  FRGK  + QH+MV  +L  
Sbjct: 54  SPREDAIASILESKIEASKAVVHDISGGCGSMYKIEVESPLFRGKGLVAQHRMVKAALAT 113

Query: 61  KMGNALHALSIKT 73
           ++ + +H L++ T
Sbjct: 114 EIAD-MHGLTLLT 125


>gi|114051307|ref|NP_001040378.1| bolA-like 3 [Bombyx mori]
 gi|95102678|gb|ABF51277.1| bolA-like 3 [Bombyx mori]
          Length = 117

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 46/76 (60%), Gaps = 3/76 (3%)

Query: 6   HEIEKMIKKGIPQ-SIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG 63
            ++   +KK +P  + +++ D++G  G  +   + ++EF G NR++QH++V DSL N++ 
Sbjct: 43  QQLTDALKKAMPGITYISVQDISGGCGAMFEISVEAKEFVGLNRVKQHRLVTDSLKNEIA 102

Query: 64  NALHALSIKTSVPDSQ 79
             +H + I T+   +Q
Sbjct: 103 E-MHGIRIHTTPAATQ 117


>gi|148907206|gb|ABR16744.1| unknown [Picea sitchensis]
          Length = 350

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 31/46 (67%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
            H+  +I+S +F G++ +++H+++Y+ L  ++ + LHALSI    P
Sbjct: 299 THFNVKIVSSKFEGRSLVKRHRLIYELLQEELQSGLHALSIIAKTP 344


>gi|156548040|ref|XP_001605871.1| PREDICTED: similar to BolA protein, putative [Nasonia
          vitripennis]
          Length = 111

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 44/85 (51%), Gaps = 11/85 (12%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIH-DL----------AGDGNHYAAEIISEEFRGKNRIQQH 51
          ++P  +E  I+K + ++ +  H D+           G   H+   ++S++F     I++H
Sbjct: 5  VHPKPVETSIRKKLKETFLPTHMDVLNESYMHNVPKGAETHFKVVVVSDKFTDLPLIKRH 64

Query: 52 QMVYDSLGNKMGNALHALSIKTSVP 76
          +MV D L +++ N +HALSI    P
Sbjct: 65 RMVMDLLSDELENGVHALSIVAKTP 89


>gi|119897995|ref|YP_933208.1| putative BolA-like protein [Azoarcus sp. BH72]
 gi|119670408|emb|CAL94321.1| putative BolA-like protein [Azoarcus sp. BH72]
          Length = 97

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 28/40 (70%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIK 72
          YA  I+S+ F GK+ + +H+M+Y +L + M   +HAL+I+
Sbjct: 41 YAISIVSDAFAGKSTVARHRMIYAALDDLMKTQIHALAIR 80


>gi|57098783|ref|XP_533041.1| PREDICTED: similar to bolA-like 1 isoform 1 [Canis familiaris]
 gi|73981250|ref|XP_849759.1| PREDICTED: similar to bolA-like 1 isoform 3 [Canis familiaris]
          Length = 137

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 30/49 (61%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           G   H+   ++S  F G + +Q+H++V+ +L  ++   +HAL+I+T  P
Sbjct: 63  GSETHFRVAVVSSRFEGLSPLQRHRLVHAALSEELAGRVHALAIQTRTP 111


>gi|86747664|ref|YP_484160.1| BolA-like protein [Rhodopseudomonas palustris HaA2]
 gi|86570692|gb|ABD05249.1| transcriptional regulator BolA [Rhodopseudomonas palustris HaA2]
          Length = 89

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 29/46 (63%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          +H+   I+S  F GK+RI +H+MV + L  ++   +HAL++K   P
Sbjct: 41 SHFRVNIVSGAFAGKSRIDRHRMVNELLAAELSGGVHALALKARAP 86


>gi|27375296|ref|NP_766825.1| hypothetical protein bsr0185 [Bradyrhizobium japonicum USDA 110]
 gi|27348432|dbj|BAC45450.1| bsr0185 [Bradyrhizobium japonicum USDA 110]
          Length = 89

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 30/46 (65%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+   I+S+ F+GK+R+ +H+M+  +L  ++  ++HAL+I    P
Sbjct: 41 THFRVYIVSQAFKGKSRVDRHRMINAALAAELSGSVHALAIHAQAP 86


>gi|53802523|ref|YP_112794.1| toluene-tolerance protein [Methylococcus capsulatus str. Bath]
 gi|53756284|gb|AAU90575.1| putative toluene-tolerance protein [Methylococcus capsulatus str.
          Bath]
          Length = 82

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   E+  +I+ GIP   V +    G+G +++  +I E F G + +++ Q V  ++   +
Sbjct: 1  MEIDEVRTLIEAGIPGCEVRVE---GEGCNFSVVVIGEAFEGLSPVKRQQRVLATVSEPL 57

Query: 63 GN-ALHALSIKTSVP 76
             ALHA+S+K   P
Sbjct: 58 STGALHAISMKVYTP 72


>gi|94310805|ref|YP_584015.1| transcriptional regulator BolA [Cupriavidus metallidurans CH34]
 gi|93354657|gb|ABF08746.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Cupriavidus metallidurans
          CH34]
          Length = 104

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 43/81 (53%), Gaps = 10/81 (12%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHD----------LAGDGNHYAAEIISEEFRGKNRIQQ 50
          M+ +P  IE +++  +  + + + D           A  G HY   I+SE F G +R+ +
Sbjct: 1  MAADPATIEALLQAALDPTRLAVRDDSAAHAGHAGAASGGGHYDVLIVSERFGGHSRVAR 60

Query: 51 HQMVYDSLGNKMGNALHALSI 71
          H+MVYD+L     + +HAL++
Sbjct: 61 HRMVYDALRELFPSQIHALAV 81


>gi|328791881|ref|XP_001123015.2| PREDICTED: bolA-like protein 3-like [Apis mellifera]
          Length = 107

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 50/78 (64%), Gaps = 6/78 (7%)

Query: 6   HEIEKMI---KKGIPQS-IVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
           H  +KMI   +   P++ ++ ++D++G  G  +   +++ EF+G N I+QH+++ ++L  
Sbjct: 31  HAEQKMISILRNKFPKAKLIEVNDVSGGCGAMFEINVVAPEFKGLNTIKQHRLINEALKE 90

Query: 61  KMGNALHALSIKTSVPDS 78
           ++ + +H + I TSVP+S
Sbjct: 91  EIKD-MHGVRIYTSVPES 107


>gi|315498106|ref|YP_004086910.1| bola family protein [Asticcacaulis excentricus CB 48]
 gi|315416118|gb|ADU12759.1| BolA family protein [Asticcacaulis excentricus CB 48]
          Length = 90

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 32/50 (64%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G  +H++  I+SE FRG+ R+ + + V  +L  ++   +HALS++T  P+
Sbjct: 39 GGESHFSVLIVSEAFRGQTRVARQRAVNAALREELSGPVHALSMQTLTPE 88


>gi|17541430|ref|NP_499963.1| hypothetical protein K11H12.1 [Caenorhabditis elegans]
 gi|3025255|sp|P91375|YN1I_CAEEL RecName: Full=Putative bolA-like protein K11H12.1
 gi|1825597|gb|AAC24398.1| Hypothetical protein K11H12.1 [Caenorhabditis elegans]
          Length = 108

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
          G   H+  +++S+EF GK  I++H++V   L  ++   +HAL I  ++P S+
Sbjct: 40 GAEKHFRVQVVSDEFEGKRVIERHRLVNTCLAKELATTVHALRI-DAIPTSK 90


>gi|328852932|gb|EGG02074.1| hypothetical protein MELLADRAFT_38746 [Melampsora larici-populina
          98AG31]
          Length = 84

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 2/53 (3%)

Query: 27 AGDG-NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPD 77
           G G  H++ ++IS +F G NR+ +H+ +Y +L  +     LHALS++T  P+
Sbjct: 24 GGSGETHFSVKVISSDFHGLNRLSRHRKIYKALSYEFEERGLHALSLQTYTPE 76


>gi|161830835|ref|YP_001596799.1| yciL protein [Coxiella burnetii RSA 331]
 gi|161762702|gb|ABX78344.1| yciL protein [Coxiella burnetii RSA 331]
          Length = 192

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 31/47 (65%)

Query: 32  HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDS 78
           H+  EI ++ F+ KN I++H+++Y++L + M   +HAL I  +  +S
Sbjct: 146 HFKVEITAKAFKNKNPIERHRLIYEALSDLMETDIHALRIHATAAES 192


>gi|251790650|ref|YP_003005371.1| BolA family protein [Dickeya zeae Ech1591]
 gi|247539271|gb|ACT07892.1| BolA family protein [Dickeya zeae Ech1591]
          Length = 104

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 30/50 (60%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          AG  +H+   ++SE F G+  I +H+ VY  L +++   +HAL++ T  P
Sbjct: 32 AGAESHFKVVLVSEHFSGERVIGRHRAVYRVLADELAGTVHALALHTYTP 81


>gi|165975695|ref|YP_001651288.1| putative transcriptional regulator [Actinobacillus
          pleuropneumoniae serovar 3 str. JL03]
 gi|303252794|ref|ZP_07338954.1| putative transcriptional regulator [Actinobacillus
          pleuropneumoniae serovar 2 str. 4226]
 gi|307247220|ref|ZP_07529270.1| Transcriptional regulator BolA [Actinobacillus pleuropneumoniae
          serovar 2 str. S1536]
 gi|165875796|gb|ABY68844.1| putative transcriptional regulator [Actinobacillus
          pleuropneumoniae serovar 3 str. JL03]
 gi|302648355|gb|EFL78551.1| putative transcriptional regulator [Actinobacillus
          pleuropneumoniae serovar 2 str. 4226]
 gi|306856278|gb|EFM88431.1| Transcriptional regulator BolA [Actinobacillus pleuropneumoniae
          serovar 2 str. S1536]
          Length = 103

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 29/49 (59%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G  +H+   ++SE F G   + +H+ +Y  L +++ N +HAL++ T  P
Sbjct: 34 GAESHFKVTLVSETFEGIRTVARHRAIYTCLADELENGVHALALHTYTP 82


>gi|319762262|ref|YP_004126199.1| bola family protein [Alicycliphilus denitrificans BC]
 gi|330825810|ref|YP_004389113.1| BolA family protein [Alicycliphilus denitrificans K601]
 gi|317116823|gb|ADU99311.1| BolA family protein [Alicycliphilus denitrificans BC]
 gi|329311182|gb|AEB85597.1| BolA family protein [Alicycliphilus denitrificans K601]
          Length = 92

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 29/46 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G G H+   I S  F GK ++ QH++VYD+L   + +  HA++I+T
Sbjct: 46 GFGTHFRVRIASPLFAGKRKVAQHRLVYDALQIFIDHGAHAIAIET 91


>gi|29654230|ref|NP_819922.1| BolA [Coxiella burnetii RSA 493]
 gi|29541496|gb|AAO90436.1| YciL [Coxiella burnetii RSA 493]
          Length = 192

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 31/47 (65%)

Query: 32  HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDS 78
           H+  EI ++ F+ KN I++H+++Y++L + M   +HAL I  +  +S
Sbjct: 146 HFKVEITAKAFKNKNPIERHRLIYEALSDLMETDIHALRIHATAAES 192


>gi|242241043|ref|YP_002989224.1| BolA family protein [Dickeya dadantii Ech703]
 gi|242133100|gb|ACS87402.1| BolA family protein [Dickeya dadantii Ech703]
          Length = 84

 Score = 42.0 bits (97), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVPD 77
          ++GDG+H+   ++ + F+  +R++Q Q VY  L   +  N +HALSIK   P+
Sbjct: 21 VSGDGSHFQVIVVGDVFKEMSRVKQQQAVYGPLMEYIADNRIHALSIKAYTPE 73


>gi|330446816|ref|ZP_08310467.1| bolA-like family protein [Photobacterium leiognathi subsp.
          mandapamensis svers.1.1.]
 gi|328491007|dbj|GAA04964.1| bolA-like family protein [Photobacterium leiognathi subsp.
          mandapamensis svers.1.1.]
          Length = 84

 Score = 42.0 bits (97), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EI+++++  +    V +    G+G+HY    +   F G +R+++ Q +Y  L +++
Sbjct: 1  MEISEIKQILETALDLDEVIVK---GEGSHYEVIAVGTLFDGMSRVKKQQTIYGPLMDRI 57

Query: 63 -GNALHALSIKTSVPD 77
            N +HAL+IKT  P+
Sbjct: 58 AANDIHALTIKTYTPE 73


>gi|212711091|ref|ZP_03319219.1| hypothetical protein PROVALCAL_02160 [Providencia alcalifaciens
          DSM 30120]
 gi|212686259|gb|EEB45787.1| hypothetical protein PROVALCAL_02160 [Providencia alcalifaciens
          DSM 30120]
          Length = 84

 Score = 42.0 bits (97), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+ +EI++++ + +    V ++   GDG+H+    +   F G +R++Q Q VY  L   +
Sbjct: 1  MDTNEIKQVLMEKLSLEEVIVN---GDGSHFQVIAVGSLFDGMSRVKQQQAVYAPLMEYI 57

Query: 63 G-NALHALSIKTSVP 76
            N +HALSIK   P
Sbjct: 58 ADNRIHALSIKAYTP 72


>gi|317047173|ref|YP_004114821.1| BolA family protein [Pantoea sp. At-9b]
 gi|316948790|gb|ADU68265.1| BolA family protein [Pantoea sp. At-9b]
          Length = 104

 Score = 42.0 bits (97), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 39/74 (52%), Gaps = 7/74 (9%)

Query: 7  EIEKMIKKGIPQSIVTIHDL-------AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          EIE+ ++K    + + +HD        AG  +H+   I+S+ F G+  + +H+ +Y  L 
Sbjct: 5  EIEEKLRKAFEPAHLEVHDESYRHNVPAGSESHFKVVIVSDRFTGQRFLARHRSIYSELT 64

Query: 60 NKMGNALHALSIKT 73
           +    +HAL++ T
Sbjct: 65 AEFAGGVHALALHT 78


>gi|219129077|ref|XP_002184724.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217403833|gb|EEC43783.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 90

 Score = 42.0 bits (97), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 4/59 (6%)

Query: 21 VTIHDLAGD---GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          V +HD + D   G      ++S+ FRGK  +Q+H++V D +   M   +HAL+IKT  P
Sbjct: 21 VHVHDFSDDVCNGAKLKLIVVSDSFRGKPPLQRHRLVNDCVAVHMPQ-IHALTIKTWTP 78


>gi|152996431|ref|YP_001341266.1| BolA family protein [Marinomonas sp. MWYL1]
 gi|150837355|gb|ABR71331.1| BolA family protein [Marinomonas sp. MWYL1]
          Length = 78

 Score = 42.0 bits (97), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MN  E++ +++  I    V      G+G ++   +++ EF G + +++ Q+VY  L   +
Sbjct: 1  MNAGEVKALLESSIRNCEVVAE---GEGCNFQVVVVTSEFEGLSTVKRQQLVYSHLQEAI 57

Query: 63 GN-ALHALSIKTSVPD 77
           + A+HA+++KT  P+
Sbjct: 58 SSGAIHAVTMKTYTPE 73


>gi|271499595|ref|YP_003332620.1| BolA family protein [Dickeya dadantii Ech586]
 gi|270343150|gb|ACZ75915.1| BolA family protein [Dickeya dadantii Ech586]
          Length = 104

 Score = 42.0 bits (97), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 30/50 (60%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          AG  +H+   ++SE F G+  I +H+ +Y  L +++   +HAL++ T  P
Sbjct: 32 AGSESHFKVVLVSERFSGERVIGRHRAIYRVLADELAGPVHALALHTYTP 81


>gi|294896744|ref|XP_002775710.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gi|294953957|ref|XP_002787977.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gi|239881933|gb|EER07526.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gi|239903093|gb|EER19773.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
          Length = 89

 Score = 42.0 bits (97), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 41/67 (61%), Gaps = 2/67 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          +E +++  +  +   + D++G  G+ Y  E+ S +F G  RI+QHQMV D+L +++    
Sbjct: 19 LESLLRASLGATSAKVQDVSGGCGSSYKVEVHSPKFIGLTRIKQHQMVNDALKDEI-KKW 77

Query: 67 HALSIKT 73
          HA++I T
Sbjct: 78 HAITIIT 84


>gi|116208726|ref|XP_001230172.1| hypothetical protein CHGG_03656 [Chaetomium globosum CBS 148.51]
 gi|88184253|gb|EAQ91721.1| hypothetical protein CHGG_03656 [Chaetomium globosum CBS 148.51]
          Length = 559

 Score = 42.0 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 38/61 (62%), Gaps = 3/61 (4%)

Query: 17  PQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSV 75
           P  +V + D++G  G+ Y  E+ SE+FRG N ++Q ++V  +LG+ +    H + +KT V
Sbjct: 115 PTELV-VQDISGGCGSMYGIEVCSEKFRGLNMLKQQRLVNAALGDLL-KEWHGVQLKTRV 172

Query: 76  P 76
           P
Sbjct: 173 P 173


>gi|306842848|ref|ZP_07475488.1| bolA protein [Brucella sp. BO2]
 gi|306287042|gb|EFM58553.1| bolA protein [Brucella sp. BO2]
          Length = 94

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 36/54 (66%), Gaps = 1/54 (1%)

Query: 24 HDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          +D AG+  H+   I++E F G +R+Q+H+ + D L  ++ + +HAL+++ S P+
Sbjct: 37 YDGAGE-THFRIRIVAEAFTGMSRVQRHRAINDLLKEELESGVHALALEPSAPE 89


>gi|159164108|pdb|2DHM|A Chain A, Solution Structure Of The Bola Protein From Escherichia
          Coli
          Length = 107

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+M+Y +L  ++   +HAL++ T
Sbjct: 40 AGSESHFKVVLVSDRFTGERFLNRHRMIYSTLAEELSTTVHALALHT 86


>gi|183597949|ref|ZP_02959442.1| hypothetical protein PROSTU_01298 [Providencia stuartii ATCC
          25827]
 gi|188022721|gb|EDU60761.1| hypothetical protein PROSTU_01298 [Providencia stuartii ATCC
          25827]
          Length = 84

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M P+EI++++   +    V ++   GDG+H+    +   F   +R++Q Q VY  L   +
Sbjct: 1  MEPNEIKQVLMDKLSLDEVIVN---GDGSHFQVIAVGAMFENMSRVKQQQAVYAPLMEYI 57

Query: 63 G-NALHALSIKTSVP 76
            N +HALSIK   P
Sbjct: 58 ADNRIHALSIKAYTP 72


>gi|289209397|ref|YP_003461463.1| BolA family protein [Thioalkalivibrio sp. K90mix]
 gi|288945028|gb|ADC72727.1| BolA family protein [Thioalkalivibrio sp. K90mix]
          Length = 106

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 31/50 (62%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G  +H+   ++SE FR +  I +H++V  +L +++   +HAL++ T  PD
Sbjct: 34 GSESHFKVTVVSEAFRDQKLIARHRLVNQTLADELAGGIHALALHTLDPD 83


>gi|87120452|ref|ZP_01076346.1| toluene-tolerance protein, putative [Marinomonas sp. MED121]
 gi|86164095|gb|EAQ65366.1| toluene-tolerance protein, putative [Marinomonas sp. MED121]
          Length = 79

 Score = 42.0 bits (97), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MN +E++ +++K I    V      G+G ++   +IS  F G   +++ Q+VY  L + +
Sbjct: 1  MNANEVKALLEKEIESCEVIAE---GEGCNFQLTLISPAFDGLTTVKRQQLVYSHLQDSI 57

Query: 63 GN-ALHALSIKTSVP 76
           + A+HA+++KT  P
Sbjct: 58 ASGAIHAVTMKTYTP 72


>gi|121594045|ref|YP_985941.1| transcriptional regulator BolA [Acidovorax sp. JS42]
 gi|222111222|ref|YP_002553486.1| bola family protein [Acidovorax ebreus TPSY]
 gi|120606125|gb|ABM41865.1| transcriptional regulator, BolA protein family [Acidovorax sp.
          JS42]
 gi|221730666|gb|ACM33486.1| BolA family protein [Acidovorax ebreus TPSY]
          Length = 92

 Score = 41.6 bits (96), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (60%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G G H+   I S  F GK ++ QH++VYD+L   +    HA++I+T
Sbjct: 46 GFGTHFRVRIASPLFTGKRKVAQHRLVYDALQIFIDQGAHAIAIET 91


>gi|170750095|ref|YP_001756355.1| BolA family protein [Methylobacterium radiotolerans JCM 2831]
 gi|170656617|gb|ACB25672.1| BolA family protein [Methylobacterium radiotolerans JCM 2831]
          Length = 98

 Score = 41.6 bits (96), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 29/49 (59%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G   HY  +I++  F GK+R+++H++V   L +     LHAL+++   P
Sbjct: 46 GGETHYRLDIVASAFEGKSRVERHRLVNALLDDAFKRGLHALALRARTP 94


>gi|162421090|ref|YP_001605687.1| morphology/transcription regulator BolA family protein [Yersinia
          pestis Angola]
 gi|165928117|ref|ZP_02223949.1| putative BolA protein [Yersinia pestis biovar Orientalis str.
          F1991016]
 gi|165937488|ref|ZP_02226051.1| putative BolA protein [Yersinia pestis biovar Orientalis str.
          IP275]
 gi|166011398|ref|ZP_02232296.1| putative BolA protein [Yersinia pestis biovar Antiqua str.
          E1979001]
 gi|166212046|ref|ZP_02238081.1| putative BolA protein [Yersinia pestis biovar Antiqua str.
          B42003004]
 gi|167400688|ref|ZP_02306197.1| putative BolA protein [Yersinia pestis biovar Antiqua str.
          UG05-0454]
 gi|167420606|ref|ZP_02312359.1| putative BolA protein [Yersinia pestis biovar Orientalis str.
          MG05-1020]
 gi|167426974|ref|ZP_02318727.1| putative BolA protein [Yersinia pestis biovar Mediaevalis str.
          K1973002]
 gi|167470186|ref|ZP_02334890.1| putative BolA protein [Yersinia pestis FV-1]
 gi|229836874|ref|ZP_04457039.1| predicted DNA-binding transcriptional regulator [Yersinia pestis
          Pestoides A]
 gi|229839226|ref|ZP_04459385.1| predicted DNA-binding transcriptional regulator [Yersinia pestis
          biovar Orientalis str. PEXU2]
 gi|229899791|ref|ZP_04514932.1| predicted DNA-binding transcriptional regulator [Yersinia pestis
          biovar Orientalis str. India 195]
 gi|229904106|ref|ZP_04519217.1| predicted DNA-binding transcriptional regulator [Yersinia pestis
          Nepal516]
 gi|270488541|ref|ZP_06205615.1| BolA-like protein [Yersinia pestis KIM D27]
 gi|162353905|gb|ABX87853.1| putative BolA protein [Yersinia pestis Angola]
 gi|165914593|gb|EDR33207.1| putative BolA protein [Yersinia pestis biovar Orientalis str.
          IP275]
 gi|165919891|gb|EDR37192.1| putative BolA protein [Yersinia pestis biovar Orientalis str.
          F1991016]
 gi|165989782|gb|EDR42083.1| putative BolA protein [Yersinia pestis biovar Antiqua str.
          E1979001]
 gi|166206792|gb|EDR51272.1| putative BolA protein [Yersinia pestis biovar Antiqua str.
          B42003004]
 gi|166961412|gb|EDR57433.1| putative BolA protein [Yersinia pestis biovar Orientalis str.
          MG05-1020]
 gi|167050056|gb|EDR61464.1| putative BolA protein [Yersinia pestis biovar Antiqua str.
          UG05-0454]
 gi|167054014|gb|EDR63842.1| putative BolA protein [Yersinia pestis biovar Mediaevalis str.
          K1973002]
 gi|229678224|gb|EEO74329.1| predicted DNA-binding transcriptional regulator [Yersinia pestis
          Nepal516]
 gi|229687283|gb|EEO79358.1| predicted DNA-binding transcriptional regulator [Yersinia pestis
          biovar Orientalis str. India 195]
 gi|229695592|gb|EEO85639.1| predicted DNA-binding transcriptional regulator [Yersinia pestis
          biovar Orientalis str. PEXU2]
 gi|229705817|gb|EEO91826.1| predicted DNA-binding transcriptional regulator [Yersinia pestis
          Pestoides A]
 gi|270337045|gb|EFA47822.1| BolA-like protein [Yersinia pestis KIM D27]
 gi|320017112|gb|ADW00684.1| putative DNA-binding transcriptional regulator [Yersinia pestis
          biovar Medievalis str. Harbin 35]
          Length = 84

 Score = 41.6 bits (96), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVP 76
          + GDG+H+   ++ E F   NR+++ Q VY  L   +  N +HALSIK   P
Sbjct: 21 VTGDGSHFQVIVVGELFADMNRVKKQQAVYAPLMEYIADNRIHALSIKAYTP 72


>gi|300718601|ref|YP_003743404.1| transcriptional regulator (BolA family) [Erwinia billingiae
          Eb661]
 gi|299064437|emb|CAX61557.1| Transcriptional regulator (BolA family) [Erwinia billingiae
          Eb661]
          Length = 84

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 42/76 (55%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EI+ ++   +P  +  +H + GDG+H+    + E F   +R+++ Q VY  L   +
Sbjct: 1  METSEIQSVLMGALP--LQEVH-VTGDGSHFQVIAVGELFADLSRVKKQQTVYAPLMAYI 57

Query: 63 G-NALHALSIKTSVPD 77
            N +HA+SIKT  P+
Sbjct: 58 ADNRMHAVSIKTFTPE 73


>gi|323170520|gb|EFZ56170.1| protein bolA [Escherichia coli LT-68]
          Length = 83

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+M+Y +L  ++   +HAL++ T
Sbjct: 11 AGSESHFKVVLVSDRFTGERFLNRHRMIYSTLAEELSTTVHALALHT 57


>gi|117919383|ref|YP_868575.1| transcriptional regulator BolA [Shewanella sp. ANA-3]
 gi|117611715|gb|ABK47169.1| transcriptional regulator BolA [Shewanella sp. ANA-3]
          Length = 106

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 28/42 (66%)

Query: 32 HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          H+   ++S+EF G   + +H++V + L N++ N +HALSI T
Sbjct: 45 HFKVVVVSDEFDGLRLLARHRLVNNCLANELANGVHALSIHT 86


>gi|22124061|ref|NP_667484.1| morphology/transcription regulator BolA family protein [Yersinia
          pestis KIM 10]
 gi|45443556|ref|NP_995095.1| BolA-like protein [Yersinia pestis biovar Microtus str. 91001]
 gi|108809724|ref|YP_653640.1| BolA-like protein [Yersinia pestis Antiqua]
 gi|108813612|ref|YP_649379.1| BolA-like protein [Yersinia pestis Nepal516]
 gi|145597643|ref|YP_001161719.1| BolA-like protein [Yersinia pestis Pestoides F]
 gi|153997345|ref|ZP_02022445.1| BolA-like protein [Yersinia pestis CA88-4125]
 gi|218930582|ref|YP_002348457.1| BolA-like protein [Yersinia pestis CO92]
 gi|21956808|gb|AAM83735.1|AE013614_9 hypothetical protein y0141 [Yersinia pestis KIM 10]
 gi|45438425|gb|AAS63972.1| BolA-like protein [Yersinia pestis biovar Microtus str. 91001]
 gi|108777260|gb|ABG19779.1| BolA-like protein [Yersinia pestis Nepal516]
 gi|108781637|gb|ABG15695.1| BolA-like protein [Yersinia pestis Antiqua]
 gi|115349193|emb|CAL22158.1| BolA-like protein [Yersinia pestis CO92]
 gi|145209339|gb|ABP38746.1| BolA-like protein [Yersinia pestis Pestoides F]
 gi|149288982|gb|EDM39062.1| BolA-like protein [Yersinia pestis CA88-4125]
          Length = 87

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVP 76
          + GDG+H+   ++ E F   NR+++ Q VY  L   +  N +HALSIK   P
Sbjct: 24 VTGDGSHFQVIVVGELFADMNRVKKQQAVYAPLMEYIADNRIHALSIKAYTP 75


>gi|170097107|ref|XP_001879773.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164645176|gb|EDR09424.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 82

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 40/64 (62%), Gaps = 2/64 (3%)

Query: 8  IEKMIKKGIPQSIVTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          +++ I+  +P S + I D + G G+ YA  I+SE F GK+ + +H+MV D L +++   +
Sbjct: 8  LDEAIRVALPVSHLDIEDQSNGCGDSYAIVIVSEAFNGKSTLARHRMVNDLLKDQIAQ-M 66

Query: 67 HALS 70
          HA S
Sbjct: 67 HAFS 70


>gi|329296780|ref|ZP_08254116.1| transcriptional regulator BolA [Plautia stali symbiont]
          Length = 104

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 41/74 (55%), Gaps = 7/74 (9%)

Query: 7  EIEKMIKKGIPQSIVTIHDL-------AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          +IE+ ++     + + +HD        AG  +H+   I+S+ F G+  +Q+H+ +Y  L 
Sbjct: 5  QIEEKLRNAFEPAHLEVHDESYRHNVPAGSESHFKVVIVSDLFTGQRFLQRHRAIYGELA 64

Query: 60 NKMGNALHALSIKT 73
           ++  ++HAL++ T
Sbjct: 65 TELAGSVHALALYT 78


>gi|170087054|ref|XP_001874750.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164649950|gb|EDR14191.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 109

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 9   EKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHA 68
           +K+I +  P  +  +    G G+ YA  I SE F G + I+QH++V ++L  ++   +H 
Sbjct: 38  DKLIARFAPSHLKVLDVSGGCGSFYAITIASESFNGLSTIKQHKLVTETLKQEI-EGIHG 96

Query: 69  LSIKT 73
           L IKT
Sbjct: 97  LQIKT 101


>gi|319943550|ref|ZP_08017832.1| regulator of penicillin binding proteins and beta lactamase
          transcription [Lautropia mirabilis ATCC 51599]
 gi|319743365|gb|EFV95770.1| regulator of penicillin binding proteins and beta lactamase
          transcription [Lautropia mirabilis ATCC 51599]
          Length = 88

 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 46/86 (53%), Gaps = 10/86 (11%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHD----------LAGDGNHYAAEIISEEFRGKNRIQQ 50
          M   P  + + +K+  P + +T+ D           AG   H+A  ++S  F G   +++
Sbjct: 1  MKPTPEALLQRLKQHFPDAHITVQDDSHHHRGHAGAAGGAGHFAVTLVSPVFAGLPTVRR 60

Query: 51 HQMVYDSLGNKMGNALHALSIKTSVP 76
          H++VYD++ + M + +HALSI+  VP
Sbjct: 61 HRLVYDAVADWMPHRIHALSIRAEVP 86


>gi|316931923|ref|YP_004106905.1| BolA family protein [Rhodopseudomonas palustris DX-1]
 gi|315599637|gb|ADU42172.1| BolA family protein [Rhodopseudomonas palustris DX-1]
          Length = 89

 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 28/46 (60%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+   I+S  F GK+R+ +H+M+ + L  ++   +HAL+IK   P
Sbjct: 41 THFRVNIVSAAFAGKSRLDRHRMINELLAAELTGGVHALAIKAKAP 86


>gi|119503283|ref|ZP_01625367.1| stress-induced morphogen [marine gamma proteobacterium HTCC2080]
 gi|119460929|gb|EAW42020.1| stress-induced morphogen [marine gamma proteobacterium HTCC2080]
          Length = 129

 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 29/50 (58%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           G   H+    +S+ F G  ++++HQ+VY+ L + +   +HAL++    PD
Sbjct: 61  GSETHFKVTAVSQSFNGLRKVRRHQLVYEVLKDLLAGPVHALALHLFTPD 110


>gi|121632100|ref|YP_001001462.1| hypothetical protein XOO4807 [Xanthomonas oryzae pv. oryzae
          KACC10331]
 gi|116247016|gb|ABJ89942.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
          KACC10331]
          Length = 118

 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 24 HDLAGDGN-HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          H  A DG  H+   ++S  F GK  + +H+ VY ++G  M   +HALSIK   P
Sbjct: 32 HAGARDGRGHFNVRVVSAAFVGKPLLARHRAVYAAVGEMMQTDIHALSIKAFAP 85


>gi|90416667|ref|ZP_01224597.1| activator of morphogenic pathway (BolA family), important in
          general stress response [marine gamma proteobacterium
          HTCC2207]
 gi|90331420|gb|EAS46656.1| activator of morphogenic pathway (BolA family), important in
          general stress response [marine gamma proteobacterium
          HTCC2207]
          Length = 106

 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG   H+   +++++F G+ ++Q+HQ +Y  L  ++   +HAL++ T
Sbjct: 34 AGSETHFKVVLVTDQFAGQRQVQRHQAIYKLLAEELSGPIHALALHT 80


>gi|325181627|emb|CCA16077.1| BolAlike protein putative [Albugo laibachii Nc14]
          Length = 110

 Score = 41.6 bits (96), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 33/49 (67%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G  +H+   +++E F GK+ +Q+H+M+ ++L  ++   +HALSI++  P
Sbjct: 37 GTESHFKVIVVAEVFEGKSLLQRHRMLNEALKEELVELVHALSIESKTP 85


>gi|326795419|ref|YP_004313239.1| BolA family protein [Marinomonas mediterranea MMB-1]
 gi|326546183|gb|ADZ91403.1| BolA family protein [Marinomonas mediterranea MMB-1]
          Length = 102

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 43/78 (55%), Gaps = 8/78 (10%)

Query: 7  EIEKMIKKGIPQSIVTI------HDL-AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          EI ++I++     ++ +      H++  G  +H+   ++S EF GK  +Q+HQM+Y +L 
Sbjct: 6  EIRQLIERTFDSEVLDLTNESYMHNVPEGSESHFKLTLVSNEFSGKRLVQRHQMIYGALT 65

Query: 60 NKMGNALHALSIKTSVPD 77
           +M   +HAL++     D
Sbjct: 66 EQM-QKIHALALHLYTTD 82


>gi|324553977|gb|ADY49791.1| BolA-like protein 3 [Ascaris suum]
          Length = 101

 Score = 41.6 bits (96), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 45/71 (63%), Gaps = 3/71 (4%)

Query: 8   IEKMIKKGIPQ-SIVTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
           I K+++K  P  + + + D++ G G+ Y   +  ++F+G  +++QH+MV D+L  ++  +
Sbjct: 31  ITKLLQKRFPNATTIDVMDVSSGCGSMYQIVVECDDFKGLPKVRQHRMVTDTLKEEIA-S 89

Query: 66  LHALSIKTSVP 76
           +H + ++TS P
Sbjct: 90  MHGVVVETSTP 100


>gi|294142113|ref|YP_003558091.1| bolA protein [Shewanella violacea DSS12]
 gi|293328582|dbj|BAJ03313.1| bolA protein [Shewanella violacea DSS12]
          Length = 99

 Score = 41.6 bits (96), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (60%)

Query: 32 HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          H+   I SE F GK  + +H+ V ++L ++  N LHALS+ T  P+
Sbjct: 38 HFKVIITSEAFEGKRLLGRHRSVNEALADEFANGLHALSMHTFTPE 83


>gi|302840150|ref|XP_002951631.1| cysteine desulfuration protein [Volvox carteri f. nagariensis]
 gi|300263240|gb|EFJ47442.1| cysteine desulfuration protein [Volvox carteri f. nagariensis]
          Length = 360

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 24  HDLAGDG--NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H  AG+    H+  E++SE F G  ++++ +M+Y  L  +    LHALS+ T  P
Sbjct: 295 HGKAGETGETHFRVEVVSEAFEGMTQVKRQRMIYQLLEEEFAMGLHALSLVTRTP 349


>gi|301096392|ref|XP_002897293.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gi|262107177|gb|EEY65229.1| conserved hypothetical protein [Phytophthora infestans T30-4]
          Length = 112

 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 39/58 (67%), Gaps = 2/58 (3%)

Query: 21  VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           V + D++G  G+ +  E+ S +F G++R++QH+MV + L  ++  ++H L+I+T  P+
Sbjct: 51  VKVTDVSGGCGSMFDVEVASPQFAGQSRVKQHRMVNEILKEEI-KSMHGLTIRTMTPE 107


>gi|255020944|ref|ZP_05293000.1| Cell division protein BolA [Acidithiobacillus caldus ATCC 51756]
 gi|254969735|gb|EET27241.1| Cell division protein BolA [Acidithiobacillus caldus ATCC 51756]
          Length = 101

 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 43/79 (54%), Gaps = 11/79 (13%)

Query: 8  IEKMIKKGIPQSIVTIHDL---------AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSL 58
          +EK +++ +   ++ + D          A +G HY   ++S  F G + + +H++VYD +
Sbjct: 6  LEKALREALTPELLEVRDRTEAHAGHSGASEGGHYELTVVSRRFEGLSALDRHRLVYD-V 64

Query: 59 GNKMGNALHALSIKTSVPD 77
            ++ + +HAL+I+   PD
Sbjct: 65 SARIPH-IHALAIRAWTPD 82


>gi|299529222|ref|ZP_07042667.1| BolA-like protein [Comamonas testosteroni S44]
 gi|298722845|gb|EFI63757.1| BolA-like protein [Comamonas testosteroni S44]
          Length = 88

 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 29/47 (61%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          +G G H+   I    F GK R+ +H++VYD+L + +   +HA++I+ 
Sbjct: 41 SGVGTHFRVRIAGPAFDGKTRVARHRLVYDALQDFIDQGVHAIAIEV 87


>gi|57525877|ref|NP_001003557.1| bolA-like protein 1 [Danio rerio]
 gi|50417366|gb|AAH77096.1| Zgc:101119 [Danio rerio]
          Length = 122

 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 31/49 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G  +H+   ++S +F G + +Q+H++V ++L  ++   +HALSI+   P
Sbjct: 40 GSESHFKVLVVSLQFEGLSLLQRHRLVNETLKEELSTCIHALSIQAKTP 88


>gi|194756514|ref|XP_001960522.1| GF19772 [Drosophila ananassae]
 gi|190621820|gb|EDV37344.1| GF19772 [Drosophila ananassae]
          Length = 91

 Score = 41.6 bits (96), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 41/67 (61%), Gaps = 2/67 (2%)

Query: 12 IKKGIPQSIVTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALS 70
          +K+ +    V + D + G G  ++A I+SE+F GK+ +++H++V  +L  ++   +HA S
Sbjct: 13 LKEQLNTQYVNVEDESDGCGAKFSATIVSEQFVGKSLLEKHRLVNKALAEELKE-IHAFS 71

Query: 71 IKTSVPD 77
           KT  P+
Sbjct: 72 QKTYTPE 78


>gi|152980402|ref|YP_001353235.1| BolA stress-induced morphogen [Janthinobacterium sp. Marseille]
 gi|151280479|gb|ABR88889.1| BolA stress-induced morphogen [Janthinobacterium sp. Marseille]
          Length = 89

 Score = 41.6 bits (96), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 27/44 (61%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          +   IIS +F  ++RI +H++VYD L + M   +HAL+I    P
Sbjct: 43 FRLRIISAQFEKQSRINRHRLVYDCLDDMMHKEIHALAITALAP 86


>gi|320538926|ref|ZP_08038602.1| putative DNA-binding transcriptional regulator [Serratia
          symbiotica str. Tucson]
 gi|320031086|gb|EFW13089.1| putative DNA-binding transcriptional regulator [Serratia
          symbiotica str. Tucson]
          Length = 94

 Score = 41.6 bits (96), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVPD 77
          + GDG+H+   ++ E F   +R+++ Q VY  L   +  N +HALSIK   P+
Sbjct: 31 VTGDGSHFQVIVVGELFAAMSRVKKQQTVYAPLMEYIADNRIHALSIKAYTPE 83


>gi|311280668|ref|YP_003942899.1| BolA family protein [Enterobacter cloacae SCF1]
 gi|308749863|gb|ADO49615.1| BolA family protein [Enterobacter cloacae SCF1]
          Length = 104

 Score = 41.6 bits (96), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+M+Y +L  ++   +HAL++ T
Sbjct: 32 AGSESHFKVVLVSDRFTGERFLNRHRMIYSTLTAELSTTVHALALHT 78


>gi|148555248|ref|YP_001262830.1| transcriptional regulator BolA [Sphingomonas wittichii RW1]
 gi|148500438|gb|ABQ68692.1| transcriptional regulator BolA [Sphingomonas wittichii RW1]
          Length = 102

 Score = 41.2 bits (95), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 24  HDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           HD +G+ +H+  EI S  F G+NR+ + + V  +LG+ +   +HAL+I+   P
Sbjct: 49  HDGSGE-SHFTVEIESPAFAGQNRVARQRAVNAALGDLLRERVHALAIRARAP 100


>gi|238756119|ref|ZP_04617440.1| hypothetical protein yruck0001_2740 [Yersinia ruckeri ATCC 29473]
 gi|238705658|gb|EEP98054.1| hypothetical protein yruck0001_2740 [Yersinia ruckeri ATCC 29473]
          Length = 84

 Score = 41.2 bits (95), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EI+ ++ + +    V +    GDG+H+    + E F   +R+++ Q VY  L   +
Sbjct: 1  METTEIKDVLMRALALDEVQV---TGDGSHFQVIAVGELFTEMSRVKKQQTVYAPLMEYI 57

Query: 63 G-NALHALSIKTSVP 76
            N +HALSIKT  P
Sbjct: 58 ADNRIHALSIKTYTP 72


>gi|302830290|ref|XP_002946711.1| bola-like protein [Volvox carteri f. nagariensis]
 gi|300267755|gb|EFJ51937.1| bola-like protein [Volvox carteri f. nagariensis]
          Length = 89

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+  E+ SE F G   +++HQ++Y  L ++    LHALS+ T  P
Sbjct: 39 THFRLEVTSEAFGGVPLVKRHQLIYGLLADEFKAGLHALSMTTKTP 84


>gi|269104099|ref|ZP_06156796.1| protein yrbA [Photobacterium damselae subsp. damselae CIP 102761]
 gi|268163997|gb|EEZ42493.1| protein yrbA [Photobacterium damselae subsp. damselae CIP 102761]
          Length = 84

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSL-GNKMGNALHALSIKTSVP 76
          G+G+HY    +   F G +R+++ Q +Y  L G+   N +HALSIKT  P
Sbjct: 23 GEGSHYEVIAVGAIFDGMSRVKKQQTIYGPLMGHIAANDIHALSIKTFTP 72


>gi|253998627|ref|YP_003050690.1| BolA family protein [Methylovorus sp. SIP3-4]
 gi|253985306|gb|ACT50163.1| BolA family protein [Methylovorus sp. SIP3-4]
          Length = 88

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 29/41 (70%)

Query: 37 IISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          ++S +F GK+ I +H++VY +L + + + +HALSI+   PD
Sbjct: 44 VVSSQFSGKSPIIRHRIVYQALADLIPSKIHALSIRALAPD 84


>gi|160898740|ref|YP_001564322.1| BolA family protein [Delftia acidovorans SPH-1]
 gi|160364324|gb|ABX35937.1| BolA family protein [Delftia acidovorans SPH-1]
          Length = 93

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G G H+   I S  F+GK R+ +H++VYD+L   +    HA++I+ 
Sbjct: 47 GFGTHFRVRIASPLFQGKPRVARHRLVYDALQEFIDQGAHAIAIEV 92


>gi|291615990|ref|YP_003518732.1| YrbA [Pantoea ananatis LMG 20103]
 gi|291151020|gb|ADD75604.1| YrbA [Pantoea ananatis LMG 20103]
 gi|327396242|dbj|BAK13664.1| protein YrbA [Pantoea ananatis AJ13355]
          Length = 90

 Score = 41.2 bits (95), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 3/76 (3%)

Query: 2  SMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNK 61
          +M   EI+ ++   +P  +  +H ++ DG+H+    + E F   +R+++ Q VY  L   
Sbjct: 5  AMENSEIQAVLMAALP--LDEVHVMSNDGSHFQVIAVGELFGELSRVKKQQAVYAPLMEF 62

Query: 62 MG-NALHALSIKTSVP 76
          +  N +HA+SIKT  P
Sbjct: 63 IADNRIHAVSIKTYTP 78


>gi|238879540|gb|EEQ43178.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 89

 Score = 41.2 bits (95), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 45/77 (58%), Gaps = 2/77 (2%)

Query: 2  SMNPHEIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          ++    +  +I   +  ++V + D++G  G  +A  I+S  F+GKN++ +H++V + L +
Sbjct: 5  ALTADSLRDIITTRLNANLVQVEDMSGGCGQAFAVIIVSSLFQGKNKLARHRLVNNELKD 64

Query: 61 KMGNALHALSIKTSVPD 77
          ++  ++HA + K   PD
Sbjct: 65 EIA-SIHAFTQKGFTPD 80


>gi|237730412|ref|ZP_04560893.1| BolA protein [Citrobacter sp. 30_2]
 gi|226905951|gb|EEH91869.1| BolA protein [Citrobacter sp. 30_2]
          Length = 116

 Score = 41.2 bits (95), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+M+Y +L  ++   +HAL++ T
Sbjct: 44 AGSESHFKVVLVSDRFTGERFLNRHRMIYSTLTAELSTTVHALALHT 90


>gi|156057955|ref|XP_001594901.1| hypothetical protein SS1G_04709 [Sclerotinia sclerotiorum 1980]
 gi|154702494|gb|EDO02233.1| hypothetical protein SS1G_04709 [Sclerotinia sclerotiorum 1980
          UF-70]
          Length = 115

 Score = 41.2 bits (95), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA--LHALSIKTSVPD 77
           H+  E+ SE F  K +  +H+MVY  L  +M  A  +HAL +KT  PD
Sbjct: 47 THFRVEVTSEAFAKKMQPARHRMVYALLKEEMAKAGGIHALQLKTRTPD 95


>gi|103486140|ref|YP_615701.1| BolA-like protein [Sphingopyxis alaskensis RB2256]
 gi|98976217|gb|ABF52368.1| transcriptional regulator BolA [Sphingopyxis alaskensis RB2256]
          Length = 96

 Score = 41.2 bits (95), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 11/81 (13%)

Query: 7  EIEKMIKKGIPQSIVTI-------HDLAGDG----NHYAAEIISEEFRGKNRIQQHQMVY 55
          E+E ++    P +  T+       H   GD     +H++  I    F G NR+ + +MV 
Sbjct: 14 EMESLLAAAFPDASFTVSNDSAKHHGHVGDDGSGESHFSLSIEWAGFAGMNRVMRQRMVN 73

Query: 56 DSLGNKMGNALHALSIKTSVP 76
           +LG+  G  +HAL+I+ + P
Sbjct: 74 KALGDLPGQRVHALAIRATAP 94


>gi|313200701|ref|YP_004039359.1| bola family protein [Methylovorus sp. MP688]
 gi|312440017|gb|ADQ84123.1| BolA family protein [Methylovorus sp. MP688]
          Length = 88

 Score = 41.2 bits (95), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 29/41 (70%)

Query: 37 IISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          ++S +F GK+ I +H++VY +L + + + +HALSI+   PD
Sbjct: 44 VVSSQFSGKSPIIRHRIVYQALADLIPSRIHALSIRALAPD 84


>gi|218512378|ref|ZP_03509218.1| BolA family protein [Rhizobium etli 8C-3]
          Length = 94

 Score = 41.2 bits (95), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 11/87 (12%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIH----------DLAGDG-NHYAAEIISEEFRGKNRIQ 49
          M++     EK++    P+ +  I           D+ G G  H    I+S EF G +R+ 
Sbjct: 2  MTLRTRIEEKLVAAFAPERLSVIDESHLHAGHQPDITGTGETHMRVRIVSAEFAGLSRLA 61

Query: 50 QHQMVYDSLGNKMGNALHALSIKTSVP 76
          +H+ + D L  ++   LHAL+++ + P
Sbjct: 62 RHRAITDLLKPELDAGLHALAVEPAAP 88


>gi|188576658|ref|YP_001913587.1| morphogene BolA protein [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188521110|gb|ACD59055.1| morphogene BolA protein [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 107

 Score = 41.2 bits (95), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 24 HDLAGDGN-HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          H  A DG  H+   ++S  F GK  + +H+ VY ++G  M   +HALSIK   P
Sbjct: 32 HAGARDGRGHFNVRVVSAAFVGKPLLARHRAVYAAVGEMMQTDIHALSIKAFAP 85


>gi|148559370|ref|YP_001259838.1| bolA protein [Brucella ovis ATCC 25840]
 gi|306843453|ref|ZP_07476054.1| bolA protein [Brucella sp. BO1]
 gi|148370627|gb|ABQ60606.1| bolA protein [Brucella ovis ATCC 25840]
 gi|306276144|gb|EFM57844.1| bolA protein [Brucella sp. BO1]
          Length = 104

 Score = 41.2 bits (95), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 35/53 (66%), Gaps = 1/53 (1%)

Query: 24 HDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          +D AG+  H+   I++E F G +R+Q+H+ + D L  ++ + +HAL+++ S P
Sbjct: 47 YDGAGE-THFRIRIVAEAFTGMSRVQRHRAINDLLKEELESGVHALALEPSAP 98


>gi|114799844|ref|YP_758818.1| BolA family protein [Hyphomonas neptunium ATCC 15444]
 gi|114740018|gb|ABI78143.1| BolA family protein [Hyphomonas neptunium ATCC 15444]
          Length = 93

 Score = 41.2 bits (95), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDS 78
          G   HY+ EI++E F G +R+Q  + V   L  +  + LHAL++K   P++
Sbjct: 42 GGETHYSVEIVAEAFTGLSRVQVQRAVMMVLQQEFDSGLHALTLKARPPEA 92


>gi|71276223|ref|ZP_00652502.1| BolA-like protein [Xylella fastidiosa Dixon]
 gi|71898738|ref|ZP_00680907.1| BolA-like protein [Xylella fastidiosa Ann-1]
 gi|71162984|gb|EAO12707.1| BolA-like protein [Xylella fastidiosa Dixon]
 gi|71731503|gb|EAO33565.1| BolA-like protein [Xylella fastidiosa Ann-1]
          Length = 189

 Score = 41.2 bits (95), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 24  HDLAGDG-NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
           H  A DG  H++  I++  F GK  + +H+ VY +LG+ M   +HALSI+  V + +
Sbjct: 131 HPGARDGRGHFSVLIVTPMFAGKTLLARHRAVYAALGSMMKTDIHALSIQALVDEGE 187


>gi|78707212|ref|NP_001027413.1| CG33672 [Drosophila melanogaster]
 gi|195333838|ref|XP_002033593.1| GM20347 [Drosophila sechellia]
 gi|195485261|ref|XP_002091018.1| GE13434 [Drosophila yakuba]
 gi|195582825|ref|XP_002081226.1| GD25826 [Drosophila simulans]
 gi|21627325|gb|AAM68636.1| CG33672 [Drosophila melanogaster]
 gi|194125563|gb|EDW47606.1| GM20347 [Drosophila sechellia]
 gi|194177119|gb|EDW90730.1| GE13434 [Drosophila yakuba]
 gi|194193235|gb|EDX06811.1| GD25826 [Drosophila simulans]
 gi|324096536|gb|ADY17798.1| MIP03836p [Drosophila melanogaster]
          Length = 86

 Score = 41.2 bits (95), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          +E+ +K+ +    V++ D + G G  ++A I+S  F GK  +Q+H++V  +L  ++   +
Sbjct: 9  LEEKLKRELQTEYVSVTDESDGCGGKFSAVIVSPAFSGKTLLQKHRLVNSTLAEEL-KEI 67

Query: 67 HALSIKTSVPD 77
          HA S K+  P+
Sbjct: 68 HAFSQKSYTPE 78


>gi|84623691|ref|YP_451063.1| hypothetical protein XOO_2034 [Xanthomonas oryzae pv. oryzae MAFF
          311018]
 gi|84367631|dbj|BAE68789.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
          MAFF 311018]
          Length = 106

 Score = 41.2 bits (95), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 24 HDLAGDGN-HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          H  A DG  H+   ++S  F GK  + +H+ VY ++G  M   +HALSIK   P
Sbjct: 32 HAGARDGRGHFNVRVVSAAFVGKPPLARHRAVYAAVGEMMHTDIHALSIKAFAP 85


>gi|188582668|ref|YP_001926113.1| BolA family protein [Methylobacterium populi BJ001]
 gi|179346166|gb|ACB81578.1| BolA family protein [Methylobacterium populi BJ001]
          Length = 92

 Score = 41.2 bits (95), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 28/46 (60%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+  +++S  F GK+R+++H++V   L +     LHAL+++   P
Sbjct: 43 THFRLDVVSAAFEGKSRVERHRLVNGLLDDAFKRGLHALAVRARTP 88


>gi|310797945|gb|EFQ32838.1| BolA-like protein [Glomerella graminicola M1.001]
          Length = 163

 Score = 41.2 bits (95), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 41/69 (59%), Gaps = 3/69 (4%)

Query: 9   EKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALH 67
           +K++ +  P  ++ + D++G  G+ YA +I S +F+G N ++Q +MV   LG+ M    H
Sbjct: 97  DKLVAEFAPSELI-VQDVSGGCGSMYAIDITSAKFKGANMLRQQRMVNAVLGDMMKE-WH 154

Query: 68  ALSIKTSVP 76
            + ++T  P
Sbjct: 155 GVQLRTKAP 163


>gi|331664803|ref|ZP_08365708.1| putative transcriptional regulator (BolA family) [Escherichia
          coli TA143]
 gi|331058051|gb|EGI30033.1| putative transcriptional regulator (BolA family) [Escherichia
          coli TA143]
          Length = 89

 Score = 41.2 bits (95), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M  +EI+ ++   +  S+  +H ++GDG+H+    + E F G +R+++ Q VY  L   +
Sbjct: 6  MENNEIQSVLMSAL--SLQEVH-VSGDGSHFQVIAVGELFDGMSRVKKQQTVYGPLMEYI 62

Query: 63 G-NALHALSIKTSVP 76
            N +HA+SIK   P
Sbjct: 63 ADNRIHAVSIKAYTP 77


>gi|157962922|ref|YP_001502956.1| BolA family protein [Shewanella pealeana ATCC 700345]
 gi|157847922|gb|ABV88421.1| BolA family protein [Shewanella pealeana ATCC 700345]
          Length = 99

 Score = 41.2 bits (95), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           H+   I S EF G+  I +H+ V ++L  +  N LHALS+ T  P+
Sbjct: 37 THFKVIITSSEFEGQRLIGRHRAVNEALAEEFANGLHALSMHTYTPE 83


>gi|270263235|ref|ZP_06191505.1| hypothetical protein SOD_d02520 [Serratia odorifera 4Rx13]
 gi|270042923|gb|EFA16017.1| hypothetical protein SOD_d02520 [Serratia odorifera 4Rx13]
          Length = 84

 Score = 41.2 bits (95), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVPD 77
          + GDG+H+   ++ E F   +R+++ Q VY  L   +  N +HALSIK   P+
Sbjct: 21 VTGDGSHFQVIVVGELFAAMSRVKKQQTVYAPLMEYIADNRIHALSIKAYTPE 73


>gi|240948322|ref|ZP_04752708.1| putative transcriptional regulator [Actinobacillus minor NM305]
 gi|240297361|gb|EER47902.1| putative transcriptional regulator [Actinobacillus minor NM305]
          Length = 103

 Score = 41.2 bits (95), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   I+S  F GK  + +HQ +Y  L +++   +HAL++ T
Sbjct: 34 GAESHFKVTIVSPAFEGKRSVARHQAIYQCLADELAQGVHALALHT 79


>gi|23502874|ref|NP_699001.1| bolA protein [Brucella suis 1330]
 gi|161619942|ref|YP_001593829.1| hypothetical protein BCAN_A2072 [Brucella canis ATCC 23365]
 gi|163844046|ref|YP_001628450.1| hypothetical protein BSUIS_A1867 [Brucella suis ATCC 23445]
 gi|225626408|ref|ZP_03784447.1| bolA-like protein [Brucella ceti str. Cudo]
 gi|254694651|ref|ZP_05156479.1| hypothetical protein Babob3T_08328 [Brucella abortus bv. 3 str.
          Tulya]
 gi|254700660|ref|ZP_05162488.1| hypothetical protein Bsuib55_07363 [Brucella suis bv. 5 str. 513]
 gi|254705030|ref|ZP_05166858.1| hypothetical protein Bsuib36_14139 [Brucella suis bv. 3 str. 686]
 gi|254707452|ref|ZP_05169280.1| hypothetical protein BpinM_10897 [Brucella pinnipedialis
          M163/99/10]
 gi|254709006|ref|ZP_05170817.1| hypothetical protein BpinB_01832 [Brucella pinnipedialis B2/94]
 gi|254713567|ref|ZP_05175378.1| hypothetical protein BcetM6_09474 [Brucella ceti M644/93/1]
 gi|254716078|ref|ZP_05177889.1| hypothetical protein BcetM_06531 [Brucella ceti M13/05/1]
 gi|256030531|ref|ZP_05444145.1| hypothetical protein BpinM2_07757 [Brucella pinnipedialis
          M292/94/1]
 gi|256045627|ref|ZP_05448505.1| hypothetical protein Bmelb1R_14075 [Brucella melitensis bv. 1
          str. Rev.1]
 gi|256059994|ref|ZP_05450176.1| hypothetical protein Bneo5_06516 [Brucella neotomae 5K33]
 gi|256112351|ref|ZP_05453272.1| hypothetical protein Bmelb3E_06656 [Brucella melitensis bv. 3
          str. Ether]
 gi|256158523|ref|ZP_05456417.1| hypothetical protein BcetM4_06674 [Brucella ceti M490/95/1]
 gi|256253937|ref|ZP_05459473.1| hypothetical protein BcetB_06511 [Brucella ceti B1/94]
 gi|260169437|ref|ZP_05756248.1| hypothetical protein BruF5_13989 [Brucella sp. F5/99]
 gi|260562931|ref|ZP_05833417.1| basic helix-loop-helix dimerization domain bHLH [Brucella
          melitensis bv. 1 str. 16M]
 gi|260567502|ref|ZP_05837972.1| basic helix-loop-helix dimerization domain bHLH [Brucella suis
          bv. 4 str. 40]
 gi|261214974|ref|ZP_05929255.1| BolA family protein [Brucella abortus bv. 3 str. Tulya]
 gi|261217846|ref|ZP_05932127.1| BolA family protein [Brucella ceti M13/05/1]
 gi|261221076|ref|ZP_05935357.1| BolA family protein [Brucella ceti B1/94]
 gi|261314939|ref|ZP_05954136.1| conserved hypothetical protein [Brucella pinnipedialis
          M163/99/10]
 gi|261316504|ref|ZP_05955701.1| BolA family protein [Brucella pinnipedialis B2/94]
 gi|261321304|ref|ZP_05960501.1| BolA family protein [Brucella ceti M644/93/1]
 gi|261323967|ref|ZP_05963164.1| BolA family protein [Brucella neotomae 5K33]
 gi|261751168|ref|ZP_05994877.1| BolA family protein [Brucella suis bv. 5 str. 513]
 gi|261755731|ref|ZP_05999440.1| BolA family protein [Brucella suis bv. 3 str. 686]
 gi|261758962|ref|ZP_06002671.1| basic helix-loop-helix dimerization domain bHLH protein [Brucella
          sp. F5/99]
 gi|265987577|ref|ZP_06100134.1| BolA family protein [Brucella pinnipedialis M292/94/1]
 gi|265992049|ref|ZP_06104606.1| BolA family protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993785|ref|ZP_06106342.1| BolA family protein [Brucella melitensis bv. 3 str. Ether]
 gi|265997036|ref|ZP_06109593.1| BolA family protein [Brucella ceti M490/95/1]
 gi|294851257|ref|ZP_06791930.1| BolA protein [Brucella sp. NVSL 07-0026]
 gi|23348903|gb|AAN30916.1| bolA protein [Brucella suis 1330]
 gi|161336753|gb|ABX63058.1| hypothetical protein BCAN_A2072 [Brucella canis ATCC 23365]
 gi|163674769|gb|ABY38880.1| hypothetical protein BSUIS_A1867 [Brucella suis ATCC 23445]
 gi|225618065|gb|EEH15108.1| bolA-like protein [Brucella ceti str. Cudo]
 gi|260152947|gb|EEW88039.1| basic helix-loop-helix dimerization domain bHLH [Brucella
          melitensis bv. 1 str. 16M]
 gi|260157020|gb|EEW92100.1| basic helix-loop-helix dimerization domain bHLH [Brucella suis
          bv. 4 str. 40]
 gi|260916581|gb|EEX83442.1| BolA family protein [Brucella abortus bv. 3 str. Tulya]
 gi|260919660|gb|EEX86313.1| BolA family protein [Brucella ceti B1/94]
 gi|260922935|gb|EEX89503.1| BolA family protein [Brucella ceti M13/05/1]
 gi|261293994|gb|EEX97490.1| BolA family protein [Brucella ceti M644/93/1]
 gi|261295727|gb|EEX99223.1| BolA family protein [Brucella pinnipedialis B2/94]
 gi|261299947|gb|EEY03444.1| BolA family protein [Brucella neotomae 5K33]
 gi|261303965|gb|EEY07462.1| conserved hypothetical protein [Brucella pinnipedialis
          M163/99/10]
 gi|261738946|gb|EEY26942.1| basic helix-loop-helix dimerization domain bHLH protein [Brucella
          sp. F5/99]
 gi|261740921|gb|EEY28847.1| BolA family protein [Brucella suis bv. 5 str. 513]
 gi|261745484|gb|EEY33410.1| BolA family protein [Brucella suis bv. 3 str. 686]
 gi|262551504|gb|EEZ07494.1| BolA family protein [Brucella ceti M490/95/1]
 gi|262764766|gb|EEZ10687.1| BolA family protein [Brucella melitensis bv. 3 str. Ether]
 gi|263003115|gb|EEZ15408.1| BolA family protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|264659774|gb|EEZ30035.1| BolA family protein [Brucella pinnipedialis M292/94/1]
 gi|294819846|gb|EFG36845.1| BolA protein [Brucella sp. NVSL 07-0026]
          Length = 104

 Score = 41.2 bits (95), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 35/54 (64%), Gaps = 1/54 (1%)

Query: 23 IHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           +D AG+  H+   I++E F G +R+Q+H+ + D L  ++ + +HAL+++ S P
Sbjct: 46 TYDGAGE-THFRIRIVAEAFTGMSRVQRHRAINDLLKEELESGVHALALEPSAP 98


>gi|145631284|ref|ZP_01787056.1| phosphatidylserine decarboxylase [Haemophilus influenzae R3021]
 gi|144983069|gb|EDJ90569.1| phosphatidylserine decarboxylase [Haemophilus influenzae R3021]
          Length = 103

 Score = 41.2 bits (95), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 32/54 (59%)

Query: 24 HDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          H   G  +H+   I+S +F+   ++Q+HQ +Y  L  ++ +++HAL++    P+
Sbjct: 30 HSNRGSESHFKCVIVSADFKNIRKVQRHQRIYQLLNEELNHSIHALALHLFTPE 83


>gi|62290871|ref|YP_222664.1| BolA protein [Brucella abortus bv. 1 str. 9-941]
 gi|82700783|ref|YP_415357.1| basic helix-loop-helix dimerization domain-containing protein
          [Brucella melitensis biovar Abortus 2308]
 gi|189025086|ref|YP_001935854.1| Basic helix-loop-helix dimerization domain bHLH [Brucella abortus
          S19]
 gi|237816379|ref|ZP_04595372.1| BolA-like protein [Brucella abortus str. 2308 A]
 gi|254690160|ref|ZP_05153414.1| Basic helix-loop-helix dimerization domain bHLH [Brucella abortus
          bv. 6 str. 870]
 gi|254696276|ref|ZP_05158104.1| Basic helix-loop-helix dimerization domain bHLH [Brucella abortus
          bv. 2 str. 86/8/59]
 gi|254731193|ref|ZP_05189771.1| Basic helix-loop-helix dimerization domain bHLH [Brucella abortus
          bv. 4 str. 292]
 gi|256258414|ref|ZP_05463950.1| Basic helix-loop-helix dimerization domain bHLH [Brucella abortus
          bv. 9 str. C68]
 gi|260546133|ref|ZP_05821873.1| basic helix-loop-helix dimerization domain bHLH [Brucella abortus
          NCTC 8038]
 gi|260755699|ref|ZP_05868047.1| BolA family protein [Brucella abortus bv. 6 str. 870]
 gi|260758924|ref|ZP_05871272.1| BolA family protein [Brucella abortus bv. 4 str. 292]
 gi|260760646|ref|ZP_05872989.1| BolA family protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884725|ref|ZP_05896339.1| BolA family protein [Brucella abortus bv. 9 str. C68]
 gi|297247255|ref|ZP_06930973.1| BolA protein [Brucella abortus bv. 5 str. B3196]
 gi|62197003|gb|AAX75303.1| BolA, bolA protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616884|emb|CAJ11983.1| Basic helix-loop-helix dimerization domain bHLH:BolA-like protein
          [Brucella melitensis biovar Abortus 2308]
 gi|189020658|gb|ACD73380.1| Basic helix-loop-helix dimerization domain bHLH [Brucella abortus
          S19]
 gi|237788446|gb|EEP62661.1| BolA-like protein [Brucella abortus str. 2308 A]
 gi|260096240|gb|EEW80116.1| basic helix-loop-helix dimerization domain bHLH [Brucella abortus
          NCTC 8038]
 gi|260669242|gb|EEX56182.1| BolA family protein [Brucella abortus bv. 4 str. 292]
 gi|260671078|gb|EEX57899.1| BolA family protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675807|gb|EEX62628.1| BolA family protein [Brucella abortus bv. 6 str. 870]
 gi|260874253|gb|EEX81322.1| BolA family protein [Brucella abortus bv. 9 str. C68]
 gi|297174424|gb|EFH33771.1| BolA protein [Brucella abortus bv. 5 str. B3196]
          Length = 104

 Score = 41.2 bits (95), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 35/54 (64%), Gaps = 1/54 (1%)

Query: 23 IHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           +D AG+  H+   I++E F G +R+Q+H+ + D L  ++ + +HAL+++ S P
Sbjct: 46 TYDGAGE-THFRIRIVAEAFTGMSRVQRHRAINDLLKEELESGVHALALEPSAP 98


>gi|237799006|ref|ZP_04587467.1| bolA protein [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331021860|gb|EGI01917.1| bolA protein [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 97

 Score = 41.2 bits (95), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 30/47 (63%), Gaps = 1/47 (2%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           H    ++S++F G +++++HQ VY +LG  MG   HAL++ T  P+
Sbjct: 34 EHLLTVLVSDQFEGLSQVKRHQKVYATLGALMGE-FHALALHTYTPE 79


>gi|157372588|ref|YP_001480577.1| BolA family protein [Serratia proteamaculans 568]
 gi|157324352|gb|ABV43449.1| BolA family protein [Serratia proteamaculans 568]
          Length = 84

 Score = 41.2 bits (95), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVPD 77
          + GDG+H+   ++ E F   +R+++ Q VY  L   +  N +HALSIK   P+
Sbjct: 21 VTGDGSHFQVIVVGELFAAMSRVKKQQTVYAPLMEYIADNRIHALSIKAYTPE 73


>gi|265983022|ref|ZP_06095757.1| BolA family protein [Brucella sp. 83/13]
 gi|264661614|gb|EEZ31875.1| BolA family protein [Brucella sp. 83/13]
          Length = 102

 Score = 41.2 bits (95), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 35/54 (64%), Gaps = 1/54 (1%)

Query: 23 IHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           +D AG+  H+   I++E F G +R+Q+H+ + D L  ++ + +HAL+++ S P
Sbjct: 36 TYDGAGE-THFRIRIVAEAFTGMSRVQRHRAINDLLKEELESGVHALALEPSAP 88


>gi|260767866|ref|ZP_05876801.1| cell division protein BolA [Vibrio furnissii CIP 102972]
 gi|260617375|gb|EEX42559.1| cell division protein BolA [Vibrio furnissii CIP 102972]
 gi|315179303|gb|ADT86217.1| cell division protein BolA [Vibrio furnissii NCTC 11218]
          Length = 102

 Score = 41.2 bits (95), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 23 IHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          +H++A G  +H+   ++SE F G+  I +H++V  +L  ++ N +HAL+I T  P
Sbjct: 27 MHNVAPGSESHFKVIVVSERFVGQRLIARHRLVNQALMEELSNHIHALAIHTYTP 81


>gi|261341036|ref|ZP_05968894.1| BolA protein [Enterobacter cancerogenus ATCC 35316]
 gi|288316901|gb|EFC55839.1| BolA protein [Enterobacter cancerogenus ATCC 35316]
          Length = 105

 Score = 41.2 bits (95), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 31/47 (65%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+++Y +L +++   +HAL++ T
Sbjct: 33 AGSESHFKVVLVSDRFTGERFLNRHRLIYSTLTDELSTTVHALALHT 79


>gi|145637325|ref|ZP_01792985.1| phosphatidylserine decarboxylase [Haemophilus influenzae PittHH]
 gi|145269417|gb|EDK09360.1| phosphatidylserine decarboxylase [Haemophilus influenzae PittHH]
          Length = 97

 Score = 41.2 bits (95), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 32/54 (59%)

Query: 24 HDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          H   G  +H+   I+S +F+   ++Q+HQ +Y  L  ++ +++HAL++    P+
Sbjct: 24 HSNRGSESHFKCVIVSADFKNIRKVQRHQRIYQLLNEELNHSIHALALHLFTPE 77


>gi|126207723|ref|YP_001052948.1| stress-induced morphogen (activity unknown) [Actinobacillus
          pleuropneumoniae L20]
 gi|190149506|ref|YP_001968031.1| stress-induced morphogen (activity unknown) [Actinobacillus
          pleuropneumoniae serovar 7 str. AP76]
 gi|303251643|ref|ZP_07337816.1| stress-induced morphogen [Actinobacillus pleuropneumoniae serovar
          6 str. Femo]
 gi|307245048|ref|ZP_07527142.1| Transcriptional regulator BolA [Actinobacillus pleuropneumoniae
          serovar 1 str. 4074]
 gi|307249448|ref|ZP_07531437.1| Transcriptional regulator BolA [Actinobacillus pleuropneumoniae
          serovar 4 str. M62]
 gi|307251765|ref|ZP_07533668.1| Transcriptional regulator BolA [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|307254002|ref|ZP_07535850.1| Transcriptional regulator BolA [Actinobacillus pleuropneumoniae
          serovar 9 str. CVJ13261]
 gi|307256263|ref|ZP_07538047.1| Transcriptional regulator BolA [Actinobacillus pleuropneumoniae
          serovar 10 str. D13039]
 gi|307258457|ref|ZP_07540195.1| Transcriptional regulator BolA [Actinobacillus pleuropneumoniae
          serovar 11 str. 56153]
 gi|307260692|ref|ZP_07542382.1| Transcriptional regulator BolA [Actinobacillus pleuropneumoniae
          serovar 12 str. 1096]
 gi|307262825|ref|ZP_07544450.1| Transcriptional regulator BolA [Actinobacillus pleuropneumoniae
          serovar 13 str. N273]
 gi|126096515|gb|ABN73343.1| stress-induced morphogen (activity unknown) [Actinobacillus
          pleuropneumoniae serovar 5b str. L20]
 gi|189914637|gb|ACE60889.1| stress-induced morphogen (activity unknown) [Actinobacillus
          pleuropneumoniae serovar 7 str. AP76]
 gi|302649485|gb|EFL79668.1| stress-induced morphogen [Actinobacillus pleuropneumoniae serovar
          6 str. Femo]
 gi|306854036|gb|EFM86247.1| Transcriptional regulator BolA [Actinobacillus pleuropneumoniae
          serovar 1 str. 4074]
 gi|306858522|gb|EFM90589.1| Transcriptional regulator BolA [Actinobacillus pleuropneumoniae
          serovar 4 str. M62]
 gi|306860766|gb|EFM92776.1| Transcriptional regulator BolA [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|306863028|gb|EFM94974.1| Transcriptional regulator BolA [Actinobacillus pleuropneumoniae
          serovar 9 str. CVJ13261]
 gi|306865227|gb|EFM97126.1| Transcriptional regulator BolA [Actinobacillus pleuropneumoniae
          serovar 10 str. D13039]
 gi|306867462|gb|EFM99312.1| Transcriptional regulator BolA [Actinobacillus pleuropneumoniae
          serovar 11 str. 56153]
 gi|306869613|gb|EFN01400.1| Transcriptional regulator BolA [Actinobacillus pleuropneumoniae
          serovar 12 str. 1096]
 gi|306871840|gb|EFN03559.1| Transcriptional regulator BolA [Actinobacillus pleuropneumoniae
          serovar 13 str. N273]
          Length = 103

 Score = 41.2 bits (95), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G  +H+   ++SE F G   +  H+ +Y  L +++ N +HAL++ T  P
Sbjct: 34 GAESHFKVTLVSETFEGIRTVACHRAIYTCLADELENGVHALALHTYTP 82


>gi|219871129|ref|YP_002475504.1| stress-induced morphogen [Haemophilus parasuis SH0165]
 gi|219691333|gb|ACL32556.1| stress-induced morphogen [Haemophilus parasuis SH0165]
          Length = 103

 Score = 41.2 bits (95), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G  +H+   +ISE F  K  +  HQ VY  L  ++ N +HAL++    P 
Sbjct: 34 GSESHFKVTMISELFENKRPVACHQAVYTCLAEELANGVHALALHLYTPT 83


>gi|54308015|ref|YP_129035.1| putative cell division protein BolA [Photobacterium profundum
          SS9]
 gi|46912441|emb|CAG19233.1| putative cell division protein BolA [Photobacterium profundum
          SS9]
          Length = 102

 Score = 41.2 bits (95), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 30/50 (60%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G  +H+   ++SE+F G   I +H+ V  +L +++ N +HAL+I T  P 
Sbjct: 33 GSESHFKVIVVSEQFEGARLIGRHRAVNSALAHELANDIHALAIHTYTPS 82


>gi|224056857|ref|XP_002299058.1| predicted protein [Populus trichocarpa]
 gi|222846316|gb|EEE83863.1| predicted protein [Populus trichocarpa]
          Length = 310

 Score = 41.2 bits (95), Expect = 0.052,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 33/46 (71%)

Query: 32  HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           H+  +++S+EF GK+ +++H+++Y+ L +++ + LHALSI     D
Sbjct: 260 HFNVKVVSKEFDGKSLVKRHRLIYNLLQDELQSGLHALSIVAKTLD 305


>gi|115522168|ref|YP_779079.1| morphology/transcription regulator BolA family protein
          [Rhodopseudomonas palustris BisA53]
 gi|115516115|gb|ABJ04099.1| transcriptional regulator BolA [Rhodopseudomonas palustris
          BisA53]
          Length = 90

 Score = 41.2 bits (95), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 29/45 (64%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIK 72
          G   H+   I+S+ F GK+R+++H+M+   L ++    LHAL+IK
Sbjct: 38 GGETHFRINIVSQAFDGKSRVERHRMINALLADEFAGKLHALAIK 82


>gi|261253766|ref|ZP_05946339.1| cell division protein BolA [Vibrio orientalis CIP 102891]
 gi|260937157|gb|EEX93146.1| cell division protein BolA [Vibrio orientalis CIP 102891]
          Length = 102

 Score = 41.2 bits (95), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   I+SE+F G+  I +H+ V   L +++ N +HALS+ T
Sbjct: 32 AGSESHFKVVIVSEQFEGQRLIGRHRQVNQVLADELANHIHALSMHT 78


>gi|237730110|ref|ZP_04560591.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226908716|gb|EEH94634.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 97

 Score = 41.2 bits (95), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M  +EI+ ++   +  S+  +H ++GDG+H+    + E F G +R+++ Q VY  L   +
Sbjct: 14 MENNEIQSVLMNAL--SLQEVH-VSGDGSHFQVIAVGEMFEGMSRVKKQQSVYGPLMEYI 70

Query: 63 G-NALHALSIKTSVP 76
            N +HA+SIK   P
Sbjct: 71 ADNRIHAVSIKAFTP 85


>gi|194883576|ref|XP_001975877.1| GG22564 [Drosophila erecta]
 gi|190659064|gb|EDV56277.1| GG22564 [Drosophila erecta]
          Length = 86

 Score = 41.2 bits (95), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          +E+ +K+ +    V++ D + G G  ++A I+S  F GK  +Q+H++V  +L  ++   +
Sbjct: 9  LEEKLKRELQTEYVSVTDESDGCGGKFSAVIVSPAFSGKTLLQKHRLVNSTLSEEL-KEI 67

Query: 67 HALSIKTSVPD 77
          HA S K+  P+
Sbjct: 68 HAFSQKSYTPE 78


>gi|17986329|ref|NP_538963.1| morphology/transcriptional regulatory protein BolA [Brucella
          melitensis bv. 1 str. 16M]
 gi|17981915|gb|AAL51227.1| bola protein [Brucella melitensis bv. 1 str. 16M]
          Length = 102

 Score = 41.2 bits (95), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 35/54 (64%), Gaps = 1/54 (1%)

Query: 23 IHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           +D AG+  H+   I++E F G +R+Q+H+ + D L  ++ + +HAL+++ S P
Sbjct: 44 TYDGAGE-THFRIRIVAEAFTGMSRVQRHRAINDLLKEELESGVHALALEPSAP 96


>gi|256370425|ref|YP_003107936.1| bolA protein [Brucella microti CCM 4915]
 gi|256000588|gb|ACU48987.1| bolA protein [Brucella microti CCM 4915]
          Length = 104

 Score = 40.8 bits (94), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 35/54 (64%), Gaps = 1/54 (1%)

Query: 23 IHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           +D AG+  H+   I++E F G +R+Q+H+ + D L  ++ + +HAL+++ S P
Sbjct: 46 TYDGAGE-THFRIRIVAEAFTGMSRVQRHRAINDLLKEELESGVHALALEPSAP 98


>gi|254718071|ref|ZP_05179882.1| hypothetical protein Bru83_00744 [Brucella sp. 83/13]
 gi|306837273|ref|ZP_07470159.1| bolA protein [Brucella sp. NF 2653]
 gi|306407645|gb|EFM63838.1| bolA protein [Brucella sp. NF 2653]
          Length = 112

 Score = 40.8 bits (94), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 35/54 (64%), Gaps = 1/54 (1%)

Query: 23 IHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           +D AG+  H+   I++E F G +R+Q+H+ + D L  ++ + +HAL+++ S P
Sbjct: 46 TYDGAGE-THFRIRIVAEAFTGMSRVQRHRAINDLLKEELESGVHALALEPSAP 98


>gi|329894342|ref|ZP_08270212.1| Cell division protein BolA [gamma proteobacterium IMCC3088]
 gi|328923138|gb|EGG30461.1| Cell division protein BolA [gamma proteobacterium IMCC3088]
          Length = 103

 Score = 40.8 bits (94), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 38/77 (49%), Gaps = 7/77 (9%)

Query: 8  IEKMIKKGIPQSIVTIHDLA-------GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          +   +    PQ++V + + +       G   H+   +++EEF    R+++HQ VY  + +
Sbjct: 7  LRSRVSDAFPQALVLLENESYKHNVPEGSETHFGMTVVAEEFESMPRVKRHQAVYGLVSD 66

Query: 61 KMGNALHALSIKTSVPD 77
           +   +HAL++    P+
Sbjct: 67 LLDGPVHALALHLYTPE 83


>gi|209966343|ref|YP_002299258.1| BolA protein [Rhodospirillum centenum SW]
 gi|209959809|gb|ACJ00446.1| BolA protein [Rhodospirillum centenum SW]
          Length = 104

 Score = 40.8 bits (94), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 30/49 (61%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G   H++ E++S  F G  R+ +H++V + L +++   +HAL ++T  P
Sbjct: 43 GGETHFSVEVVSARFDGMARLARHRLVNELLADELKERVHALQLRTLTP 91


>gi|15803730|ref|NP_289764.1| hypothetical protein Z4553 [Escherichia coli O157:H7 EDL933]
 gi|15833323|ref|NP_312096.1| hypothetical protein ECs4069 [Escherichia coli O157:H7 str.
          Sakai]
 gi|24114479|ref|NP_708989.1| hypothetical protein SF3230 [Shigella flexneri 2a str. 301]
 gi|26249774|ref|NP_755814.1| hypothetical protein c3948 [Escherichia coli CFT073]
 gi|30064528|ref|NP_838699.1| hypothetical protein S3448 [Shigella flexneri 2a str. 2457T]
 gi|74313727|ref|YP_312146.1| hypothetical protein SSON_3338 [Shigella sonnei Ss046]
 gi|82545572|ref|YP_409519.1| hypothetical protein SBO_3192 [Shigella boydii Sb227]
 gi|82778504|ref|YP_404853.1| hypothetical protein SDY_3371 [Shigella dysenteriae Sd197]
 gi|91212613|ref|YP_542599.1| hypothetical protein UTI89_C3624 [Escherichia coli UTI89]
 gi|110643430|ref|YP_671160.1| BolA family transcriptional regulator [Escherichia coli 536]
 gi|110807056|ref|YP_690576.1| hypothetical protein SFV_3220 [Shigella flexneri 5 str. 8401]
 gi|117625483|ref|YP_858806.1| putative DNA-binding transcriptional regulator [Escherichia coli
          APEC O1]
 gi|157155993|ref|YP_001464666.1| BolA/YrbA family protein [Escherichia coli E24377A]
 gi|168751596|ref|ZP_02776618.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. EC4113]
 gi|168754172|ref|ZP_02779179.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. EC4401]
 gi|168763727|ref|ZP_02788734.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. EC4501]
 gi|168769046|ref|ZP_02794053.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. EC4486]
 gi|168777245|ref|ZP_02802252.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. EC4196]
 gi|168781334|ref|ZP_02806341.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. EC4076]
 gi|168786076|ref|ZP_02811083.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. EC869]
 gi|168800904|ref|ZP_02825911.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. EC508]
 gi|170683064|ref|YP_001745462.1| BolA/YrbA family protein [Escherichia coli SMS-3-5]
 gi|187731889|ref|YP_001881895.1| BolA/YrbA family protein [Shigella boydii CDC 3083-94]
 gi|188495302|ref|ZP_03002572.1| putative BolA protein [Escherichia coli 53638]
 gi|191168630|ref|ZP_03030412.1| BolA/YrbA family protein [Escherichia coli B7A]
 gi|193065368|ref|ZP_03046439.1| BolA/YrbA family protein [Escherichia coli E22]
 gi|193070299|ref|ZP_03051242.1| BolA/YrbA family protein [Escherichia coli E110019]
 gi|194434488|ref|ZP_03066748.1| BolA/YrbA family protein [Shigella dysenteriae 1012]
 gi|194439193|ref|ZP_03071274.1| BolA/YrbA family protein [Escherichia coli 101-1]
 gi|195940046|ref|ZP_03085428.1| putative DNA-binding transcriptional regulator [Escherichia coli
          O157:H7 str. EC4024]
 gi|208806284|ref|ZP_03248621.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. EC4206]
 gi|208812445|ref|ZP_03253774.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. EC4045]
 gi|208820576|ref|ZP_03260896.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. EC4042]
 gi|209396580|ref|YP_002272660.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. EC4115]
 gi|217327647|ref|ZP_03443730.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. TW14588]
 gi|227887911|ref|ZP_04005716.1| BolA superfamily transcriptional regulator [Escherichia coli
          83972]
 gi|237706058|ref|ZP_04536539.1| BolA/YrbA family protein [Escherichia sp. 3_2_53FAA]
 gi|253771976|ref|YP_003034807.1| BolA family protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254038355|ref|ZP_04872413.1| YrbA family protein [Escherichia sp. 1_1_43]
 gi|256018891|ref|ZP_05432756.1| BolA family protein [Shigella sp. D9]
 gi|256024235|ref|ZP_05438100.1| BolA family protein [Escherichia sp. 4_1_40B]
 gi|261228201|ref|ZP_05942482.1| BolA family protein [Escherichia coli O157:H7 str. FRIK2000]
 gi|261255057|ref|ZP_05947590.1| BolA family protein [Escherichia coli O157:H7 str. FRIK966]
 gi|291284564|ref|YP_003501382.1| putative transcriptional regulator, BolA superfamily [Escherichia
          coli O55:H7 str. CB9615]
 gi|293416619|ref|ZP_06659258.1| yrbA protein [Escherichia coli B185]
 gi|297518298|ref|ZP_06936684.1| putative transcriptional regulator, BolA superfamily protein
          [Escherichia coli OP50]
 gi|300817556|ref|ZP_07097772.1| BolA-like protein [Escherichia coli MS 107-1]
 gi|300823845|ref|ZP_07103969.1| BolA-like protein [Escherichia coli MS 119-7]
 gi|300897957|ref|ZP_07116333.1| BolA-like protein [Escherichia coli MS 198-1]
 gi|300904381|ref|ZP_07122229.1| BolA-like protein [Escherichia coli MS 84-1]
 gi|300918951|ref|ZP_07135506.1| BolA-like protein [Escherichia coli MS 115-1]
 gi|300926066|ref|ZP_07141888.1| BolA-like protein [Escherichia coli MS 182-1]
 gi|300929885|ref|ZP_07145327.1| BolA-like protein [Escherichia coli MS 187-1]
 gi|300938105|ref|ZP_07152879.1| BolA-like protein [Escherichia coli MS 21-1]
 gi|300948844|ref|ZP_07162909.1| BolA-like protein [Escherichia coli MS 116-1]
 gi|300955778|ref|ZP_07168120.1| BolA-like protein [Escherichia coli MS 175-1]
 gi|300979962|ref|ZP_07174814.1| BolA-like protein [Escherichia coli MS 200-1]
 gi|300990919|ref|ZP_07179371.1| BolA-like protein [Escherichia coli MS 45-1]
 gi|301022091|ref|ZP_07186017.1| BolA-like protein [Escherichia coli MS 69-1]
 gi|301025909|ref|ZP_07189396.1| BolA-like protein [Escherichia coli MS 196-1]
 gi|301047963|ref|ZP_07195008.1| BolA-like protein [Escherichia coli MS 185-1]
 gi|301326377|ref|ZP_07219741.1| BolA-like protein [Escherichia coli MS 78-1]
 gi|301644904|ref|ZP_07244873.1| BolA-like protein [Escherichia coli MS 146-1]
 gi|306816468|ref|ZP_07450600.1| putative transcriptional regulator, BolA superfamily protein
          [Escherichia coli NC101]
 gi|307139876|ref|ZP_07499232.1| putative transcriptional regulator, BolA superfamily protein
          [Escherichia coli H736]
 gi|307313105|ref|ZP_07592731.1| BolA family protein [Escherichia coli W]
 gi|309793769|ref|ZP_07688195.1| BolA-like protein [Escherichia coli MS 145-7]
 gi|331643888|ref|ZP_08345019.1| putative transcriptional regulator (BolA family) [Escherichia
          coli H736]
 gi|331648990|ref|ZP_08350078.1| putative transcriptional regulator (BolA family) [Escherichia
          coli M605]
 gi|331654794|ref|ZP_08355794.1| putative transcriptional regulator (BolA family) [Escherichia
          coli M718]
 gi|331659477|ref|ZP_08360419.1| putative transcriptional regulator (BolA family) [Escherichia
          coli TA206]
 gi|331670017|ref|ZP_08370862.1| putative transcriptional regulator (BolA family) [Escherichia
          coli TA271]
 gi|331674720|ref|ZP_08375479.1| putative transcriptional regulator (BolA family) [Escherichia
          coli TA280]
 gi|331679269|ref|ZP_08379941.1| putative transcriptional regulator (BolA family) [Escherichia
          coli H591]
 gi|331684837|ref|ZP_08385429.1| putative transcriptional regulator (BolA family) [Escherichia
          coli H299]
 gi|332279979|ref|ZP_08392392.1| BolA/YrbA family protein [Shigella sp. D9]
 gi|6648611|gb|AAF21251.1|AF053073_4 YrbA [Shigella flexneri]
 gi|12517805|gb|AAG58324.1|AE005547_10 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|26110202|gb|AAN82388.1|AE016767_148 Protein yrbA [Escherichia coli CFT073]
 gi|606128|gb|AAA57991.1| ORF_f89 [Escherichia coli str. K-12 substr. MG1655]
 gi|13363542|dbj|BAB37492.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|24053662|gb|AAN44696.1| orf, conserved hypothetical protein [Shigella flexneri 2a str.
          301]
 gi|30042787|gb|AAP18510.1| hypothetical protein S3448 [Shigella flexneri 2a str. 2457T]
 gi|73857204|gb|AAZ89911.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|81242652|gb|ABB63362.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|81246983|gb|ABB67691.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|91074187|gb|ABE09068.1| hypothetical protein UTI89_C3624 [Escherichia coli UTI89]
 gi|110345022|gb|ABG71259.1| putative transcriptional regulator (BolA family) [Escherichia
          coli 536]
 gi|110616604|gb|ABF05271.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|115514607|gb|ABJ02682.1| putative DNA-binding transcriptional regulator [Escherichia coli
          APEC O1]
 gi|157078023|gb|ABV17731.1| BolA/YrbA family protein [Escherichia coli E24377A]
 gi|170520782|gb|ACB18960.1| BolA/YrbA family protein [Escherichia coli SMS-3-5]
 gi|187428881|gb|ACD08155.1| BolA/YrbA family protein [Shigella boydii CDC 3083-94]
 gi|187767451|gb|EDU31295.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. EC4196]
 gi|188014358|gb|EDU52480.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. EC4113]
 gi|188490501|gb|EDU65604.1| putative BolA protein [Escherichia coli 53638]
 gi|189001060|gb|EDU70046.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. EC4076]
 gi|189358505|gb|EDU76924.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. EC4401]
 gi|189361731|gb|EDU80150.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. EC4486]
 gi|189366118|gb|EDU84534.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. EC4501]
 gi|189373869|gb|EDU92285.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. EC869]
 gi|189376816|gb|EDU95232.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. EC508]
 gi|190901324|gb|EDV61091.1| BolA/YrbA family protein [Escherichia coli B7A]
 gi|192927009|gb|EDV81632.1| BolA/YrbA family protein [Escherichia coli E22]
 gi|192956358|gb|EDV86818.1| BolA/YrbA family protein [Escherichia coli E110019]
 gi|194417267|gb|EDX33376.1| BolA/YrbA family protein [Shigella dysenteriae 1012]
 gi|194421889|gb|EDX37895.1| BolA/YrbA family protein [Escherichia coli 101-1]
 gi|208726085|gb|EDZ75686.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. EC4206]
 gi|208733722|gb|EDZ82409.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. EC4045]
 gi|208740699|gb|EDZ88381.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. EC4042]
 gi|209157980|gb|ACI35413.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. EC4115]
 gi|209758138|gb|ACI77381.1| hypothetical protein ECs4069 [Escherichia coli]
 gi|209758140|gb|ACI77382.1| hypothetical protein ECs4069 [Escherichia coli]
 gi|209758142|gb|ACI77383.1| hypothetical protein ECs4069 [Escherichia coli]
 gi|209758144|gb|ACI77384.1| hypothetical protein ECs4069 [Escherichia coli]
 gi|209758146|gb|ACI77385.1| hypothetical protein ECs4069 [Escherichia coli]
 gi|217320014|gb|EEC28439.1| BolA/YrbA family protein [Escherichia coli O157:H7 str. TW14588]
 gi|226839979|gb|EEH72000.1| YrbA family protein [Escherichia sp. 1_1_43]
 gi|226899098|gb|EEH85357.1| BolA/YrbA family protein [Escherichia sp. 3_2_53FAA]
 gi|227835307|gb|EEJ45773.1| BolA superfamily transcriptional regulator [Escherichia coli
          83972]
 gi|253323020|gb|ACT27622.1| BolA family protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|260447783|gb|ACX38205.1| BolA family protein [Escherichia coli DH1]
 gi|281602573|gb|ADA75557.1| putative transcriptional regulator, BolA superfamily [Shigella
          flexneri 2002017]
 gi|284923212|emb|CBG36306.1| conserved hypothetical protein [Escherichia coli 042]
 gi|290764437|gb|ADD58398.1| Predicted transcriptional regulator, BolA superfamily
          [Escherichia coli O55:H7 str. CB9615]
 gi|291431975|gb|EFF04958.1| yrbA protein [Escherichia coli B185]
 gi|294492379|gb|ADE91135.1| BolA/YrbA family protein [Escherichia coli IHE3034]
 gi|299879931|gb|EFI88142.1| BolA-like protein [Escherichia coli MS 196-1]
 gi|300300195|gb|EFJ56580.1| BolA-like protein [Escherichia coli MS 185-1]
 gi|300307897|gb|EFJ62417.1| BolA-like protein [Escherichia coli MS 200-1]
 gi|300317324|gb|EFJ67108.1| BolA-like protein [Escherichia coli MS 175-1]
 gi|300358305|gb|EFJ74175.1| BolA-like protein [Escherichia coli MS 198-1]
 gi|300397687|gb|EFJ81225.1| BolA-like protein [Escherichia coli MS 69-1]
 gi|300403655|gb|EFJ87193.1| BolA-like protein [Escherichia coli MS 84-1]
 gi|300406995|gb|EFJ90533.1| BolA-like protein [Escherichia coli MS 45-1]
 gi|300413893|gb|EFJ97203.1| BolA-like protein [Escherichia coli MS 115-1]
 gi|300417924|gb|EFK01235.1| BolA-like protein [Escherichia coli MS 182-1]
 gi|300451649|gb|EFK15269.1| BolA-like protein [Escherichia coli MS 116-1]
 gi|300456868|gb|EFK20361.1| BolA-like protein [Escherichia coli MS 21-1]
 gi|300462171|gb|EFK25664.1| BolA-like protein [Escherichia coli MS 187-1]
 gi|300523613|gb|EFK44682.1| BolA-like protein [Escherichia coli MS 119-7]
 gi|300529854|gb|EFK50916.1| BolA-like protein [Escherichia coli MS 107-1]
 gi|300846941|gb|EFK74701.1| BolA-like protein [Escherichia coli MS 78-1]
 gi|301076755|gb|EFK91561.1| BolA-like protein [Escherichia coli MS 146-1]
 gi|305850033|gb|EFM50492.1| putative transcriptional regulator, BolA superfamily protein
          [Escherichia coli NC101]
 gi|306907016|gb|EFN37524.1| BolA family protein [Escherichia coli W]
 gi|307555283|gb|ADN48058.1| putative transcriptional regulator [Escherichia coli ABU 83972]
 gi|307625211|gb|ADN69515.1| putative transcriptional regulator, BolA superfamily protein
          [Escherichia coli UM146]
 gi|308122726|gb|EFO59988.1| BolA-like protein [Escherichia coli MS 145-7]
 gi|312947747|gb|ADR28574.1| BolA family protein [Escherichia coli O83:H1 str. NRG 857C]
 gi|315062496|gb|ADT76823.1| predicted DNA-binding transcriptional regulator [Escherichia coli
          W]
 gi|315137776|dbj|BAJ44935.1| putative transcriptional regulator, BolA superfamily [Escherichia
          coli DH1]
 gi|315257117|gb|EFU37085.1| BolA-like protein [Escherichia coli MS 85-1]
 gi|315289012|gb|EFU48410.1| BolA-like protein [Escherichia coli MS 110-3]
 gi|315294849|gb|EFU54188.1| BolA-like protein [Escherichia coli MS 153-1]
 gi|315297944|gb|EFU57214.1| BolA-like protein [Escherichia coli MS 16-3]
 gi|320174555|gb|EFW49691.1| YrbA protein [Shigella dysenteriae CDC 74-1112]
 gi|320181465|gb|EFW56383.1| YrbA protein [Shigella boydii ATCC 9905]
 gi|320186677|gb|EFW61401.1| YrbA protein [Shigella flexneri CDC 796-83]
 gi|320189543|gb|EFW64202.1| YrbA protein [Escherichia coli O157:H7 str. EC1212]
 gi|320194675|gb|EFW69305.1| YrbA protein [Escherichia coli WV_060327]
 gi|320202104|gb|EFW76679.1| YrbA protein [Escherichia coli EC4100B]
 gi|320640261|gb|EFX09833.1| putative transcriptional regulator, BolA superfamily protein
          [Escherichia coli O157:H7 str. G5101]
 gi|320645558|gb|EFX14567.1| putative transcriptional regulator, BolA superfamily protein
          [Escherichia coli O157:H- str. 493-89]
 gi|320650868|gb|EFX19325.1| putative transcriptional regulator, BolA superfamily protein
          [Escherichia coli O157:H- str. H 2687]
 gi|320656249|gb|EFX24161.1| putative transcriptional regulator, BolA superfamily protein
          [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320661939|gb|EFX29347.1| putative transcriptional regulator, BolA superfamily protein
          [Escherichia coli O55:H7 str. USDA 5905]
 gi|320666774|gb|EFX33753.1| putative transcriptional regulator, BolA superfamily protein
          [Escherichia coli O157:H7 str. LSU-61]
 gi|323376916|gb|ADX49184.1| BolA family protein [Escherichia coli KO11]
 gi|323936116|gb|EGB32410.1| BolA protein [Escherichia coli E1520]
 gi|323941710|gb|EGB37889.1| BolA protein [Escherichia coli E482]
 gi|323946956|gb|EGB42972.1| BolA protein [Escherichia coli H120]
 gi|323957663|gb|EGB53377.1| BolA protein [Escherichia coli H263]
 gi|323961155|gb|EGB56769.1| BolA protein [Escherichia coli H489]
 gi|323966370|gb|EGB61804.1| BolA protein [Escherichia coli M863]
 gi|323970247|gb|EGB65518.1| BolA protein [Escherichia coli TA007]
 gi|323979093|gb|EGB74171.1| BolA protein [Escherichia coli TW10509]
 gi|324008701|gb|EGB77920.1| BolA-like protein [Escherichia coli MS 57-2]
 gi|324012167|gb|EGB81386.1| BolA-like protein [Escherichia coli MS 60-1]
 gi|324018358|gb|EGB87577.1| BolA-like protein [Escherichia coli MS 117-3]
 gi|324119555|gb|EGC13437.1| BolA protein [Escherichia coli E1167]
 gi|326337890|gb|EGD61724.1| YrbA protein [Escherichia coli O157:H7 str. 1125]
 gi|326347460|gb|EGD71185.1| YrbA protein [Escherichia coli O157:H7 str. 1044]
 gi|330909244|gb|EGH37758.1| YrbA protein [Escherichia coli AA86]
 gi|331037359|gb|EGI09583.1| putative transcriptional regulator (BolA family) [Escherichia
          coli H736]
 gi|331042737|gb|EGI14879.1| putative transcriptional regulator (BolA family) [Escherichia
          coli M605]
 gi|331048176|gb|EGI20253.1| putative transcriptional regulator (BolA family) [Escherichia
          coli M718]
 gi|331054059|gb|EGI26088.1| putative transcriptional regulator (BolA family) [Escherichia
          coli TA206]
 gi|331062930|gb|EGI34844.1| putative transcriptional regulator (BolA family) [Escherichia
          coli TA271]
 gi|331068159|gb|EGI39555.1| putative transcriptional regulator (BolA family) [Escherichia
          coli TA280]
 gi|331073334|gb|EGI44657.1| putative transcriptional regulator (BolA family) [Escherichia
          coli H591]
 gi|331078452|gb|EGI49658.1| putative transcriptional regulator (BolA family) [Escherichia
          coli H299]
 gi|332102331|gb|EGJ05677.1| BolA/YrbA family protein [Shigella sp. D9]
          Length = 89

 Score = 40.8 bits (94), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M  +EI+ ++   +  S+  +H ++GDG+H+    + E F G +R+++ Q VY  L   +
Sbjct: 6  MENNEIQSVLMNAL--SLQEVH-VSGDGSHFQVIAVGELFDGMSRVKKQQTVYGPLMEYI 62

Query: 63 G-NALHALSIKTSVP 76
            N +HA+SIK   P
Sbjct: 63 ADNRIHAVSIKAYTP 77


>gi|223042147|ref|ZP_03612318.1| putative transcriptional regulator [Actinobacillus minor 202]
 gi|223017086|gb|EEF15527.1| putative transcriptional regulator [Actinobacillus minor 202]
          Length = 103

 Score = 40.8 bits (94), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   I+S  F GK  + +HQ +Y  L +++   +HAL++ T
Sbjct: 34 GAESHFKVTIVSSVFEGKRSVARHQAIYQCLADELAQGVHALALHT 79


>gi|182680329|ref|YP_001834475.1| BolA family protein [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182636212|gb|ACB96986.1| BolA family protein [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 101

 Score = 40.8 bits (94), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 29/47 (61%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G H+  +++SE F+GK+R+ +H+ +   L  ++   +HAL+I    P
Sbjct: 53 GTHFHVKVVSEAFKGKSRVDRHRTINGLLQQELNAGVHALAIDAKAP 99


>gi|50513260|pdb|1NY8|A Chain A, Solution Structure Of Protein Yrba From Escherichia
          Coli: Northeast Structural Genomics Consortium Target
          Er115
          Length = 97

 Score = 40.8 bits (94), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M  +EI+ ++   +  S+  +H ++GDG+H+    + E F G +R+++ Q VY  L   +
Sbjct: 6  MENNEIQSVLMNAL--SLQEVH-VSGDGSHFQVIAVGELFDGMSRVKKQQTVYGPLMEYI 62

Query: 63 G-NALHALSIKTSVP 76
            N +HA+SIK   P
Sbjct: 63 ADNRIHAVSIKAYTP 77


>gi|297183667|gb|ADI19792.1| stress-induced morphogen (activity unknown) [uncultured alpha
          proteobacterium EB000_37G09]
          Length = 86

 Score = 40.8 bits (94), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          +G  +H+  +I+S  F GKNRI  H++V   L + +   +HAL + T
Sbjct: 37 SGGESHFDVDIVSAAFAGKNRIMCHRLVTAELADLLAGPVHALQLST 83


>gi|16272130|ref|NP_438333.1| transcriptional regulator [Haemophilus influenzae Rd KW20]
 gi|145639779|ref|ZP_01795381.1| transcriptional regulator [Haemophilus influenzae PittII]
 gi|145641496|ref|ZP_01797074.1| phosphatidylserine decarboxylase [Haemophilus influenzae R3021]
 gi|148827303|ref|YP_001292056.1| transcriptional regulator [Haemophilus influenzae PittGG]
 gi|260580954|ref|ZP_05848778.1| transcriptional regulator [Haemophilus influenzae RdAW]
 gi|260582380|ref|ZP_05850172.1| transcriptional regulator [Haemophilus influenzae NT127]
 gi|319775965|ref|YP_004138453.1| Protein bolA [Haemophilus influenzae F3047]
 gi|319898130|ref|YP_004136327.1| protein bola homolog [Haemophilus influenzae F3031]
 gi|329123829|ref|ZP_08252387.1| regulator of penicillin binding proteins and beta lactamase
          transcription [Haemophilus aegyptius ATCC 11116]
 gi|1168682|sp|P43780|BOLA_HAEIN RecName: Full=Protein BolA homolog
 gi|644852|gb|AAA62135.1| BOLA [Haemophilus influenzae]
 gi|1573121|gb|AAC21835.1| transcriptional regulator, putative (bolA) [Haemophilus
          influenzae Rd KW20]
 gi|145271147|gb|EDK11062.1| transcriptional regulator [Haemophilus influenzae PittII]
 gi|145273787|gb|EDK13655.1| phosphatidylserine decarboxylase [Haemophilus influenzae 22.4-21]
 gi|148718545|gb|ABQ99672.1| transcriptional regulator [Haemophilus influenzae PittGG]
 gi|260092443|gb|EEW76382.1| transcriptional regulator [Haemophilus influenzae RdAW]
 gi|260094531|gb|EEW78427.1| transcriptional regulator [Haemophilus influenzae NT127]
 gi|309750419|gb|ADO80403.1| Morphology-related protein BolA [Haemophilus influenzae R2866]
 gi|309972714|gb|ADO95915.1| Morphology-related protein BolA [Haemophilus influenzae R2846]
 gi|317433636|emb|CBY82021.1| protein bolA homolog [Haemophilus influenzae F3031]
 gi|317450556|emb|CBY86773.1| Protein bolA homolog [Haemophilus influenzae F3047]
 gi|327469316|gb|EGF14787.1| regulator of penicillin binding proteins and beta lactamase
          transcription [Haemophilus aegyptius ATCC 11116]
          Length = 103

 Score = 40.8 bits (94), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 32/54 (59%)

Query: 24 HDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          H   G  +H+   I+S +F+   ++Q+HQ +Y  L  ++ +++HAL++    P+
Sbjct: 30 HSNRGSESHFKCVIVSADFKNIRKVQRHQRIYQLLNEELNHSIHALALHLFTPE 83


>gi|224161882|ref|XP_002197048.1| PREDICTED: hypothetical protein [Taeniopygia guttata]
          Length = 60

 Score = 40.8 bits (94), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDS 78
           G G+ Y   + SEEFR K  +QQH+MV  +L  ++ + +H L I TS P +
Sbjct: 10 GGCGDMYEIHVESEEFREKRPVQQHRMVTQALSEEIKH-MHGLRIFTSAPKA 60


>gi|291225575|ref|XP_002732777.1| PREDICTED: bolA-like 1-like [Saccoglossus kowalevskii]
          Length = 149

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 32/50 (64%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           G  +H+   +IS++F  +  I++H+MV +SL  ++   +HALSI+   P+
Sbjct: 74  GSESHFKVVVISDKFDKQTLIKRHRMVNESLEEELKGPVHALSIQAKTPE 123


>gi|37680775|ref|NP_935384.1| cell division protein BolA [Vibrio vulnificus YJ016]
 gi|37199524|dbj|BAC95355.1| cell division protein BolA [Vibrio vulnificus YJ016]
          Length = 126

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 30/46 (65%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
           G  +H+   ++S+ F GK  I +H++V  +L N++ N +HAL+I T
Sbjct: 56  GSESHFKVIVVSDLFEGKRLIARHRLVNQALANELENNIHALAIHT 101


>gi|238919009|ref|YP_002932523.1| hypothetical protein NT01EI_1076 [Edwardsiella ictaluri 93-146]
 gi|238868577|gb|ACR68288.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 108

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 31/47 (65%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG   H+   ++S+ F+G+  + +H+ +Y +L ++M + +HAL++ T
Sbjct: 32 AGSETHFKVVMVSDRFQGERFLSRHRAIYGTLADEMADGVHALALHT 78


>gi|109896884|ref|YP_660139.1| BolA-like protein [Pseudoalteromonas atlantica T6c]
 gi|109699165|gb|ABG39085.1| BolA-like protein [Pseudoalteromonas atlantica T6c]
          Length = 85

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 43/74 (58%), Gaps = 8/74 (10%)

Query: 3  MNPHEIEKMI--KKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M   EIE+++  K G+ ++ VT     GDG+H+    +S++F   +R+++ Q VY  L  
Sbjct: 1  MQNSEIEQLLIEKLGLAEAHVT-----GDGSHFQIIAVSDQFDDMSRVKKQQFVYAPLSE 55

Query: 61 KMGN-ALHALSIKT 73
           +    +HA+SIKT
Sbjct: 56 IIAQGTMHAISIKT 69


>gi|304396330|ref|ZP_07378211.1| BolA family protein [Pantoea sp. aB]
 gi|308189082|ref|YP_003933213.1| hypothetical protein Pvag_3646 [Pantoea vagans C9-1]
 gi|304355839|gb|EFM20205.1| BolA family protein [Pantoea sp. aB]
 gi|308059592|gb|ADO11764.1| Uncharacterized protein yrbA [Pantoea vagans C9-1]
          Length = 85

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 41/75 (54%), Gaps = 3/75 (4%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EI+ ++   +P  +  +H ++ DG+H+    + E F   +R+++ Q VY  L   +
Sbjct: 1  MENSEIQAVLMAALP--LDEVHVMSNDGSHFQVIAVGELFGELSRVKKQQAVYAPLMEFI 58

Query: 63 G-NALHALSIKTSVP 76
            N +HA+SIKT  P
Sbjct: 59 ADNRMHAVSIKTYTP 73


>gi|291398071|ref|XP_002715415.1| PREDICTED: bolA-like 1 [Oryctolagus cuniculus]
          Length = 137

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 29/49 (59%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           G   H+   ++S  F G + +Q+H++V+ +L  ++   +HAL+I+   P
Sbjct: 63  GSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELAGPVHALAIQARTP 111


>gi|296818485|ref|XP_002849579.1| BolA domain-containing protein [Arthroderma otae CBS 113480]
 gi|238840032|gb|EEQ29694.1| BolA domain-containing protein [Arthroderma otae CBS 113480]
          Length = 116

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN--ALHALSIKTSVPDSQ 79
            H++  I+S  F  KN+  +H+MVY+ L  +M     +HAL +KT  P+ +
Sbjct: 57  THFSVTIVSSAFASKNQPARHRMVYNLLKEEMARDGGIHALQLKTRTPEEE 107


>gi|15839041|ref|NP_299729.1| hypothetical protein XF2450 [Xylella fastidiosa 9a5c]
 gi|9107646|gb|AAF85249.1|AE004054_1 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 96

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 24 HDLAGDGN-HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
          H  A DG  H++  I++  F GK  + +H+ VY +LG+ M   +HALSI+  V + +
Sbjct: 38 HSGARDGRGHFSVLIVTPMFAGKTLLARHRAVYAALGSMMETDIHALSIQALVDEGE 94


>gi|297811085|ref|XP_002873426.1| hypothetical protein ARALYDRAFT_487805 [Arabidopsis lyrata subsp.
          lyrata]
 gi|297319263|gb|EFH49685.1| hypothetical protein ARALYDRAFT_487805 [Arabidopsis lyrata subsp.
          lyrata]
          Length = 93

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 31/47 (65%), Gaps = 1/47 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTS 74
          G G  +  E++SE+F GK  +++H+MV  +L  +M   +HALSIK +
Sbjct: 28 GCGASFEIEVVSEQFEGKRLLERHRMVNAALEEEMKE-IHALSIKKA 73


>gi|251793314|ref|YP_003008042.1| BolA protein [Aggregatibacter aphrophilus NJ8700]
 gi|247534709|gb|ACS97955.1| BolA protein [Aggregatibacter aphrophilus NJ8700]
          Length = 103

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 28/44 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSI 71
          GD +H+   I+S+ F G N++ +H+ +Y  L   + N +HAL++
Sbjct: 34 GDSSHFKVVIVSDVFEGLNKVARHRKIYQFLAQDLQNGIHALAL 77


>gi|146331882|gb|ABQ22447.1| BolA-like protein 1-like protein [Callithrix jacchus]
          Length = 133

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 29/49 (59%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           G   H+   ++S  F G + +Q+H++V+ +L  ++   +HAL+I+   P
Sbjct: 59  GSETHFRVAVVSSRFEGLSPLQRHRLVHTALAEELAGPVHALAIQARTP 107


>gi|28199349|ref|NP_779663.1| morphogene BolA protein [Xylella fastidiosa Temecula1]
 gi|182682074|ref|YP_001830234.1| BolA family protein [Xylella fastidiosa M23]
 gi|28057455|gb|AAO29312.1| morphogene BolA protein [Xylella fastidiosa Temecula1]
 gi|182632184|gb|ACB92960.1| BolA family protein [Xylella fastidiosa M23]
 gi|307578341|gb|ADN62310.1| BolA family protein [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 96

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 24 HDLAGDG-NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
          H  A DG  H++  I++  F GK  + +H+ VY +LG+ M   +HALSI+  V + +
Sbjct: 38 HSGARDGRGHFSVLIVTPMFAGKTLLARHRAVYAALGSMMKTDIHALSIQALVDEGE 94


>gi|188532484|ref|YP_001906281.1| Putative transcriptional regulator (BolA family) [Erwinia
          tasmaniensis Et1/99]
 gi|188027526|emb|CAO95373.1| Putative transcriptional regulator (BolA family) [Erwinia
          tasmaniensis Et1/99]
          Length = 84

 Score = 40.8 bits (94), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EI+ ++   +P  +  +H ++GDG+H+    + E F   +R+++ Q VY  L   +
Sbjct: 1  MENSEIQSVLMSALP--LQEVH-VSGDGSHFQVIAVGELFGELSRVKKQQTVYAPLMAYI 57

Query: 63 G-NALHALSIKTSVPD 77
            N +HA+SIKT  P+
Sbjct: 58 ADNRIHAVSIKTYTPE 73


>gi|145628462|ref|ZP_01784262.1| glutathione reductase [Haemophilus influenzae 22.1-21]
 gi|144978932|gb|EDJ88618.1| glutathione reductase [Haemophilus influenzae 22.1-21]
          Length = 103

 Score = 40.8 bits (94), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 32/54 (59%)

Query: 24 HDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          H   G  +H+   I+S +F+   ++Q+HQ +Y  L  ++ +++HAL++    P+
Sbjct: 30 HSNRGSESHFKCVIVSADFKNIRKVQRHQRIYQLLNEELNHSIHALALHLFTPE 83


>gi|89109953|ref|AP_003733.1| predicted DNA-binding transcriptional regulator [Escherichia coli
          str. K-12 substr. W3110]
 gi|90111555|ref|NP_417657.2| predicted DNA-binding transcriptional regulator, BolA family
          [Escherichia coli str. K-12 substr. MG1655]
 gi|170018560|ref|YP_001723514.1| BolA family protein [Escherichia coli ATCC 8739]
 gi|170082724|ref|YP_001732044.1| DNA-binding transcriptional regulator [Escherichia coli str. K-12
          substr. DH10B]
 gi|191174491|ref|ZP_03035991.1| BolA/YrbA family protein [Escherichia coli F11]
 gi|209920665|ref|YP_002294749.1| hypothetical protein ECSE_3474 [Escherichia coli SE11]
 gi|215488506|ref|YP_002330937.1| predicted DNA-binding transcriptional regulator [Escherichia coli
          O127:H6 str. E2348/69]
 gi|218550473|ref|YP_002384264.1| DNA-binding transcriptional regulator [Escherichia fergusonii
          ATCC 35469]
 gi|218555760|ref|YP_002388673.1| putative DNA-binding transcriptional regulator [Escherichia coli
          IAI1]
 gi|218560260|ref|YP_002393173.1| DNA-binding transcriptional regulator [Escherichia coli S88]
 gi|218691480|ref|YP_002399692.1| putative DNA-binding transcriptional regulator [Escherichia coli
          ED1a]
 gi|218696895|ref|YP_002404562.1| putative DNA-binding transcriptional regulator [Escherichia coli
          55989]
 gi|218701959|ref|YP_002409588.1| putative DNA-binding transcriptional regulator [Escherichia coli
          IAI39]
 gi|218706810|ref|YP_002414329.1| putative DNA-binding transcriptional regulator [Escherichia coli
          UMN026]
 gi|238902292|ref|YP_002928088.1| putative DNA-binding transcriptional regulator [Escherichia coli
          BW2952]
 gi|254163132|ref|YP_003046240.1| putative DNA-binding transcriptional regulator [Escherichia coli
          B str. REL606]
 gi|254795139|ref|YP_003079976.1| putative DNA-binding transcriptional regulator [Escherichia coli
          O157:H7 str. TW14359]
 gi|260846003|ref|YP_003223781.1| putative DNA-binding transcriptional regulator [Escherichia coli
          O103:H2 str. 12009]
 gi|260857317|ref|YP_003231208.1| putative DNA-binding transcriptional regulator [Escherichia coli
          O26:H11 str. 11368]
 gi|260869941|ref|YP_003236343.1| putative DNA-binding transcriptional regulator [Escherichia coli
          O111:H- str. 11128]
 gi|293406799|ref|ZP_06650725.1| cell division protein BolA [Escherichia coli FVEC1412]
 gi|293412561|ref|ZP_06655284.1| conserved hypothetical protein [Escherichia coli B354]
 gi|293449523|ref|ZP_06663944.1| yrbA protein [Escherichia coli B088]
 gi|298382540|ref|ZP_06992137.1| yrbA protein [Escherichia coli FVEC1302]
 gi|309785518|ref|ZP_07680149.1| bolA-like family protein [Shigella dysenteriae 1617]
 gi|312968472|ref|ZP_07782681.1| bolA-like family protein [Escherichia coli 2362-75]
 gi|312972536|ref|ZP_07786710.1| bolA-like family protein [Escherichia coli 1827-70]
 gi|71152957|sp|P0A9W7|YRBA_ECOL6 RecName: Full=Uncharacterized protein YrbA
 gi|71152958|sp|P0A9W6|YRBA_ECOLI RecName: Full=Uncharacterized protein YrbA
 gi|71152959|sp|P0A9W8|YRBA_SHIFL RecName: Full=Uncharacterized protein YrbA
 gi|85675984|dbj|BAE77234.1| predicted DNA-binding transcriptional regulator [Escherichia coli
          str. K12 substr. W3110]
 gi|87082226|gb|AAC76222.2| predicted DNA-binding transcriptional regulator, BolA family
          [Escherichia coli str. K-12 substr. MG1655]
 gi|169753488|gb|ACA76187.1| BolA family protein [Escherichia coli ATCC 8739]
 gi|169890559|gb|ACB04266.1| predicted DNA-binding transcriptional regulator [Escherichia coli
          str. K-12 substr. DH10B]
 gi|190905246|gb|EDV64885.1| BolA/YrbA family protein [Escherichia coli F11]
 gi|209913924|dbj|BAG78998.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|215266578|emb|CAS11017.1| predicted DNA-binding transcriptional regulator [Escherichia coli
          O127:H6 str. E2348/69]
 gi|218353627|emb|CAU99832.1| putative DNA-binding transcriptional regulator [Escherichia coli
          55989]
 gi|218358014|emb|CAQ90660.1| putative DNA-binding transcriptional regulator [Escherichia
          fergusonii ATCC 35469]
 gi|218362528|emb|CAR00152.1| putative DNA-binding transcriptional regulator [Escherichia coli
          IAI1]
 gi|218367029|emb|CAR04800.1| putative DNA-binding transcriptional regulator [Escherichia coli
          S88]
 gi|218371945|emb|CAR19801.1| putative DNA-binding transcriptional regulator [Escherichia coli
          IAI39]
 gi|218429044|emb|CAR09990.2| putative DNA-binding transcriptional regulator [Escherichia coli
          ED1a]
 gi|218433907|emb|CAR14824.1| putative DNA-binding transcriptional regulator [Escherichia coli
          UMN026]
 gi|222034907|emb|CAP77650.1| Uncharacterized protein yrbA [Escherichia coli LF82]
 gi|238862292|gb|ACR64290.1| predicted DNA-binding transcriptional regulator [Escherichia coli
          BW2952]
 gi|242378733|emb|CAQ33523.1| predicted DNA-binding transcriptional regulator [Escherichia coli
          BL21(DE3)]
 gi|253975033|gb|ACT40704.1| predicted DNA-binding transcriptional regulator [Escherichia coli
          B str. REL606]
 gi|253979189|gb|ACT44859.1| predicted DNA-binding transcriptional regulator [Escherichia coli
          BL21(DE3)]
 gi|254594539|gb|ACT73900.1| predicted DNA-binding transcriptional regulator [Escherichia coli
          O157:H7 str. TW14359]
 gi|257755966|dbj|BAI27468.1| predicted DNA-binding transcriptional regulator [Escherichia coli
          O26:H11 str. 11368]
 gi|257761150|dbj|BAI32647.1| predicted DNA-binding transcriptional regulator [Escherichia coli
          O103:H2 str. 12009]
 gi|257766297|dbj|BAI37792.1| predicted DNA-binding transcriptional regulator [Escherichia coli
          O111:H- str. 11128]
 gi|281180232|dbj|BAI56562.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|291322613|gb|EFE62042.1| yrbA protein [Escherichia coli B088]
 gi|291426805|gb|EFE99837.1| cell division protein BolA [Escherichia coli FVEC1412]
 gi|291469332|gb|EFF11823.1| conserved hypothetical protein [Escherichia coli B354]
 gi|298277680|gb|EFI19196.1| yrbA protein [Escherichia coli FVEC1302]
 gi|308926638|gb|EFP72114.1| bolA-like family protein [Shigella dysenteriae 1617]
 gi|309703616|emb|CBJ02956.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
 gi|310334913|gb|EFQ01118.1| bolA-like family protein [Escherichia coli 1827-70]
 gi|312286690|gb|EFR14601.1| bolA-like family protein [Escherichia coli 2362-75]
 gi|313648567|gb|EFS13009.1| bolA-like family protein [Shigella flexneri 2a str. 2457T]
 gi|315617273|gb|EFU97882.1| bolA-like family protein [Escherichia coli 3431]
 gi|323154404|gb|EFZ40605.1| bolA-like family protein [Escherichia coli EPECa14]
 gi|323165151|gb|EFZ50941.1| bolA-like family protein [Shigella sonnei 53G]
 gi|323173550|gb|EFZ59179.1| bolA-like family protein [Escherichia coli LT-68]
 gi|323178634|gb|EFZ64210.1| bolA-like family protein [Escherichia coli 1180]
 gi|323183144|gb|EFZ68542.1| bolA-like family protein [Escherichia coli 1357]
 gi|323189189|gb|EFZ74473.1| bolA-like family protein [Escherichia coli RN587/1]
 gi|323951291|gb|EGB47166.1| BolA protein [Escherichia coli H252]
 gi|324115206|gb|EGC09170.1| BolA protein [Escherichia fergusonii B253]
 gi|325498771|gb|EGC96630.1| hypothetical protein ECD227_2868 [Escherichia fergusonii ECD227]
 gi|327251281|gb|EGE62970.1| bolA-like family protein [Escherichia coli STEC_7v]
 gi|332086235|gb|EGI91393.1| bolA-like family protein [Shigella boydii 5216-82]
 gi|332086423|gb|EGI91570.1| bolA-like family protein [Shigella dysenteriae 155-74]
 gi|332090737|gb|EGI95831.1| bolA-like family protein [Shigella boydii 3594-74]
 gi|332345147|gb|AEE58481.1| conserved hypothetical protein [Escherichia coli UMNK88]
 gi|332752349|gb|EGJ82739.1| bolA-like family protein [Shigella flexneri 4343-70]
 gi|332752875|gb|EGJ83260.1| bolA-like family protein [Shigella flexneri K-671]
 gi|332754619|gb|EGJ84985.1| bolA-like family protein [Shigella flexneri 2747-71]
 gi|332765186|gb|EGJ95413.1| bolA-like family protein [Shigella flexneri 2930-71]
 gi|332998832|gb|EGK18428.1| bolA-like family protein [Shigella flexneri VA-6]
 gi|332999269|gb|EGK18855.1| bolA-like family protein [Shigella flexneri K-272]
 gi|333000311|gb|EGK19894.1| bolA-like family protein [Shigella flexneri K-218]
 gi|333014555|gb|EGK33902.1| bolA-like family protein [Shigella flexneri K-304]
 gi|333014993|gb|EGK34337.1| bolA-like family protein [Shigella flexneri K-227]
          Length = 84

 Score = 40.8 bits (94), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M  +EI+ ++   +  S+  +H ++GDG+H+    + E F G +R+++ Q VY  L   +
Sbjct: 1  MENNEIQSVLMNAL--SLQEVH-VSGDGSHFQVIAVGELFDGMSRVKKQQTVYGPLMEYI 57

Query: 63 G-NALHALSIKTSVP 76
            N +HA+SIK   P
Sbjct: 58 ADNRIHAVSIKAYTP 72


>gi|329889993|ref|ZP_08268336.1| bolA-like family protein [Brevundimonas diminuta ATCC 11568]
 gi|328845294|gb|EGF94858.1| bolA-like family protein [Brevundimonas diminuta ATCC 11568]
          Length = 99

 Score = 40.8 bits (94), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          +H+   I+SE F G+NR+Q+ + V   L  ++   +HALSI+   P
Sbjct: 49 SHFQLTIVSEAFSGQNRVQRQRAVNAVLQAELAGPVHALSIRAQTP 94


>gi|295097677|emb|CBK86767.1| Predicted transcriptional regulator, BolA superfamily
          [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 84

 Score = 40.8 bits (94), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVP 76
          ++GDG+H+    + E F G +R+++ Q VY  L   +  N +HALSIK   P
Sbjct: 21 VSGDGSHFQVIAVGEMFDGMSRVKKQQAVYAPLMEYIADNRIHALSIKAFTP 72


>gi|213510814|ref|NP_001134857.1| BolA-like protein 3 [Salmo salar]
 gi|209736604|gb|ACI69171.1| BolA-like protein 3 [Salmo salar]
          Length = 105

 Score = 40.8 bits (94), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 3/71 (4%)

Query: 8   IEKMIKKGIPQSI-VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
           I  ++K+  P +  + + D++G  G  Y   I S EF+GK  +QQHQ+V  +L  ++   
Sbjct: 34  IAHILKEKFPSATSLKVVDISGGCGAMYEVHIESNEFKGKRTVQQHQLVNQALKEEI-QG 92

Query: 66  LHALSIKTSVP 76
           +H L I T VP
Sbjct: 93  MHGLRIFTDVP 103


>gi|162147679|ref|YP_001602140.1| BolA-like protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542304|ref|YP_002274533.1| BolA family protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786256|emb|CAP55838.1| BolA-like protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209529981|gb|ACI49918.1| BolA family protein [Gluconacetobacter diazotrophicus PAl 5]
          Length = 131

 Score = 40.8 bits (94), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 29/47 (61%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
            HY   ++S  F G +R+Q+ ++V+D L ++  + LHALS+    PD
Sbjct: 73  THYNILLVSGAFGGISRVQRSRLVHDLLADEFASGLHALSLTLRTPD 119


>gi|145633591|ref|ZP_01789319.1| transcriptional regulator [Haemophilus influenzae 3655]
 gi|145635288|ref|ZP_01790991.1| transcriptional regulator [Haemophilus influenzae PittAA]
 gi|148825568|ref|YP_001290321.1| transcriptional regulator [Haemophilus influenzae PittEE]
 gi|229847281|ref|ZP_04467384.1| transcriptional regulator [Haemophilus influenzae 7P49H1]
 gi|144985797|gb|EDJ92411.1| transcriptional regulator [Haemophilus influenzae 3655]
 gi|145267432|gb|EDK07433.1| transcriptional regulator [Haemophilus influenzae PittAA]
 gi|148715728|gb|ABQ97938.1| transcriptional regulator [Haemophilus influenzae PittEE]
 gi|229809824|gb|EEP45547.1| transcriptional regulator [Haemophilus influenzae 7P49H1]
          Length = 116

 Score = 40.8 bits (94), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 32/54 (59%)

Query: 24 HDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          H   G  +H+   I+S +F+   ++Q+HQ +Y  L  ++ +++HAL++    P+
Sbjct: 30 HSNRGSESHFKCVIVSADFKNIRKVQRHQRIYQLLNEELNHSIHALALHLFTPE 83


>gi|296228651|ref|XP_002759901.1| PREDICTED: bolA-like protein 1-like [Callithrix jacchus]
          Length = 137

 Score = 40.8 bits (94), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 29/49 (59%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           G   H+   ++S  F G + +Q+H++V+ +L  ++   +HAL+I+   P
Sbjct: 63  GSETHFRVAVVSSRFEGLSPLQRHRLVHTALAEELAGPVHALAIQARTP 111


>gi|27365171|ref|NP_760699.1| cell division protein BolA [Vibrio vulnificus CMCP6]
 gi|320155554|ref|YP_004187933.1| cell division protein BolA [Vibrio vulnificus MO6-24/O]
 gi|27361318|gb|AAO10226.1| Cell division protein BolA [Vibrio vulnificus CMCP6]
 gi|319930866|gb|ADV85730.1| cell division protein BolA [Vibrio vulnificus MO6-24/O]
          Length = 103

 Score = 40.8 bits (94), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 30/46 (65%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   ++S+ F GK  I +H++V  +L N++ N +HAL+I T
Sbjct: 33 GSESHFKVIVVSDLFEGKRLIARHRLVNQALANELENNIHALAIHT 78


>gi|302764300|ref|XP_002965571.1| hypothetical protein SELMODRAFT_143426 [Selaginella
          moellendorffii]
 gi|302802606|ref|XP_002983057.1| hypothetical protein SELMODRAFT_271608 [Selaginella
          moellendorffii]
 gi|300149210|gb|EFJ15866.1| hypothetical protein SELMODRAFT_271608 [Selaginella
          moellendorffii]
 gi|300166385|gb|EFJ32991.1| hypothetical protein SELMODRAFT_143426 [Selaginella
          moellendorffii]
          Length = 93

 Score = 40.8 bits (94), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 1  MSMNPHEIEKMIK-KGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          M +    +E+ +K K  P  +V I    G G  +  EI S  F GK  +++H++V  +L 
Sbjct: 1  MGVTKEGVEETLKAKLTPTHLVVIDTSGGCGASFDIEIASSNFEGKRLLERHRLVNAALA 60

Query: 60 NKMGNALHALSIKTSVPDSQ 79
           ++ + +HALSI+ ++   Q
Sbjct: 61 EELKD-IHALSIRKALTPKQ 79


>gi|323498701|ref|ZP_08103691.1| protein yrbA [Vibrio sinaloensis DSM 21326]
 gi|323316257|gb|EGA69278.1| protein yrbA [Vibrio sinaloensis DSM 21326]
          Length = 84

 Score = 40.8 bits (94), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPD 77
          G+G+HY    +   F G NR+++ Q++Y  L   +  N +HA+SIK   PD
Sbjct: 23 GEGSHYEVIAVDACFDGMNRVKKQQLIYAPLMEYIQRNDIHAVSIKAFTPD 73


>gi|332977706|gb|EGK14470.1| BolA family protein [Psychrobacter sp. 1501(2011)]
          Length = 84

 Score = 40.8 bits (94), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          MSMN  ++   ++   P++ +     A  GN +   ++   F GK  +Q+ Q VY  +G+
Sbjct: 1  MSMNADDLIAFLQPHYPEAFIQA---ANQGNKFDVRVVDASFEGKRLVQRQQAVYGLVGD 57

Query: 61 KMGNA-LHALSIKTSVP 76
           +    +HAL+I+   P
Sbjct: 58 IIARGDIHALNIQALTP 74


>gi|254507880|ref|ZP_05120010.1| cell division protein BolA [Vibrio parahaemolyticus 16]
 gi|219549253|gb|EED26248.1| cell division protein BolA [Vibrio parahaemolyticus 16]
          Length = 102

 Score = 40.8 bits (94), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 34/52 (65%), Gaps = 1/52 (1%)

Query: 23 IHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          +H++A G  +H+   I+SE+F G   I +H++V   L +++ N +HALSI T
Sbjct: 27 MHNVAPGSESHFKVIIVSEKFEGVRLIGRHRLVNQVLADELANHIHALSIHT 78


>gi|194429116|ref|ZP_03061646.1| BolA/YrbA family protein [Escherichia coli B171]
 gi|194412841|gb|EDX29133.1| BolA/YrbA family protein [Escherichia coli B171]
          Length = 89

 Score = 40.8 bits (94), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M  +EI+ ++   +  S+  +H ++GDG+H+    + E F G +R+++ Q VY  L   +
Sbjct: 6  MENNEIQSVLMNAL--SLQEVH-VSGDGSHFQVIAVGELFDGMSRVKKQQTVYGPLMEYI 62

Query: 63 G-NALHALSIKTSVP 76
            N +HA+SIK   P
Sbjct: 63 ADNRIHAVSIKAYTP 77


>gi|323162882|gb|EFZ48717.1| bolA-like family protein [Escherichia coli E128010]
          Length = 84

 Score = 40.8 bits (94), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M  +EI+ ++   +  S+  +H ++GDG+H+    + E F G +R+++ Q VY  L   +
Sbjct: 1  MENNEIQSVLMNAL--SLQEVH-VSGDGSHFQVIAVGELFDGMSRVKKQQTVYGPLMEYI 57

Query: 63 G-NALHALSIKTSVP 76
            N +HA+SIK   P
Sbjct: 58 ADNRIHAVSIKAYTP 72


>gi|229845156|ref|ZP_04465290.1| transcriptional regulator [Haemophilus influenzae 6P18H1]
 gi|229811867|gb|EEP47562.1| transcriptional regulator [Haemophilus influenzae 6P18H1]
          Length = 102

 Score = 40.8 bits (94), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 32/54 (59%)

Query: 24 HDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          H   G  +H+   I+S +F+   ++Q+HQ +Y  L  ++ +++HAL++    P+
Sbjct: 16 HSNRGSESHFKCVIVSADFKNIRKVQRHQRIYQLLNEELNHSIHALALHLFTPE 69


>gi|149374417|ref|ZP_01892191.1| BolA-like protein [Marinobacter algicola DG893]
 gi|149361120|gb|EDM49570.1| BolA-like protein [Marinobacter algicola DG893]
          Length = 114

 Score = 40.8 bits (94), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 28/46 (60%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+   ++S EF G+ ++++HQ +Y  L ++M   +HAL++    P
Sbjct: 37 THFKVTLVSPEFEGQGKVKRHQAIYKILADEMSGGVHALALHVYSP 82


>gi|269138345|ref|YP_003295045.1| transcriptional regulator BolA [Edwardsiella tarda EIB202]
 gi|267984005|gb|ACY83834.1| transcriptional regulator BolA [Edwardsiella tarda EIB202]
 gi|304558377|gb|ADM41041.1| Cell division protein BolA [Edwardsiella tarda FL6-60]
          Length = 108

 Score = 40.8 bits (94), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 31/47 (65%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG   H+   ++S+ F+G+  + +H+ +Y +L ++M + +HAL++ T
Sbjct: 32 AGSETHFKVVMVSDRFQGERFLSRHRAIYGALADEMADGVHALALHT 78


>gi|254492282|ref|ZP_05105456.1| BolA-like protein [Methylophaga thiooxidans DMS010]
 gi|224462607|gb|EEF78882.1| BolA-like protein [Methylophaga thiooxydans DMS010]
          Length = 89

 Score = 40.8 bits (94), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 30/48 (62%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G HY   I+S+ F G + IQ+H++V+  +   M + +HALSI+   P+
Sbjct: 37 GGHYNLFIVSDAFEGLSLIQRHRLVFAHVDALMQSQIHALSIQAKTPN 84


>gi|332220114|ref|XP_003259203.1| PREDICTED: bolA-like protein 1-like [Nomascus leucogenys]
 gi|332220116|ref|XP_003259204.1| PREDICTED: bolA-like protein 1-like [Nomascus leucogenys]
          Length = 137

 Score = 40.8 bits (94), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 29/50 (58%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           G   H+   ++S  F G + +Q+H++V+ +L  ++   +HAL+I+   P 
Sbjct: 63  GSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELAGPVHALAIQAQTPT 112


>gi|332305013|ref|YP_004432864.1| BolA family protein [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172342|gb|AEE21596.1| BolA family protein [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 85

 Score = 40.8 bits (94), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 43/72 (59%), Gaps = 4/72 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EIE+++ + +   +  +H + GDG+H+    +S++F   +R+++ Q VY  L + +
Sbjct: 1  MQNSEIEQLLMEKL--GLAEVH-VTGDGSHFQIIAVSDQFDDMSRVKRQQFVYAPLSDII 57

Query: 63 GN-ALHALSIKT 73
              +HA+SIKT
Sbjct: 58 AQGTMHAISIKT 69


>gi|195149419|ref|XP_002015655.1| GL11190 [Drosophila persimilis]
 gi|198456189|ref|XP_001360247.2| GA17237 [Drosophila pseudoobscura pseudoobscura]
 gi|194109502|gb|EDW31545.1| GL11190 [Drosophila persimilis]
 gi|198135525|gb|EAL24822.2| GA17237 [Drosophila pseudoobscura pseudoobscura]
          Length = 89

 Score = 40.8 bits (94), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 2/75 (2%)

Query: 4  NPHEIEKMIKKGIPQSIVTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          N   +E  +K+ +    V + D + G G  ++  I+SE F+GK  +Q+H++V  +L  ++
Sbjct: 5  NSKYLEDKLKQELEAKYVNVVDESDGCGGKFSVIIVSEAFKGKTLLQKHRLVNTTLAEEL 64

Query: 63 GNALHALSIKTSVPD 77
             +HA S K+  P+
Sbjct: 65 -KEIHAFSQKSYTPE 78


>gi|331006505|ref|ZP_08329804.1| Cell division protein BolA [gamma proteobacterium IMCC1989]
 gi|330419673|gb|EGG94040.1| Cell division protein BolA [gamma proteobacterium IMCC1989]
          Length = 118

 Score = 40.8 bits (94), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 30/46 (65%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+ A I+S+ F G   +Q+ Q VY+ L +++   +HAL+++T
Sbjct: 49 GSESHFKAIIVSDMFAGLRPVQRQQRVYEVLSDELAGGIHALTMQT 94


>gi|162451736|ref|YP_001614103.1| BolA-like protein [Sorangium cellulosum 'So ce 56']
 gi|161162318|emb|CAN93623.1| BolA-like protein [Sorangium cellulosum 'So ce 56']
          Length = 158

 Score = 40.8 bits (94), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           G   H+   ++SE FRG + + +H+ V D +  +  + LHAL+I+   PD
Sbjct: 79  GSETHFKVLVVSEAFRGLSPLDRHRRVNDLVREEFRSGLHALTIRAMTPD 128


>gi|149190599|ref|ZP_01868868.1| BolA/YrbA family protein [Vibrio shilonii AK1]
 gi|148835597|gb|EDL52565.1| BolA/YrbA family protein [Vibrio shilonii AK1]
          Length = 84

 Score = 40.8 bits (94), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 32/51 (62%), Gaps = 1/51 (1%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPD 77
          G+G+HY    +  +F G +R+++ QM+Y  L + +  N +HA+SIK   P+
Sbjct: 23 GEGSHYEVIAVDAQFEGMSRVKKQQMIYGPLMDYIQRNDIHAVSIKAYTPE 73


>gi|194036300|ref|XP_001926900.1| PREDICTED: bolA-like protein 1-like isoform 1 [Sus scrofa]
 gi|311254402|ref|XP_003125828.1| PREDICTED: bolA-like protein 1-like isoform 2 [Sus scrofa]
          Length = 137

 Score = 40.8 bits (94), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 29/49 (59%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           G   H+   ++S  F G + +Q+H++V+ +L  ++   +HAL+I+   P
Sbjct: 63  GSETHFRVAVVSSRFEGLSPLQRHRLVHTALSEELAGPVHALAIQARTP 111


>gi|146310563|ref|YP_001175637.1| transcriptional regulator BolA [Enterobacter sp. 638]
 gi|145317439|gb|ABP59586.1| transcriptional regulator, BolA protein family [Enterobacter sp.
          638]
          Length = 105

 Score = 40.8 bits (94), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+M+Y +L  ++   +HAL++ T
Sbjct: 33 AGSESHFKVVLVSDRFAGERFLNRHRMIYGTLTEELSTTVHALALHT 79


>gi|109015979|ref|XP_001096955.1| PREDICTED: bolA-like protein 1 isoform 2 [Macaca mulatta]
          Length = 137

 Score = 40.8 bits (94), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 29/49 (59%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           G   H+   ++S  F G + +Q+H++V+ +L  ++   +HAL+I+   P
Sbjct: 63  GSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELAGPVHALAIQARTP 111


>gi|311694078|gb|ADP96951.1| BolA-like protein [marine bacterium HP15]
          Length = 118

 Score = 40.4 bits (93), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 28/47 (59%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           H+   ++S EF G+ R+++HQ +Y  L  ++   +HAL++    P+
Sbjct: 37 THFKVTLVSPEFEGQMRVRRHQAIYKVLAEELAGPVHALALHLYSPE 83


>gi|242240295|ref|YP_002988476.1| BolA family protein [Dickeya dadantii Ech703]
 gi|242132352|gb|ACS86654.1| BolA family protein [Dickeya dadantii Ech703]
          Length = 104

 Score = 40.4 bits (93), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 30/50 (60%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          AG  +H+   ++SE F G+  I +H+ +Y  L +++  A+HAL++    P
Sbjct: 32 AGSESHFKVVLVSEHFNGERVIGRHRAIYKVLADELEGAVHALALHVYTP 81


>gi|86147568|ref|ZP_01065878.1| BolA/YrbA family protein [Vibrio sp. MED222]
 gi|148977761|ref|ZP_01814317.1| BolA/YrbA family protein [Vibrionales bacterium SWAT-3]
 gi|218710665|ref|YP_002418286.1| putative BolA family transcriptional regulator [Vibrio splendidus
          LGP32]
 gi|85834607|gb|EAQ52755.1| BolA/YrbA family protein [Vibrio sp. MED222]
 gi|145962975|gb|EDK28245.1| BolA/YrbA family protein [Vibrionales bacterium SWAT-3]
 gi|218323684|emb|CAV20012.1| putative transcriptional regulator (BolA family) [Vibrio
          splendidus LGP32]
          Length = 84

 Score = 40.4 bits (93), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPD 77
          G+G+HY    +   F G NR+++ Q++Y  L   +  N +HALSIK   P+
Sbjct: 23 GEGSHYEVVAVDPCFDGMNRVKKQQLIYGPLMEYIQRNDIHALSIKAFTPE 73


>gi|84387820|ref|ZP_00990835.1| BolA/YrbA family protein [Vibrio splendidus 12B01]
 gi|84377335|gb|EAP94203.1| BolA/YrbA family protein [Vibrio splendidus 12B01]
          Length = 84

 Score = 40.4 bits (93), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPD 77
          G+G+HY    +   F G NR+++ Q++Y  L   +  N +HALSIK   P+
Sbjct: 23 GEGSHYEVVAVDACFDGMNRVKKQQLIYGPLMEYIQRNDIHALSIKAFTPE 73


>gi|283834246|ref|ZP_06353987.1| BolA protein [Citrobacter youngae ATCC 29220]
 gi|291069766|gb|EFE07875.1| BolA protein [Citrobacter youngae ATCC 29220]
          Length = 105

 Score = 40.4 bits (93), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+M+Y +L  ++   +HAL++ T
Sbjct: 33 AGSESHFKVVLVSDRFTGERFLNRHRMIYGTLTAELSTTVHALALHT 79


>gi|219112109|ref|XP_002177806.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217410691|gb|EEC50620.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 114

 Score = 40.4 bits (93), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 28/41 (68%)

Query: 29  DGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHAL 69
           +G+H + E+++E F GK  +Q+ QMVY ++  ++   +HA+
Sbjct: 63  NGSHISIEVVAEAFAGKRPVQRQQMVYKAIWEELKGPVHAV 103


>gi|222149982|ref|YP_002550939.1| stress induced morphogen [Agrobacterium vitis S4]
 gi|221736964|gb|ACM37927.1| stress induced morphogen [Agrobacterium vitis S4]
          Length = 98

 Score = 40.4 bits (93), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 25 DLAGDG-NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          D+ G G  H    IIS  F G +R+ +H+ V D L  ++   LHAL+I+ S P
Sbjct: 40 DMTGTGETHMRVRIISGSFTGLSRLARHRAVTDLLKPELDAGLHALAIEPSAP 92


>gi|113969276|ref|YP_733069.1| transcriptional regulator BolA [Shewanella sp. MR-4]
 gi|113883960|gb|ABI38012.1| transcriptional regulator BolA [Shewanella sp. MR-4]
          Length = 106

 Score = 40.4 bits (93), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 28/42 (66%)

Query: 32 HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          H+   ++S+EF G   + +H++V + L +++ N +HALSI T
Sbjct: 45 HFKVVVVSDEFEGLRLLARHRLVNNCLADELANGVHALSIHT 86


>gi|288550452|ref|ZP_05970493.2| BolA/YrbA family protein [Enterobacter cancerogenus ATCC 35316]
 gi|288315283|gb|EFC54221.1| BolA/YrbA family protein [Enterobacter cancerogenus ATCC 35316]
          Length = 97

 Score = 40.4 bits (93), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVP 76
          ++GDG+H+    + E F G +R+++ Q VY  L   +  N +HALSIK   P
Sbjct: 34 VSGDGSHFQVIAVGEIFDGMSRVKKQQAVYAPLMEYIADNRIHALSIKAFTP 85


>gi|71901985|ref|ZP_00684034.1| BolA-like protein [Xylella fastidiosa Ann-1]
 gi|71728252|gb|EAO30434.1| BolA-like protein [Xylella fastidiosa Ann-1]
          Length = 90

 Score = 40.4 bits (93), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 24 HDLAGDGN-HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
          H  A DG  H++  I++  F GK  + +H+ VY +LG+ M   +HALSI+  V + +
Sbjct: 32 HPGARDGRGHFSVLIVTPMFAGKTLLARHRAVYAALGSMMKTDIHALSIQALVDEGE 88


>gi|167855787|ref|ZP_02478540.1| stress-induced morphogen [Haemophilus parasuis 29755]
 gi|167853066|gb|EDS24327.1| stress-induced morphogen [Haemophilus parasuis 29755]
          Length = 103

 Score = 40.4 bits (93), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G  +H+   ++SE F  K  +  HQ VY  L  ++ N +HAL++    P 
Sbjct: 34 GSESHFKVTMVSELFENKRPVACHQAVYTCLAEELANGVHALALHLYTPT 83


>gi|50420351|ref|XP_458709.1| DEHA2D05566p [Debaryomyces hansenii CBS767]
 gi|49654376|emb|CAG86851.1| DEHA2D05566p [Debaryomyces hansenii]
          Length = 133

 Score = 40.4 bits (93), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-ALHALSIKTSVPD 77
           +H+  EI+S+EF GK+   +H++VY  L ++  N  LHAL++KT   +
Sbjct: 78  SHFTMEIVSDEFIGKSMPSRHRIVYQLLDDEFKNKGLHALTMKTKTAE 125


>gi|55588110|ref|XP_513766.1| PREDICTED: hypothetical protein LOC457263 isoform 3 [Pan
           troglodytes]
 gi|114559184|ref|XP_001166564.1| PREDICTED: bolA-like 1 isoform 1 [Pan troglodytes]
 gi|114559186|ref|XP_001166599.1| PREDICTED: hypothetical protein LOC457263 isoform 2 [Pan
           troglodytes]
          Length = 137

 Score = 40.4 bits (93), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 29/49 (59%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           G   H+   ++S  F G + +Q+H++V+ +L  ++   +HAL+I+   P
Sbjct: 63  GSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELAGPVHALAIQARTP 111


>gi|297538003|ref|YP_003673772.1| BolA family protein [Methylotenera sp. 301]
 gi|297257350|gb|ADI29195.1| BolA family protein [Methylotenera sp. 301]
          Length = 86

 Score = 40.4 bits (93), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 29/48 (60%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G H+  +I S  F  K++I +H+++Y +L   + + +HALSI    PD
Sbjct: 37 GGHFKLKITSSHFSEKSQIMRHRIIYQALAELIPSKIHALSIHALAPD 84


>gi|145352948|ref|XP_001420795.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144581030|gb|ABO99088.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 87

 Score = 40.4 bits (93), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 40/66 (60%), Gaps = 3/66 (4%)

Query: 8  IEKM---IKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN 64
          +E+M   I +G+    V + D +G+  H + +++S+ F GK+ + + +MVY  +  ++ +
Sbjct: 11 VEQMRGKIAEGLEADAVDVRDESGNARHVSIKVVSKAFEGKSSVNRQRMVYKCIWMELQD 70

Query: 65 ALHALS 70
           +HA++
Sbjct: 71 QVHAVN 76


>gi|71066339|ref|YP_265066.1| transcriptional regulator BolA [Psychrobacter arcticus 273-4]
 gi|71039324|gb|AAZ19632.1| transcriptional regulator BolA [Psychrobacter arcticus 273-4]
          Length = 114

 Score = 40.4 bits (93), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVY---DSLGNKMGNALHALSIKTSVP 76
          G  +H+   ++SE F GK  + +HQMVY   D+L    G  +HAL+I    P
Sbjct: 44 GKESHFKLIMVSEAFTGKRLVARHQMVYHLADALLTSQGGQIHALAIHAYTP 95


>gi|330504068|ref|YP_004380937.1| transcriptional regulator BolA [Pseudomonas mendocina NK-01]
 gi|328918354|gb|AEB59185.1| transcriptional regulator BolA [Pseudomonas mendocina NK-01]
          Length = 101

 Score = 40.4 bits (93), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G   HY A I+S  F   N +++HQ VY ++G  MG  +HAL++ T  P
Sbjct: 31 GLETHYKAVIVSSAFAELNAVKRHQKVYATVGELMGQ-IHALALHTYTP 78


>gi|16759426|ref|NP_455043.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Typhi str. CT18]
 gi|16763827|ref|NP_459442.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Typhimurium str. LT2]
 gi|29142802|ref|NP_806144.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Typhi str. Ty2]
 gi|56414398|ref|YP_151473.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. ATCC 9150]
 gi|161504377|ref|YP_001571489.1| transcriptional regulator BolA [Salmonella enterica subsp.
          arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|161615362|ref|YP_001589327.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Paratyphi B str. SPB7]
 gi|167551740|ref|ZP_02345493.1| protein BolA [Salmonella enterica subsp. enterica serovar
          Saintpaul str. SARA29]
 gi|168231433|ref|ZP_02656491.1| protein BolA [Salmonella enterica subsp. enterica serovar
          Kentucky str. CDC 191]
 gi|168237559|ref|ZP_02662617.1| protein BolA [Salmonella enterica subsp. enterica serovar
          Schwarzengrund str. SL480]
 gi|168240271|ref|ZP_02665203.1| protein BolA [Salmonella enterica subsp. enterica serovar
          Heidelberg str. SL486]
 gi|168261119|ref|ZP_02683092.1| protein BolA [Salmonella enterica subsp. enterica serovar Hadar
          str. RI_05P066]
 gi|168465538|ref|ZP_02699420.1| protein BolA [Salmonella enterica subsp. enterica serovar Newport
          str. SL317]
 gi|168818944|ref|ZP_02830944.1| protein BolA [Salmonella enterica subsp. enterica serovar
          Weltevreden str. HI_N05-537]
 gi|194442852|ref|YP_002039689.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Newport str. SL254]
 gi|194447317|ref|YP_002044481.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Heidelberg str. SL476]
 gi|194470832|ref|ZP_03076816.1| protein BolA [Salmonella enterica subsp. enterica serovar
          Kentucky str. CVM29188]
 gi|194734965|ref|YP_002113477.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Schwarzengrund str. CVM19633]
 gi|197248768|ref|YP_002145427.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Agona str. SL483]
 gi|197265922|ref|ZP_03165996.1| protein BolA [Salmonella enterica subsp. enterica serovar
          Saintpaul str. SARA23]
 gi|197363318|ref|YP_002142955.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. AKU_12601]
 gi|198242918|ref|YP_002214400.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Dublin str. CT_02021853]
 gi|200390073|ref|ZP_03216684.1| protein BolA [Salmonella enterica subsp. enterica serovar Virchow
          str. SL491]
 gi|205351757|ref|YP_002225558.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Gallinarum str. 287/91]
 gi|207855926|ref|YP_002242577.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Enteritidis str. P125109]
 gi|213023413|ref|ZP_03337860.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Typhi str. 404ty]
 gi|213161816|ref|ZP_03347526.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Typhi str. E00-7866]
 gi|213419492|ref|ZP_03352558.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Typhi str. E01-6750]
 gi|213425860|ref|ZP_03358610.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Typhi str. E02-1180]
 gi|213580886|ref|ZP_03362712.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Typhi str. E98-0664]
 gi|213616066|ref|ZP_03371892.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Typhi str. E98-2068]
 gi|213646007|ref|ZP_03376060.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Typhi str. J185]
 gi|213853066|ref|ZP_03382598.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Typhi str. M223]
 gi|238911422|ref|ZP_04655259.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Tennessee str. CDC07-0191]
 gi|289804092|ref|ZP_06534721.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Typhi str. AG3]
 gi|289827301|ref|ZP_06545984.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Typhi str. E98-3139]
 gi|25300378|pir||AI0557 BolA protein [imported] - Salmonella enterica subsp. enterica
          serovar Typhi (strain CT18)
 gi|16418953|gb|AAL19401.1| morphogene; putative regulator of murein genes (BolA family)
          [Salmonella enterica subsp. enterica serovar
          Typhimurium str. LT2]
 gi|16501717|emb|CAD08905.1| BolA protein [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29138434|gb|AAO70004.1| BolA protein [Salmonella enterica subsp. enterica serovar Typhi
          str. Ty2]
 gi|56128655|gb|AAV78161.1| BolA protein [Salmonella enterica subsp. enterica serovar
          Paratyphi A str. ATCC 9150]
 gi|160865724|gb|ABX22347.1| hypothetical protein SARI_02488 [Salmonella enterica subsp.
          arizonae serovar 62:z4,z23:--]
 gi|161364726|gb|ABX68494.1| hypothetical protein SPAB_03133 [Salmonella enterica subsp.
          enterica serovar Paratyphi B str. SPB7]
 gi|194401515|gb|ACF61737.1| protein BolA [Salmonella enterica subsp. enterica serovar Newport
          str. SL254]
 gi|194405621|gb|ACF65840.1| protein BolA [Salmonella enterica subsp. enterica serovar
          Heidelberg str. SL476]
 gi|194457196|gb|EDX46035.1| protein BolA [Salmonella enterica subsp. enterica serovar
          Kentucky str. CVM29188]
 gi|194710467|gb|ACF89688.1| protein BolA [Salmonella enterica subsp. enterica serovar
          Schwarzengrund str. CVM19633]
 gi|195631964|gb|EDX50484.1| protein BolA [Salmonella enterica subsp. enterica serovar Newport
          str. SL317]
 gi|197094795|emb|CAR60328.1| BolA protein [Salmonella enterica subsp. enterica serovar
          Paratyphi A str. AKU_12601]
 gi|197212471|gb|ACH49868.1| protein BolA [Salmonella enterica subsp. enterica serovar Agona
          str. SL483]
 gi|197244177|gb|EDY26797.1| protein BolA [Salmonella enterica subsp. enterica serovar
          Saintpaul str. SARA23]
 gi|197289573|gb|EDY28936.1| protein BolA [Salmonella enterica subsp. enterica serovar
          Schwarzengrund str. SL480]
 gi|197937434|gb|ACH74767.1| protein BolA [Salmonella enterica subsp. enterica serovar Dublin
          str. CT_02021853]
 gi|199602518|gb|EDZ01064.1| protein BolA [Salmonella enterica subsp. enterica serovar Virchow
          str. SL491]
 gi|205271538|emb|CAR36356.1| BolA protein [Salmonella enterica subsp. enterica serovar
          Gallinarum str. 287/91]
 gi|205323408|gb|EDZ11247.1| protein BolA [Salmonella enterica subsp. enterica serovar
          Saintpaul str. SARA29]
 gi|205334069|gb|EDZ20833.1| protein BolA [Salmonella enterica subsp. enterica serovar
          Kentucky str. CDC 191]
 gi|205340222|gb|EDZ26986.1| protein BolA [Salmonella enterica subsp. enterica serovar
          Heidelberg str. SL486]
 gi|205343965|gb|EDZ30729.1| protein BolA [Salmonella enterica subsp. enterica serovar
          Weltevreden str. HI_N05-537]
 gi|205349843|gb|EDZ36474.1| protein BolA [Salmonella enterica subsp. enterica serovar Hadar
          str. RI_05P066]
 gi|206707729|emb|CAR32014.1| BolA protein [Salmonella enterica subsp. enterica serovar
          Enteritidis str. P125109]
 gi|261245729|emb|CBG23526.1| BolA protein [Salmonella enterica subsp. enterica serovar
          Typhimurium str. D23580]
 gi|267992160|gb|ACY87045.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Typhimurium str. 14028S]
 gi|301157057|emb|CBW16541.1| BolA protein [Salmonella enterica subsp. enterica serovar
          Typhimurium str. SL1344]
 gi|312911479|dbj|BAJ35453.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Typhimurium str. T000240]
 gi|320084720|emb|CBY94511.1| Protein bolA [Salmonella enterica subsp. enterica serovar
          Weltevreden str. 2007-60-3289-1]
 gi|321226024|gb|EFX51075.1| Cell division protein BolA [Salmonella enterica subsp. enterica
          serovar Typhimurium str. TN061786]
 gi|322614724|gb|EFY11653.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. 315996572]
 gi|322618830|gb|EFY15718.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. 495297-1]
 gi|322623537|gb|EFY20376.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. 495297-3]
 gi|322629165|gb|EFY25944.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. 495297-4]
 gi|322631885|gb|EFY28639.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. 515920-1]
 gi|322637378|gb|EFY34080.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. 515920-2]
 gi|322642063|gb|EFY38673.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. 531954]
 gi|322647882|gb|EFY44357.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322652560|gb|EFY48914.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. OH_2009072675]
 gi|322653278|gb|EFY49611.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322660573|gb|EFY56809.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. 19N]
 gi|322664725|gb|EFY60918.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. 81038-01]
 gi|322669222|gb|EFY65372.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. MD_MDA09249507]
 gi|322670767|gb|EFY66900.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. 414877]
 gi|322678994|gb|EFY75049.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. 366867]
 gi|322682022|gb|EFY78047.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. 413180]
 gi|322685149|gb|EFY81146.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. 446600]
 gi|323128766|gb|ADX16196.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Typhimurium str. 4/74]
 gi|323192958|gb|EFZ78181.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. 609458-1]
 gi|323196960|gb|EFZ82102.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. 556150-1]
 gi|323203945|gb|EFZ88962.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. 609460]
 gi|323206970|gb|EFZ91923.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. 507440-20]
 gi|323214173|gb|EFZ98931.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. 556152]
 gi|323214503|gb|EFZ99254.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB101509-0077]
 gi|323223061|gb|EGA07404.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB102109-0047]
 gi|323227009|gb|EGA11190.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB110209-0055]
 gi|323230173|gb|EGA14293.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB111609-0052]
 gi|323233911|gb|EGA18000.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. 2009083312]
 gi|323238395|gb|EGA22453.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. 2009085258]
 gi|323244083|gb|EGA28092.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. 315731156]
 gi|323246243|gb|EGA30226.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2009159199]
 gi|323251869|gb|EGA35732.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008282]
 gi|323257866|gb|EGA41545.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008283]
 gi|323261121|gb|EGA44713.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008284]
 gi|323264949|gb|EGA48448.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008285]
 gi|323272512|gb|EGA55919.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008287]
 gi|326622149|gb|EGE28494.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Dublin str. 3246]
 gi|326626792|gb|EGE33135.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Gallinarum str. 9]
 gi|332987395|gb|AEF06378.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Typhimurium str. UK-1]
          Length = 105

 Score = 40.4 bits (93), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+M+Y +L  ++   +HAL++ T
Sbjct: 33 AGSESHFKVVLVSDRFTGERFLNRHRMIYGTLTAELSTTVHALALHT 79


>gi|166712395|ref|ZP_02243602.1| hypothetical protein Xoryp_13305 [Xanthomonas oryzae pv.
          oryzicola BLS256]
          Length = 106

 Score = 40.4 bits (93), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 24 HDLAGDGN-HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          H  A DG  H+   +IS  F GK  + +H+ VY ++G  M   +HALSI+   P
Sbjct: 32 HAGARDGRGHFNVRVISAAFVGKPPLSRHRAVYAAVGEMMQTDIHALSIEAFAP 85


>gi|283784261|ref|YP_003364126.1| transcriptional regulator [Citrobacter rodentium ICC168]
 gi|282947715|emb|CBG87270.1| putative transcriptional regulator [Citrobacter rodentium ICC168]
          Length = 105

 Score = 40.4 bits (93), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+M+Y +L  ++   +HAL++ T
Sbjct: 33 AGSESHFKVVLVSDRFTGERFLNRHRMIYGTLTAELSTTVHALALHT 79


>gi|261884083|ref|ZP_06008122.1| hypothetical protein CfetvA_02216 [Campylobacter fetus subsp.
          venerealis str. Azul-94]
          Length = 75

 Score = 40.4 bits (93), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 35/54 (64%), Gaps = 1/54 (1%)

Query: 23 IHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           +D AG+  H+   I++E F G +R+Q+H+ + D L  ++ + +HAL+++ S P
Sbjct: 17 TYDGAGE-THFRIRIVAEAFTGMSRVQRHRAINDLLKEELESGVHALALEPSAP 69


>gi|157146948|ref|YP_001454267.1| transcriptional regulator BolA [Citrobacter koseri ATCC BAA-895]
 gi|157084153|gb|ABV13831.1| hypothetical protein CKO_02725 [Citrobacter koseri ATCC BAA-895]
          Length = 105

 Score = 40.4 bits (93), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+M+Y +L  ++   +HAL++ T
Sbjct: 33 AGSESHFKVVLVSDRFTGERFLNRHRMIYGTLTAELSTTVHALALHT 79


>gi|254293154|ref|YP_003059177.1| BolA family protein [Hirschia baltica ATCC 49814]
 gi|254041685|gb|ACT58480.1| BolA family protein [Hirschia baltica ATCC 49814]
          Length = 91

 Score = 40.4 bits (93), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 31/46 (67%)

Query: 32 HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          HY+ ++ S+ F G NR++ H+ + ++L ++  + LHALSI+   P+
Sbjct: 43 HYSIKVWSKSFEGMNRVEIHRKINETLQSEFDSGLHALSIRIVKPN 88


>gi|238785103|ref|ZP_04629098.1| hypothetical protein yberc0001_250 [Yersinia bercovieri ATCC
          43970]
 gi|238713995|gb|EEQ06012.1| hypothetical protein yberc0001_250 [Yersinia bercovieri ATCC
          43970]
          Length = 84

 Score = 40.4 bits (93), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+ +EI+ ++ + +  ++   H + GDG+H+   ++ E F   +R+++ Q VY  L   +
Sbjct: 1  MDTNEIKDVLMRAL--ALQEAH-VTGDGSHFQVIVVGELFADMSRVKKQQAVYAPLMEYI 57

Query: 63 G-NALHALSIKTSVP 76
            N +HALSIK   P
Sbjct: 58 ADNRIHALSIKAYTP 72


>gi|332289183|ref|YP_004420035.1| transcriptional regulator BolA [Gallibacterium anatis UMN179]
 gi|330432079|gb|AEC17138.1| transcriptional regulator BolA [Gallibacterium anatis UMN179]
          Length = 102

 Score = 40.4 bits (93), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 30/50 (60%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          GD +H+   I+SE F+    + +H++VY  L  ++ + +HAL++    P+
Sbjct: 34 GDESHFKLIIVSERFQAMRAVMRHRLVYQLLAQQLADGVHALALHLYDPE 83


>gi|119469177|ref|ZP_01612161.1| putative transcriptional regulator (BolA family) protein
          [Alteromonadales bacterium TW-7]
 gi|119447429|gb|EAW28697.1| putative transcriptional regulator (BolA family) protein
          [Alteromonadales bacterium TW-7]
          Length = 85

 Score = 40.4 bits (93), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   ++E ++++ +   +  +H +  +G+HY    + E F G +R+++ Q+VY  L N +
Sbjct: 1  METSQVETLLREEL--QLAEVH-VKANGSHYEVVAVGECFDGLSRVKKQQLVYGPLMNTI 57

Query: 63 GN-ALHALSIKTSVP 76
           +  +HA+SI+   P
Sbjct: 58 SDGTIHAVSIRAFTP 72


>gi|295096778|emb|CBK85868.1| transcriptional regulator, BolA protein family [Enterobacter
          cloacae subsp. cloacae NCTC 9394]
          Length = 105

 Score = 40.4 bits (93), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+++Y +L  ++   +HAL++ T
Sbjct: 33 AGSESHFKVVLVSDRFTGERFLNRHRLIYSTLTEELSTTVHALALHT 79


>gi|170730715|ref|YP_001776148.1| morphogene BolA protein [Xylella fastidiosa M12]
 gi|167965508|gb|ACA12518.1| morphogene BolA protein [Xylella fastidiosa M12]
          Length = 106

 Score = 40.4 bits (93), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 24  HDLAGDG-NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
           H  A DG  H++  I++  F GK  + +H+ VY +LG+ M   +HALSI+  V + +
Sbjct: 48  HPGARDGRGHFSVLIVTPMFAGKTLLARHRAVYAALGSMMKTDIHALSIQALVDEGE 104


>gi|161506129|ref|YP_001573241.1| hypothetical protein SARI_04317 [Salmonella enterica subsp.
          arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160867476|gb|ABX24099.1| hypothetical protein SARI_04317 [Salmonella enterica subsp.
          arizonae serovar 62:z4,z23:--]
          Length = 97

 Score = 40.4 bits (93), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EI+ ++   +  S+  +H ++GDG+H+    + E F G +R+++ Q VY  L   +
Sbjct: 14 MENDEIQSVLMNAL--SLQEVH-VSGDGSHFQVIAVGEMFDGMSRVKKQQTVYGPLMEYI 70

Query: 63 G-NALHALSIKTSVP 76
            N +HA+SIK   P
Sbjct: 71 ADNRIHAVSIKAYTP 85


>gi|296101557|ref|YP_003611703.1| transcriptional regulator BolA [Enterobacter cloacae subsp.
          cloacae ATCC 13047]
 gi|295056016|gb|ADF60754.1| transcriptional regulator BolA [Enterobacter cloacae subsp.
          cloacae ATCC 13047]
          Length = 105

 Score = 40.4 bits (93), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+++Y +L  ++   +HAL++ T
Sbjct: 33 AGSESHFKVVLVSDRFTGERFLNRHRLIYSTLTEELSTTVHALALHT 79


>gi|156542317|ref|XP_001599467.1| PREDICTED: similar to conserved hypothetical protein [Nasonia
           vitripennis]
          Length = 101

 Score = 40.4 bits (93), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 45/70 (64%), Gaps = 3/70 (4%)

Query: 11  MIKKGIPQS-IVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHA 68
           +++   P++ ++ + D++G  G  +   +I+ EF+G N ++QH+++ + L  ++ + +H 
Sbjct: 33  LLRNKFPKAELIEVCDVSGGCGAMFEINVIAPEFKGLNTVKQHRIINEVLKEEIKD-MHG 91

Query: 69  LSIKTSVPDS 78
           + I T++PDS
Sbjct: 92  IRIHTAIPDS 101


>gi|62179058|ref|YP_215475.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Choleraesuis str. SC-B67]
 gi|62126691|gb|AAX64394.1| morphogene; putative regulator of murein genes (BolA family)
          [Salmonella enterica subsp. enterica serovar
          Choleraesuis str. SC-B67]
 gi|322713519|gb|EFZ05090.1| transcriptional regulator BolA [Salmonella enterica subsp.
          enterica serovar Choleraesuis str. A50]
          Length = 102

 Score = 40.4 bits (93), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+M+Y +L  ++   +HAL++ T
Sbjct: 30 AGSESHFKVVLVSDRFTGERFLNRHRMIYGTLTAELSTTVHALALHT 76


>gi|5305151|emb|CAB46189.1| BolA protein [Pseudomonas putida]
          Length = 68

 Score = 40.4 bits (93), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (64%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN 64
          G   H+ A ++S +F G NR+++HQ VY +LG  MG 
Sbjct: 31 GLQTHFKAVVVSRQFEGLNRVKRHQKVYGTLGELMGE 67


>gi|308198265|ref|XP_001386946.2| predicted protein [Scheffersomyces stipitis CBS 6054]
 gi|149388936|gb|EAZ62923.2| predicted protein [Pichia stipitis CBS 6054]
          Length = 109

 Score = 40.4 bits (93), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query: 32  HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-ALHALSIKT 73
           H+  E+IS EF GKN   +H+++Y  L +++ N  +HAL +KT
Sbjct: 59  HFRIEVISNEFEGKNMPTRHRLIYSLLDDELKNKGVHALQMKT 101


>gi|46124399|ref|XP_386753.1| hypothetical protein FG06577.1 [Gibberella zeae PH-1]
          Length = 138

 Score = 40.4 bits (93), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 47/77 (61%), Gaps = 4/77 (5%)

Query: 2   SMNPHE--IEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSL 58
           SM+P E  I +++ + +  + + + D++G  G+ YA +I S  F+G+  ++Q +MV  +L
Sbjct: 62  SMSPAEAAIAEILSEKLSPTELLVQDVSGGCGSMYAIDITSPAFKGQTILKQQRMVNAAL 121

Query: 59  GNKMGNALHALSIKTSV 75
           G+ +  + H + I+T V
Sbjct: 122 GD-LVKSWHGVQIRTKV 137


>gi|170766069|ref|ZP_02900880.1| BolA/YrbA family protein [Escherichia albertii TW07627]
 gi|170125215|gb|EDS94146.1| BolA/YrbA family protein [Escherichia albertii TW07627]
          Length = 84

 Score = 40.4 bits (93), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M  +EI+ ++   +  S+  +H ++GDG+H+    + E F G +R+++ Q +Y  L   +
Sbjct: 1  MENNEIQSVLMNAL--SLQEVH-VSGDGSHFQVIAVGEMFDGMSRVKKQQTIYGPLMEYI 57

Query: 63 G-NALHALSIKTSVP 76
            N +HA+SIK   P
Sbjct: 58 ADNRIHAVSIKAYTP 72


>gi|332531912|ref|ZP_08407796.1| protein YrbA [Pseudoalteromonas haloplanktis ANT/505]
 gi|332038539|gb|EGI74982.1| protein YrbA [Pseudoalteromonas haloplanktis ANT/505]
          Length = 85

 Score = 40.4 bits (93), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   ++E ++++ +   +  +H +  +G+HY    + E F G +R+++ Q+VY  L N +
Sbjct: 1  METSQVETLLREEL--QLAEVH-VKANGSHYEVVAVGECFDGLSRVKKQQLVYGPLMNTI 57

Query: 63 GN-ALHALSIKTSVP 76
           +  +HA+SI+   P
Sbjct: 58 SDGTIHAVSIRAFTP 72


>gi|268569856|ref|XP_002640632.1| Hypothetical protein CBG08750 [Caenorhabditis briggsae]
 gi|187032414|emb|CAP28521.1| hypothetical protein CBG_08750 [Caenorhabditis briggsae AF16]
          Length = 106

 Score = 40.4 bits (93), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 45/75 (60%), Gaps = 3/75 (4%)

Query: 1   MSMNPHEIEKMIKKGIP-QSIVTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSL 58
           MS    ++ K++ +GI   S V +HD++ G G+ Y   + +  F+GK+++ QH++V   L
Sbjct: 30  MSEAEQKMSKLLNEGIQGCSRVEVHDVSNGCGSMYDVVVEASSFQGKSKVAQHKIVTSIL 89

Query: 59  GNKMGNALHALSIKT 73
             ++   +H L+IKT
Sbjct: 90  SEQI-KGMHGLTIKT 103


>gi|313870797|gb|ADR82289.1| hypothetical protein [Blumeria graminis f. sp. tritici]
          Length = 167

 Score = 40.4 bits (93), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query: 3   MNP--HEIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
           +NP   EI +++ + +  S++ + D++G  G+ Y   ++S  FRG   +QQ ++V   LG
Sbjct: 92  LNPAEKEIYQLLARELEPSVLKVQDISGGCGSMYEIHVVSARFRGLRMLQQQRLVNSILG 151

Query: 60  NKMGNALHALSIKTS 74
           + M    H + + TS
Sbjct: 152 D-MLKKWHGMRLTTS 165


>gi|255712968|ref|XP_002552766.1| KLTH0D00968p [Lachancea thermotolerans]
 gi|238934146|emb|CAR22328.1| KLTH0D00968p [Lachancea thermotolerans]
          Length = 87

 Score = 40.4 bits (93), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 45/77 (58%), Gaps = 6/77 (7%)

Query: 1  MSMNPHE---IEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYD 56
          +S  P E    EK+ K+  PQ I  + D++G  G+ +A +I SE+F+G + ++QH++V  
Sbjct: 10 LSFTPEEKLVYEKLTKQLKPQQI-EVRDISGGCGSMFAIDITSEKFKGLSMVKQHKLVNK 68

Query: 57 SLGNKMGNALHALSIKT 73
           L + +    H L ++T
Sbjct: 69 VLQDDI-KRWHGLQLRT 84


>gi|264679102|ref|YP_003279009.1| BolA-like protein [Comamonas testosteroni CNB-2]
 gi|262209615|gb|ACY33713.1| BolA-like protein [Comamonas testosteroni CNB-2]
          Length = 88

 Score = 40.4 bits (93), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 28/47 (59%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          +G G H+   I    F GK R+ +H++VYD+L + +    HA++I+ 
Sbjct: 41 SGVGTHFRVRIAGPAFDGKTRVARHRLVYDALQDFIDQGAHAIAIEV 87


>gi|50302445|ref|XP_451157.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49640288|emb|CAH02745.1| KLLA0A03575p [Kluyveromyces lactis]
          Length = 120

 Score = 40.4 bits (93), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 29/47 (61%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           +H+  EI+S  F+GK+   +H+MVY  L  +  + +HAL + T  P+
Sbjct: 65  SHFRLEIVSGLFKGKSLPMRHRMVYGMLNEEFDDGVHALQLTTKTPE 111


>gi|301168816|emb|CBW28407.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Haemophilus influenzae
          10810]
          Length = 103

 Score = 40.4 bits (93), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 31/54 (57%)

Query: 24 HDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          H   G  +H+   I+S  F+   ++Q+HQ +Y  L  ++ +++HAL++    P+
Sbjct: 30 HSNRGSESHFKCVIVSAAFKNIRKVQRHQRIYQLLNEELNHSIHALALHLFTPE 83


>gi|74317549|ref|YP_315289.1| putative stress-induced morphogen BolA [Thiobacillus
          denitrificans ATCC 25259]
 gi|74057044|gb|AAZ97484.1| putative stress-induced morphogen BolA [Thiobacillus
          denitrificans ATCC 25259]
          Length = 87

 Score = 40.4 bits (93), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          +   I+S  FR  + + +H++VYD++G  M   +HALS+    P+
Sbjct: 41 FRLTIVSPRFRNLSTLARHRLVYDAMGELMQREIHALSVTALTPE 85


>gi|90022813|ref|YP_528640.1| toluene-tolerance protein [Saccharophagus degradans 2-40]
 gi|89952413|gb|ABD82428.1| BolA-like protein [Saccharophagus degradans 2-40]
          Length = 80

 Score = 40.4 bits (93), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MN  +I+ +I+  IP+S V       DG+H    ++S  F G   +++ Q+VY  L + +
Sbjct: 1  MNQDDIKALIESSIPESQVQAQI---DGSHVHLVVVSPAFEGLMPVKKQQLVYACLQDSI 57

Query: 63 GN-ALHALSIKTSVP 76
           + A+HA+ ++T  P
Sbjct: 58 ASGAIHAVHMQTFTP 72


>gi|116788620|gb|ABK24942.1| unknown [Picea sitchensis]
          Length = 93

 Score = 40.4 bits (93), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIK-TSVP 76
          G G  +A EI+S +F GK  + +H+MV  +L  ++   +HALS+K T  P
Sbjct: 29 GCGTSFAVEIVSSQFDGKRSLDRHRMVNSALAEELKR-IHALSLKMTRTP 77


>gi|115675684|ref|XP_001185918.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
 gi|115950685|ref|XP_001179680.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
          Length = 89

 Score = 40.4 bits (93), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 40/75 (53%), Gaps = 3/75 (4%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHD--LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSL 58
          M +    +EK ++     S V + D    G G  ++  I+SE+F GK  +Q+H++V   L
Sbjct: 1  MEITAEILEKKLRDEFQASHVEVIDETTGGCGQKFSTVIVSEKFEGKPLLQRHRLVNSCL 60

Query: 59 GNKMGNALHALSIKT 73
            ++   +HA S+KT
Sbjct: 61 AEEL-KTIHAFSMKT 74


>gi|301789702|ref|XP_002930266.1| PREDICTED: bolA-like protein 1-like [Ailuropoda melanoleuca]
 gi|281346201|gb|EFB21785.1| hypothetical protein PANDA_020655 [Ailuropoda melanoleuca]
          Length = 137

 Score = 40.0 bits (92), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 29/49 (59%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           G   H+   ++S  F G + +Q+H++V+ +L  ++   +HAL+I+   P
Sbjct: 63  GSETHFRVAVVSSRFEGLSPLQRHRLVHAALSEELAGPVHALAIQARTP 111


>gi|77735657|ref|NP_001029524.1| bolA-like protein 1 [Bos taurus]
 gi|110278897|sp|Q3T138|BOLA1_BOVIN RecName: Full=BolA-like protein 1
 gi|74354877|gb|AAI02141.1| BolA homolog 1 (E. coli) [Bos taurus]
 gi|296489548|gb|DAA31661.1| bolA-like protein 1 [Bos taurus]
          Length = 135

 Score = 40.0 bits (92), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 29/49 (59%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           G   H+   ++S  F G + +Q+H++V+ +L  ++   +HAL+I+   P
Sbjct: 63  GSETHFRVAVVSSRFEGLSPLQRHRLVHAALSEELAGPVHALAIQARTP 111


>gi|330946379|ref|XP_003306760.1| hypothetical protein PTT_19971 [Pyrenophora teres f. teres 0-1]
 gi|311315623|gb|EFQ85151.1| hypothetical protein PTT_19971 [Pyrenophora teres f. teres 0-1]
          Length = 123

 Score = 40.0 bits (92), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 8   IEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
           ++K +++G+  + V I DL+G  G  Y A I+S +F  K  + +H++V  +L  ++  A+
Sbjct: 46  LKKKLEQGLGATYVEIEDLSGGCGQMYEAIIVSPQFAKKTTLARHRLVNTTLKEEIA-AI 104

Query: 67  HALSIKTSVPD 77
           HA + K   P+
Sbjct: 105 HAWTPKCHTPE 115


>gi|189191724|ref|XP_001932201.1| BolA domain containing protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187973807|gb|EDU41306.1| BolA domain containing protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 123

 Score = 40.0 bits (92), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 8   IEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
           ++K +++G+  + V I DL+G  G  Y A I+S +F  K  + +H++V  +L  ++  A+
Sbjct: 46  LKKKLEQGLGATYVEIEDLSGGCGQMYEAIIVSPQFAKKTTLARHRLVNTTLKEEIA-AI 104

Query: 67  HALSIKTSVPD 77
           HA + K   P+
Sbjct: 105 HAWTPKCHTPE 115


>gi|297797489|ref|XP_002866629.1| hypothetical protein ARALYDRAFT_332687 [Arabidopsis lyrata subsp.
          lyrata]
 gi|297312464|gb|EFH42888.1| hypothetical protein ARALYDRAFT_332687 [Arabidopsis lyrata subsp.
          lyrata]
          Length = 95

 Score = 40.0 bits (92), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 17 PQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIK 72
          P  +  I    G G  +  EI+SE+F GK  +++H++V  +L  +M   +HALSIK
Sbjct: 18 PVHLEVIDTSGGCGASFVIEIVSEQFEGKRLLERHRIVNAALEEEM-KEIHALSIK 72


>gi|255557192|ref|XP_002519627.1| UV-induced protein uvi31, putative [Ricinus communis]
 gi|223541217|gb|EEF42772.1| UV-induced protein uvi31, putative [Ricinus communis]
          Length = 304

 Score = 40.0 bits (92), Expect = 0.095,   Method: Composition-based stats.
 Identities = 16/45 (35%), Positives = 30/45 (66%)

Query: 32  HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+  +++S+EF GK+ +++H+++Y  L  ++   LHALSI    P
Sbjct: 254 HFNLKVVSKEFDGKSLVKRHRLIYGLLQEELQGGLHALSIVAKTP 298


>gi|39940840|ref|XP_359957.1| hypothetical protein MGG_11028 [Magnaporthe oryzae 70-15]
 gi|145010368|gb|EDJ95024.1| hypothetical protein MGG_11028 [Magnaporthe oryzae 70-15]
          Length = 110

 Score = 40.0 bits (92), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 44/81 (54%), Gaps = 7/81 (8%)

Query: 3  MNPHEI-EKMIKKGIPQSIVTIH----DLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYD 56
          M   EI E  IK  + Q +  IH    D++G  G  +   I+S EF GKN +++H++V  
Sbjct: 1  MAESEITEASIKDALTQRLKAIHAEVTDMSGGCGQAFTVLIVSSEFAGKNSLKRHRLVNA 60

Query: 57 SLGNKMGNALHALSIKTSVPD 77
          ++ +++   +HA + K   P+
Sbjct: 61 AMKDEIAR-IHAWTAKCQTPE 80


>gi|221066303|ref|ZP_03542408.1| BolA family protein [Comamonas testosteroni KF-1]
 gi|220711326|gb|EED66694.1| BolA family protein [Comamonas testosteroni KF-1]
          Length = 88

 Score = 40.0 bits (92), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 29/47 (61%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          +G G H+   I    F GK+R+ +H++VYD+L + +    HA++I+ 
Sbjct: 41 SGVGTHFRVRIAGPAFDGKSRVARHRLVYDALQDFIDQGAHAIAIEV 87


>gi|332304900|ref|YP_004432751.1| BolA family protein [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172229|gb|AEE21483.1| BolA family protein [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 104

 Score = 40.0 bits (92), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 29/46 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   I+S+EF GK  I +H+ V   L +++ N +HAL+I T
Sbjct: 34 GSESHFKVVIVSDEFAGKRLIGRHRAVNQVLADELANDIHALAIHT 79


>gi|149926467|ref|ZP_01914728.1| stress-induced morphogen BolA [Limnobacter sp. MED105]
 gi|149824830|gb|EDM84044.1| stress-induced morphogen BolA [Limnobacter sp. MED105]
          Length = 89

 Score = 40.0 bits (92), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTS 74
          G HY  ++ S  F G   + +H++VYD+L   M   +HAL+I ++
Sbjct: 38 GRHYRVKLKSARFNGLRTLARHRLVYDALAEWMKKEIHALAIDST 82


>gi|87119927|ref|ZP_01075823.1| BolA protein [Marinomonas sp. MED121]
 gi|86164629|gb|EAQ65898.1| BolA protein [Marinomonas sp. MED121]
          Length = 101

 Score = 40.0 bits (92), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 30/44 (68%), Gaps = 1/44 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSI 71
          G  +H+   ++S++F GK  +Q+HQM+Y  L  +M + +HAL++
Sbjct: 34 GSESHFKLTLVSDDFAGKRLVQRHQMIYKLLAKQM-DLIHALAL 76


>gi|293609215|ref|ZP_06691518.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292829788|gb|EFF88150.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325124596|gb|ADY84119.1| NAD-dependent DNA ligase LigA [Acinetobacter calcoaceticus
          PHEA-2]
          Length = 83

 Score = 40.0 bits (92), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 41/76 (53%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MN  ++ +++K+  P++ V +   +G    +   I+ ++F GK  + + Q+VY  L   +
Sbjct: 1  MNSEQLTQILKEAFPEAEVAV---SGQAGKFDLRIVDDQFDGKRTVARQQLVYAPLNTYI 57

Query: 63 GNA-LHALSIKTSVPD 77
           +  +HA++I+    D
Sbjct: 58 ASGEVHAVTIRAMTKD 73


>gi|154323330|ref|XP_001560979.1| hypothetical protein BC1G_00064 [Botryotinia fuckeliana B05.10]
 gi|150842293|gb|EDN17486.1| hypothetical protein BC1G_00064 [Botryotinia fuckeliana B05.10]
          Length = 179

 Score = 40.0 bits (92), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN--ALHALSIKTSVPDSQ 79
            H+  EI+SE F  K +  +H+MVY  L  +M     +HAL +KT  P+ +
Sbjct: 117 THFRVEIVSEAFTKKMQPARHRMVYALLKEEMAKEGGIHALQLKTRTPEEE 167


>gi|315121778|ref|YP_004062267.1| BolA family protein [Candidatus Liberibacter solanacearum
          CLso-ZC1]
 gi|313495180|gb|ADR51779.1| BolA family protein [Candidatus Liberibacter solanacearum
          CLso-ZC1]
          Length = 101

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 28 GDG-NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
          G G  H   ++IS++F G N + +H+++Y+ L  ++ + LHALSI+   PD +
Sbjct: 43 GSGETHIRIKVISKQFIGMNLLSRHKIIYELLKVEIKDELHALSIEAFSPDEK 95


>gi|27904836|ref|NP_777962.1| YrbA [Buchnera aphidicola str. Bp (Baizongia pistaciae)]
 gi|38372578|sp|Q89AF0|Y348_BUCBP RecName: Full=Uncharacterized protein bbp_348
 gi|27904234|gb|AAO27067.1| YrbA [Buchnera aphidicola str. Bp (Baizongia pistaciae)]
          Length = 79

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 39/69 (56%), Gaps = 4/69 (5%)

Query: 6  HEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN- 64
          + I+ ++KK IP +++    + GD  H     +S+ F   N +++ Q++Y  L   + N 
Sbjct: 5  NTIKSLLKKKIPLTVI---HVTGDNKHINITAVSDIFNNINTLRRQQIIYKPLMPYIINK 61

Query: 65 ALHALSIKT 73
           LHA+SIKT
Sbjct: 62 TLHAISIKT 70


>gi|227112745|ref|ZP_03826401.1| putative bolA family protein [Pectobacterium carotovorum subsp.
          brasiliensis PBR1692]
 gi|227326642|ref|ZP_03830666.1| putative bolA family protein [Pectobacterium carotovorum subsp.
          carotovorum WPP14]
 gi|253686691|ref|YP_003015881.1| BolA family protein [Pectobacterium carotovorum subsp.
          carotovorum PC1]
 gi|251753269|gb|ACT11345.1| BolA family protein [Pectobacterium carotovorum subsp.
          carotovorum PC1]
          Length = 84

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVPD 77
          ++GDG+H+   ++   F G +R+++ Q VY  L   +  N +HALSIK   P+
Sbjct: 21 VSGDGSHFQVIVVGGLFAGMSRVKKQQAVYAPLMEYIADNRIHALSIKAYTPE 73


>gi|241957870|ref|XP_002421654.1| BolA domain protein, putative [Candida dubliniensis CD36]
 gi|223644999|emb|CAX39591.1| BolA domain protein, putative [Candida dubliniensis CD36]
          Length = 89

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          +  +I   +  ++V + D++G  G  +A  I+S  F+GKN++ +H++V + L +++  ++
Sbjct: 11 LRDIIATRLNANLVQVEDMSGGCGQAFAVIIVSSLFQGKNKLARHRLVNNELKDEIA-SI 69

Query: 67 HALSIKTSVPD 77
          HA + K   PD
Sbjct: 70 HAFTQKGFTPD 80


>gi|262281450|ref|ZP_06059230.1| conserved hypothetical protein [Acinetobacter calcoaceticus
          RUH2202]
 gi|262257038|gb|EEY75776.1| conserved hypothetical protein [Acinetobacter calcoaceticus
          RUH2202]
          Length = 89

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 41/78 (52%), Gaps = 4/78 (5%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
           +MN  ++ +++K+  P + V +   +G    +   I+ ++F GK  + + Q+VY  L  
Sbjct: 5  FAMNSEQLTQILKEAFPVAEVAV---SGQAGKFDLRIVDDQFEGKRTVARQQLVYAPLNT 61

Query: 61 KMGNA-LHALSIKTSVPD 77
           + +  +HA++I+    D
Sbjct: 62 YIASGEVHAVTIRAMTKD 79


>gi|156095528|ref|XP_001613799.1| hypothetical protein [Plasmodium vivax SaI-1]
 gi|148802673|gb|EDL44072.1| hypothetical protein, conserved [Plasmodium vivax]
          Length = 86

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query: 9  EKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHA 68
          EK+     P  +  +    G G  + A I+S +F  K  + +H+MV D + N++ N +HA
Sbjct: 9  EKLSSALKPTFLELVDKSCGCGTAFDAVIVSSDFDSKRLLDRHRMVNDVIKNELPN-IHA 67

Query: 69 LSIKTSVP 76
           S+K   P
Sbjct: 68 FSMKCHTP 75


>gi|70992557|ref|XP_751127.1| BolA domain protein [Aspergillus fumigatus Af293]
 gi|66848760|gb|EAL89089.1| BolA domain protein [Aspergillus fumigatus Af293]
 gi|159124699|gb|EDP49817.1| BolA domain protein [Aspergillus fumigatus A1163]
          Length = 132

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 44/78 (56%), Gaps = 2/78 (2%)

Query: 1   MSMNPHEIEKMIKKGIPQSIVTIHDLAG-DGNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
           +++ P  ++  + + +   +V I DL+G  G  + A I+S +F  KN + +H++V   L 
Sbjct: 46  LTVTPELLKSKLVEQLQAQVVEIEDLSGGCGQAFQAIIVSPQFEKKNMLARHRLVNSVLK 105

Query: 60  NKMGNALHALSIKTSVPD 77
           +++  A+HA + K   P+
Sbjct: 106 SEIA-AIHAWTPKCYTPE 122


>gi|196004562|ref|XP_002112148.1| expressed hypothetical protein [Trichoplax adhaerens]
 gi|190586047|gb|EDV26115.1| expressed hypothetical protein [Trichoplax adhaerens]
          Length = 105

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 30/45 (66%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIK 72
          G   H+   I+S+ F GK+ +Q+H+MV + L  ++  ++HALSI+
Sbjct: 35 GSETHFKVIIVSDLFNGKSLLQRHRMVNELLAEELSGSVHALSIQ 79


>gi|307167889|gb|EFN61278.1| BolA-like protein 3 [Camponotus floridanus]
          Length = 101

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 44/70 (62%), Gaps = 3/70 (4%)

Query: 11  MIKKGIPQS-IVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHA 68
           +++   PQ+ ++ + D++G  G  +   +I+ EF+G N ++QH+++ + L  ++ + +H 
Sbjct: 33  ILRNRFPQAQLIEVTDVSGGCGAMFDINVIAPEFKGLNTVKQHRIINEVLKEEIKD-MHG 91

Query: 69  LSIKTSVPDS 78
           L I TS+P S
Sbjct: 92  LRIHTSIPQS 101


>gi|15642294|ref|NP_231927.1| bolA protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121586156|ref|ZP_01675947.1| bolA protein [Vibrio cholerae 2740-80]
 gi|121726775|ref|ZP_01679993.1| bolA protein [Vibrio cholerae V52]
 gi|147674547|ref|YP_001217809.1| bolA protein [Vibrio cholerae O395]
 gi|153817860|ref|ZP_01970527.1| bolA protein [Vibrio cholerae NCTC 8457]
 gi|153821481|ref|ZP_01974148.1| bolA protein [Vibrio cholerae B33]
 gi|227082420|ref|YP_002810971.1| bolA protein [Vibrio cholerae M66-2]
 gi|254849424|ref|ZP_05238774.1| BolA family protein [Vibrio cholerae MO10]
 gi|255747014|ref|ZP_05420959.1| cell division protein BolA [Vibrio cholera CIRS 101]
 gi|262161444|ref|ZP_06030554.1| cell division protein BolA [Vibrio cholerae INDRE 91/1]
 gi|262168294|ref|ZP_06035991.1| cell division protein BolA [Vibrio cholerae RC27]
 gi|298500331|ref|ZP_07010136.1| bolA protein [Vibrio cholerae MAK 757]
 gi|14547934|sp|Q9KPS0|BOLA_VIBCH RecName: Full=Protein BolA
 gi|9656860|gb|AAF95440.1| bolA protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121549568|gb|EAX59592.1| bolA protein [Vibrio cholerae 2740-80]
 gi|121630809|gb|EAX63193.1| bolA protein [Vibrio cholerae V52]
 gi|126511568|gb|EAZ74162.1| bolA protein [Vibrio cholerae NCTC 8457]
 gi|126520974|gb|EAZ78197.1| bolA protein [Vibrio cholerae B33]
 gi|146316430|gb|ABQ20969.1| bolA protein [Vibrio cholerae O395]
 gi|227010308|gb|ACP06520.1| bolA protein [Vibrio cholerae M66-2]
 gi|227014192|gb|ACP10402.1| bolA protein [Vibrio cholerae O395]
 gi|254845129|gb|EET23543.1| BolA family protein [Vibrio cholerae MO10]
 gi|255735416|gb|EET90816.1| cell division protein BolA [Vibrio cholera CIRS 101]
 gi|262023186|gb|EEY41890.1| cell division protein BolA [Vibrio cholerae RC27]
 gi|262028755|gb|EEY47409.1| cell division protein BolA [Vibrio cholerae INDRE 91/1]
 gi|297541024|gb|EFH77078.1| bolA protein [Vibrio cholerae MAK 757]
          Length = 106

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 29/46 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   ++SE F G   + +H++V  +L +++ N +HAL+I T
Sbjct: 33 GSESHFKVTVVSERFAGLRPVARHRLVNQTLADELANHIHALAIHT 78


>gi|24214812|ref|NP_712293.1| BolA family protein [Leptospira interrogans serovar Lai str.
          56601]
 gi|45657671|ref|YP_001757.1| BolA-like protein [Leptospira interrogans serovar Copenhageni
          str. Fiocruz L1-130]
 gi|24195823|gb|AAN49311.1| BolA family protein [Leptospira interrogans serovar Lai str.
          56601]
 gi|45600911|gb|AAS70394.1| BolA-like protein [Leptospira interrogans serovar Copenhageni
          str. Fiocruz L1-130]
          Length = 87

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 29/46 (63%)

Query: 29 DGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTS 74
          +G H    + S  F GK++++QH+MVY  L   +   LHA++++TS
Sbjct: 41 EGTHIKIVLASPSFLGKSKLEQHRMVYSILKPWIDRGLHAITLETS 86


>gi|50551805|ref|XP_503377.1| YALI0E00572p [Yarrowia lipolytica]
 gi|49649246|emb|CAG78956.1| YALI0E00572p [Yarrowia lipolytica]
          Length = 121

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 2/48 (4%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG--NALHALSIKTSVP 76
           +H+   I+S++F GK+   +H+MVY     +M   N LHALS+ T  P
Sbjct: 65  SHFRLTIVSDKFEGKSAPIRHRMVYKLFEEEMAQPNGLHALSLTTKTP 112


>gi|116328089|ref|YP_797809.1| BolA family transcriptional regulator [Leptospira borgpetersenii
          serovar Hardjo-bovis L550]
 gi|116331458|ref|YP_801176.1| BolA family transcriptional regulator [Leptospira borgpetersenii
          serovar Hardjo-bovis JB197]
 gi|116120833|gb|ABJ78876.1| Transcriptional regulator, BolA-family [Leptospira borgpetersenii
          serovar Hardjo-bovis L550]
 gi|116125147|gb|ABJ76418.1| Transcriptional regulator, BolA-family [Leptospira borgpetersenii
          serovar Hardjo-bovis JB197]
          Length = 89

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 30/49 (61%)

Query: 29 DGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          +G H    ++S +F GK++++QH+MVY  L   +   LHA+ ++T   D
Sbjct: 41 EGTHIKIILVSSKFSGKSKVEQHRMVYSVLKPWIDRGLHAIILETKERD 89


>gi|23005005|ref|ZP_00048046.1| COG0271: Stress-induced morphogen (activity unknown)
          [Magnetospirillum magnetotacticum MS-1]
          Length = 69

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 27/46 (58%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+  +++S  F GK+R+++H++V   L       LHAL+++   P
Sbjct: 20 THFRLDVVSAAFEGKSRVERHRLVNGLLDEAFKRGLHALAVRARTP 65


>gi|327484810|gb|AEA79217.1| Cell division protein BolA [Vibrio cholerae LMA3894-4]
          Length = 106

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 29/46 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   ++SE F G   + +H++V  +L +++ N +HAL+I T
Sbjct: 33 GSESHFKVTVVSERFAGLRLVARHRLVNQTLADELANHIHALAIHT 78


>gi|88798186|ref|ZP_01113772.1| hypothetical protein MED297_13047 [Reinekea sp. MED297]
 gi|88778962|gb|EAR10151.1| hypothetical protein MED297_13047 [Reinekea sp. MED297]
          Length = 76

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 1/63 (1%)

Query: 16 IPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA-LHALSIKTS 74
          IP       ++AG+G  +   ++SE F GK  + + QMVY  L  ++ +  +HA+++   
Sbjct: 11 IPAFADATIEVAGEGAKFDISMVSEAFAGKRAVARQQMVYAVLNEQIASGDIHAVTMTLK 70

Query: 75 VPD 77
           PD
Sbjct: 71 TPD 73


>gi|172051152|gb|ACB70351.1| BolA-related protein [Ornithodoros coriaceus]
          Length = 85

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          +E+ ++K +    V + D++ G G  + A I+S +F GK  +++H+MV   L  ++  A+
Sbjct: 9  LEEKLRKELDTVHVELEDISDGCGAKFNAVIVSPKFEGKPLLERHRMVNTVLSKEL-EAI 67

Query: 67 HALSIKTSVPD 77
          HA S KT  P+
Sbjct: 68 HAFSQKTLTPE 78


>gi|153217278|ref|ZP_01951039.1| bolA protein [Vibrio cholerae 1587]
 gi|153826809|ref|ZP_01979476.1| bolA protein [Vibrio cholerae MZO-2]
 gi|153828245|ref|ZP_01980912.1| bolA protein [Vibrio cholerae 623-39]
 gi|254286034|ref|ZP_04960995.1| bolA protein [Vibrio cholerae AM-19226]
 gi|262189973|ref|ZP_06048281.1| cell division protein BolA [Vibrio cholerae CT 5369-93]
 gi|297580938|ref|ZP_06942863.1| bolA protein [Vibrio cholerae RC385]
 gi|124113689|gb|EAY32509.1| bolA protein [Vibrio cholerae 1587]
 gi|148876334|gb|EDL74469.1| bolA protein [Vibrio cholerae 623-39]
 gi|149739396|gb|EDM53638.1| bolA protein [Vibrio cholerae MZO-2]
 gi|150423944|gb|EDN15884.1| bolA protein [Vibrio cholerae AM-19226]
 gi|262034144|gb|EEY52576.1| cell division protein BolA [Vibrio cholerae CT 5369-93]
 gi|297534764|gb|EFH73600.1| bolA protein [Vibrio cholerae RC385]
          Length = 106

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 29/46 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   ++SE F G   + +H++V  +L +++ N +HAL+I T
Sbjct: 33 GSESHFKVTVVSERFAGLRPVARHRLVNQTLADELANHIHALAIHT 78


>gi|221236042|ref|YP_002518479.1| BolA protein [Caulobacter crescentus NA1000]
 gi|220965215|gb|ACL96571.1| BolA protein [Caulobacter crescentus NA1000]
          Length = 97

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 24 HDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          H  AG+ +H+   I S+ F GK R+ + +MV  +L  ++   +HALSI  S P
Sbjct: 43 HTGAGE-SHFNLRIESQAFAGKTRVMRQRMVMHALAEELAGPVHALSIHASAP 94


>gi|260770990|ref|ZP_05879919.1| protein yrbA [Vibrio furnissii CIP 102972]
 gi|260614227|gb|EEX39417.1| protein yrbA [Vibrio furnissii CIP 102972]
 gi|315179036|gb|ADT85950.1| BolA/YrbA family protein [Vibrio furnissii NCTC 11218]
          Length = 84

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 46/76 (60%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+  ++++++++ +  ++  IH + G+G+HY    +   F G +R+++ Q++Y  L   +
Sbjct: 1  MDSAQVQQILEQAL--NLQEIH-VKGEGSHYEVIAVDAAFDGMSRVKKQQLIYAPLMAYI 57

Query: 63 G-NALHALSIKTSVPD 77
            N +HA+SIK   PD
Sbjct: 58 QRNDIHAVSIKAFTPD 73


>gi|163759944|ref|ZP_02167028.1| hypothetical protein HPDFL43_16976 [Hoeflea phototrophica DFL-43]
 gi|162282902|gb|EDQ33189.1| hypothetical protein HPDFL43_16976 [Hoeflea phototrophica DFL-43]
          Length = 113

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 3/53 (5%)

Query: 27  AGDGN---HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           A DG    H+   I++E F G +RI +H  V + L N++ + LHA++++ + P
Sbjct: 55  AFDGTGETHFRIRIVAEAFAGMSRINRHHAVNELLKNELDSGLHAMAVEAAAP 107


>gi|254562406|ref|YP_003069501.1| BolA-like protein [Methylobacterium extorquens DM4]
 gi|254269684|emb|CAX25656.1| BolA-like protein [Methylobacterium extorquens DM4]
          Length = 92

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 27/46 (58%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+  +++S  F GK+R+++H++V   L       LHAL+++   P
Sbjct: 43 THFRLDVVSAAFEGKSRVERHRIVNGLLDEAFKRGLHALAVRARTP 88


>gi|218531488|ref|YP_002422304.1| BolA family protein [Methylobacterium chloromethanicum CM4]
 gi|240139980|ref|YP_002964457.1| BolA-like protein [Methylobacterium extorquens AM1]
 gi|218523791|gb|ACK84376.1| BolA family protein [Methylobacterium chloromethanicum CM4]
 gi|240009954|gb|ACS41180.1| BolA-like protein [Methylobacterium extorquens AM1]
          Length = 92

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 27/46 (58%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+  +++S  F GK+R+++H++V   L       LHAL+++   P
Sbjct: 43 THFRLDVVSAAFEGKSRVERHRIVNGLLDEAFKRGLHALAVRARTP 88


>gi|312113094|ref|YP_004010690.1| BolA family protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311218223|gb|ADP69591.1| BolA family protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 94

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          +GD  H+   I+S  F GK+ +++H+ V  +L  ++   +HAL+IK   P
Sbjct: 42 SGD-THFRVRIVSSAFEGKSSLERHRAVNAALAEELAGPVHALAIKALTP 90


>gi|289665766|ref|ZP_06487347.1| hypothetical protein XcampvN_22511 [Xanthomonas campestris pv.
          vasculorum NCPPB702]
          Length = 89

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 24 HDLAGDGN-HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          H  A DG  H+   ++S  F GK  + +H+ VY ++G  M   +HALSI+   P
Sbjct: 32 HAGARDGRGHFNVRVVSTAFAGKPPLARHRAVYAAVGEMMQTDIHALSIQALAP 85


>gi|153801053|ref|ZP_01955639.1| bolA protein [Vibrio cholerae MZO-3]
 gi|124123407|gb|EAY42150.1| bolA protein [Vibrio cholerae MZO-3]
          Length = 106

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 29/46 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   ++SE F G   + +H++V  +L +++ N +HAL+I T
Sbjct: 33 GSESHFKVTVVSERFAGLRPVARHRLVNQTLADELANHIHALAIHT 78


>gi|213514872|ref|NP_001134510.1| BolA-like protein 1 [Salmo salar]
 gi|209733918|gb|ACI67828.1| BolA-like protein 1 [Salmo salar]
          Length = 150

 Score = 39.7 bits (91), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 30/49 (61%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           G  +H+   ++S  F G + +Q+H++V ++L  ++   +HAL+I+   P
Sbjct: 68  GSESHFRVLVVSPRFDGLSLLQRHRLVNETLAEELKTCVHALAIQAKTP 116


>gi|146182568|ref|XP_001471032.1| Protein bolA, putative [Tetrahymena thermophila]
 gi|146143772|gb|EDK31359.1| Protein bolA, putative [Tetrahymena thermophila SB210]
          Length = 117

 Score = 39.7 bits (91), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G   H+   I+S++F G +++Q HQ +Y  L  +    LHALS+ T
Sbjct: 47 GSETHFKLVIVSDDFSGLSKVQCHQKIYSLLQPEFQKGLHALSLMT 92


>gi|27364137|ref|NP_759665.1| protein YrbA [Vibrio vulnificus CMCP6]
 gi|37678644|ref|NP_933253.1| transcriptional regulator [Vibrio vulnificus YJ016]
 gi|320157522|ref|YP_004189901.1| YrbA protein [Vibrio vulnificus MO6-24/O]
 gi|27360255|gb|AAO09192.1| Protein yrbA [Vibrio vulnificus CMCP6]
 gi|37197384|dbj|BAC93224.1| predicted transcriptional regulator [Vibrio vulnificus YJ016]
 gi|319932834|gb|ADV87698.1| YrbA protein [Vibrio vulnificus MO6-24/O]
          Length = 84

 Score = 39.7 bits (91), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVP 76
          G+G+HY    +   F G +R+++ Q++Y  L + +  N +HALSIK   P
Sbjct: 23 GEGSHYEVVAVDACFEGMSRVKKQQLIYKPLMDYIQRNDIHALSIKAYTP 72


>gi|307173495|gb|EFN64405.1| Probable dolichyl pyrophosphate Man9GlcNAc2
           alpha-1,3-glucosyltransferase [Camponotus floridanus]
          Length = 178

 Score = 39.7 bits (91), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           G G  ++  ++S+ F+GK  +Q+H++VY  L  ++  A+HA+S+ T  P+
Sbjct: 123 GCGAKFSVIVVSDLFQGKPTLQRHRLVYGVLEEEL-KAIHAISVTTLTPE 171


>gi|307108205|gb|EFN56446.1| hypothetical protein CHLNCDRAFT_48758 [Chlorella variabilis]
          Length = 275

 Score = 39.7 bits (91), Expect = 0.12,   Method: Composition-based stats.
 Identities = 16/45 (35%), Positives = 29/45 (64%)

Query: 32  HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+  E++S  F G   I++H++VY  L +++ + +HALS+ T  P
Sbjct: 225 HFNVEVVSARFEGLTSIKRHRLVYQILDDELRSPVHALSLITKTP 269


>gi|315041775|ref|XP_003170264.1| BolA domain-containing protein [Arthroderma gypseum CBS 118893]
 gi|311345298|gb|EFR04501.1| BolA domain-containing protein [Arthroderma gypseum CBS 118893]
          Length = 123

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN--ALHALSIKTSVPDSQ 79
            H+   IIS  F  KN+  +H+MVY+ L  +M     +HAL +KT  P+ +
Sbjct: 67  THFHVTIISSAFASKNQPARHRMVYNLLKEEMARDGGIHALQLKTRTPEEE 117


>gi|288956919|ref|YP_003447260.1| transcriptional regulator [Azospirillum sp. B510]
 gi|288909227|dbj|BAI70716.1| transcriptional regulator [Azospirillum sp. B510]
          Length = 99

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+   I+S  F G++R+++ +MVY  L  ++   +HAL + T  P
Sbjct: 49 THFHVTIVSGAFAGRSRVERQRMVYALLAEELRERVHALGLTTQAP 94


>gi|153834593|ref|ZP_01987260.1| BolA/YrbA family protein [Vibrio harveyi HY01]
 gi|156975887|ref|YP_001446794.1| hypothetical protein VIBHAR_03653 [Vibrio harveyi ATCC BAA-1116]
 gi|269960377|ref|ZP_06174751.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|148869036|gb|EDL68081.1| BolA/YrbA family protein [Vibrio harveyi HY01]
 gi|156527481|gb|ABU72567.1| hypothetical protein VIBHAR_03653 [Vibrio harveyi ATCC BAA-1116]
 gi|269834988|gb|EEZ89073.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 84

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 47/76 (61%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+  ++++++++ +  ++  +H + G+G+HY    +   F G +R+++ Q++Y  L + +
Sbjct: 1  MDSAKVQQLLEEAL--NLQEVH-VKGEGSHYEVVAVDACFDGMSRVKKQQLIYGPLMDYI 57

Query: 63 -GNALHALSIKTSVPD 77
            N +HALSIK   P+
Sbjct: 58 QRNDIHALSIKAFTPE 73


>gi|93006887|ref|YP_581324.1| BolA-like protein [Psychrobacter cryohalolentis K5]
 gi|92394565|gb|ABE75840.1| transcriptional regulator BolA [Psychrobacter cryohalolentis K5]
          Length = 114

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVY---DSLGNKMGNALHALSIKTSVP 76
          G  +H+   ++SE F GK  + +HQMVY   D+L    G  +HAL+I    P
Sbjct: 44 GKESHFKLIMVSEAFTGKRLVARHQMVYHLADALLTSKGGQIHALAIHAYTP 95


>gi|16127241|ref|NP_421805.1| BolA protein [Caulobacter crescentus CB15]
 gi|13424649|gb|AAK24973.1| BolA protein [Caulobacter crescentus CB15]
          Length = 91

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 24 HDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          H  AG+ +H+   I S+ F GK R+ + +MV  +L  ++   +HALSI  S P
Sbjct: 37 HTGAGE-SHFNLRIESQAFAGKTRVMRQRMVMHALAEELAGPVHALSIHASAP 88


>gi|153948521|ref|YP_001399446.1| BolA family transcriptional regulator [Yersinia
          pseudotuberculosis IP 31758]
 gi|152960016|gb|ABS47477.1| putative BolA protein [Yersinia pseudotuberculosis IP 31758]
          Length = 84

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVP 76
          + GDG+H+   ++ E F   +R+++ Q VY  L   +  N +HALSIK   P
Sbjct: 21 VTGDGSHFQVIVVGELFADMSRVKKQQAVYAPLMEYIADNRIHALSIKAYTP 72


>gi|119472651|ref|XP_001258392.1| BolA domain protein [Neosartorya fischeri NRRL 181]
 gi|119406544|gb|EAW16495.1| BolA domain protein [Neosartorya fischeri NRRL 181]
          Length = 92

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 2/77 (2%)

Query: 2  SMNPHEIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          S+ P  ++  + + +   +V I DL+G  G  + A I+S +F  KN + +H++V   L +
Sbjct: 7  SVTPELLKSKLVEQLQAQVVEIEDLSGGCGQAFQAIIVSPQFEKKNMLARHRLVNSVLKS 66

Query: 61 KMGNALHALSIKTSVPD 77
          ++  A+HA + K   P+
Sbjct: 67 EIA-AIHAWTPKCYTPE 82


>gi|197102720|ref|NP_001125298.1| bolA-like protein 1 [Pongo abelii]
 gi|59797915|sp|Q5RCE5|BOLA1_PONAB RecName: Full=BolA-like protein 1
 gi|55727614|emb|CAH90562.1| hypothetical protein [Pongo abelii]
          Length = 137

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 29/49 (59%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           G   H+   ++S  F G + +Q+H++++ +L  ++   +HAL+I+   P
Sbjct: 63  GSETHFRVAVVSSRFEGLSPLQRHRLIHAALAEELAGPVHALAIQARTP 111


>gi|51597806|ref|YP_071997.1| BolA/YrbA family protein [Yersinia pseudotuberculosis IP 32953]
 gi|170022768|ref|YP_001719273.1| BolA family protein [Yersinia pseudotuberculosis YPIII]
 gi|186896998|ref|YP_001874110.1| BolA family protein [Yersinia pseudotuberculosis PB1/+]
 gi|51591088|emb|CAH22752.1| putative BolA/YrbA family protein [Yersinia pseudotuberculosis IP
          32953]
 gi|169749302|gb|ACA66820.1| BolA family protein [Yersinia pseudotuberculosis YPIII]
 gi|186700024|gb|ACC90653.1| BolA family protein [Yersinia pseudotuberculosis PB1/+]
          Length = 87

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVP 76
          + GDG+H+   ++ E F   +R+++ Q VY  L   +  N +HALSIK   P
Sbjct: 24 VTGDGSHFQVIVVGELFADMSRVKKQQAVYAPLMEYIADNRIHALSIKAYTP 75


>gi|49474763|ref|YP_032805.1| transcriptional regulator bolA [Bartonella quintana str.
          Toulouse]
 gi|49240267|emb|CAF26737.1| Transcriptional regulator bolA [Bartonella quintana str.
          Toulouse]
          Length = 92

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 24 HDLAGDG-NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          H L G G  H+  +I+S  F G  R++ H+ +Y  L  ++   +HAL+++ 
Sbjct: 39 HALYGKGETHFRVKILSSSFSGMTRVEIHRAIYKVLQKELATCVHALALEV 89


>gi|229521140|ref|ZP_04410560.1| cell division protein BolA [Vibrio cholerae TM 11079-80]
 gi|229341672|gb|EEO06674.1| cell division protein BolA [Vibrio cholerae TM 11079-80]
          Length = 113

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 29/46 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   ++SE F G   + +H++V  +L +++ N +HAL+I T
Sbjct: 40 GSESHFKVTVVSERFAGLRPVARHRLVNQTLADELANHIHALAIHT 85


>gi|254481209|ref|ZP_05094454.1| BolA-like protein [marine gamma proteobacterium HTCC2148]
 gi|214038372|gb|EEB79034.1| BolA-like protein [marine gamma proteobacterium HTCC2148]
          Length = 107

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 28/46 (60%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+   +++ +F GK ++ +HQ VY  L +++   +HAL++ T  P
Sbjct: 37 THFKVVVVAAQFDGKRKVARHQQVYQVLADQLEGPVHALALHTYSP 82


>gi|217976514|ref|YP_002360661.1| BolA family protein [Methylocella silvestris BL2]
 gi|217501890|gb|ACK49299.1| BolA family protein [Methylocella silvestris BL2]
          Length = 108

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 29/46 (63%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
            H+  +++S+ F GK+RI +H+ +  +L  ++   +HAL+I+   P
Sbjct: 61  THFKVKVVSKSFSGKSRIDRHRAINAALSQELDAGVHALAIEAKAP 106


>gi|57335961|emb|CAH25382.1| hypothetical protein [Guillardia theta]
          Length = 144

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
            H+  +++S +F G + +++HQMVY  L  +    LHAL+I    P
Sbjct: 93  THFRLKVVSSKFEGLSLVKRHQMVYALLNEQFQQGLHALNIVAKTP 138


>gi|260900281|ref|ZP_05908676.1| BolA/YrbA family protein [Vibrio parahaemolyticus AQ4037]
 gi|308107523|gb|EFO45063.1| BolA/YrbA family protein [Vibrio parahaemolyticus AQ4037]
 gi|328471430|gb|EGF42325.1| protein yrbA [Vibrio parahaemolyticus 10329]
          Length = 84

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 46/76 (60%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+  ++++++++ +  ++  +H + G+G+HY    +   F G +R+++ Q++Y  L   +
Sbjct: 1  MDSAKVQQLLEEAL--NLQEVH-VKGEGSHYEVVAVDACFEGMSRVKKQQLIYGPLMEYI 57

Query: 63 -GNALHALSIKTSVPD 77
            N +HALSIK   P+
Sbjct: 58 QRNDIHALSIKAFTPE 73


>gi|229513938|ref|ZP_04403400.1| cell division protein BolA [Vibrio cholerae TMA 21]
 gi|229349119|gb|EEO14076.1| cell division protein BolA [Vibrio cholerae TMA 21]
          Length = 113

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 29/46 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   ++SE F G   + +H++V  +L +++ N +HAL+I T
Sbjct: 40 GSESHFKVTVVSERFAGLRPVARHRLVNQTLADELANHIHALAIHT 85


>gi|229507630|ref|ZP_04397135.1| cell division protein BolA [Vibrio cholerae BX 330286]
 gi|229512174|ref|ZP_04401653.1| cell division protein BolA [Vibrio cholerae B33]
 gi|229519310|ref|ZP_04408753.1| cell division protein BolA [Vibrio cholerae RC9]
 gi|229607136|ref|YP_002877784.1| cell division protein BolA [Vibrio cholerae MJ-1236]
 gi|229343999|gb|EEO08974.1| cell division protein BolA [Vibrio cholerae RC9]
 gi|229352139|gb|EEO17080.1| cell division protein BolA [Vibrio cholerae B33]
 gi|229355135|gb|EEO20056.1| cell division protein BolA [Vibrio cholerae BX 330286]
 gi|229369791|gb|ACQ60214.1| cell division protein BolA [Vibrio cholerae MJ-1236]
          Length = 113

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 29/46 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   ++SE F G   + +H++V  +L +++ N +HAL+I T
Sbjct: 40 GSESHFKVTVVSERFAGLRPVARHRLVNQTLADELANHIHALAIHT 85


>gi|307942513|ref|ZP_07657861.1| protein BolA [Roseibium sp. TrichSKD4]
 gi|307774152|gb|EFO33365.1| protein BolA [Roseibium sp. TrichSKD4]
          Length = 98

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 29/50 (58%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   H+   I++  F G+NR+ +H+ +   L  ++ + +HAL+I+   P+
Sbjct: 38 GGETHFRVRIVAGSFSGQNRVARHRTINSLLAEELADRVHALAIEARAPE 87


>gi|289671222|ref|ZP_06492297.1| hypothetical protein XcampmN_22733 [Xanthomonas campestris pv.
          musacearum NCPPB4381]
          Length = 89

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 24 HDLAGDGN-HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          H  A DG  H+   ++S  F GK  + +H+ VY ++G  M   +HALSI+   P
Sbjct: 32 HAGARDGRGHFNVRVVSTAFAGKPPLARHRAVYAAVGEMMQTDIHALSIEALAP 85


>gi|229524299|ref|ZP_04413704.1| cell division protein BolA [Vibrio cholerae bv. albensis VL426]
 gi|229337880|gb|EEO02897.1| cell division protein BolA [Vibrio cholerae bv. albensis VL426]
          Length = 113

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 29/46 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   ++SE F G   + +H++V  +L +++ N +HAL+I T
Sbjct: 40 GSESHFKVTVVSERFAGLRPVARHRLVNQTLADELANHIHALAIHT 85


>gi|229528703|ref|ZP_04418093.1| cell division protein BolA [Vibrio cholerae 12129(1)]
 gi|229332477|gb|EEN97963.1| cell division protein BolA [Vibrio cholerae 12129(1)]
          Length = 113

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 29/46 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   ++SE F G   + +H++V  +L +++ N +HAL+I T
Sbjct: 40 GSESHFKVTVVSERFAGLRLVARHRLVNQTLADELANHIHALAIHT 85


>gi|163852647|ref|YP_001640690.1| BolA family protein [Methylobacterium extorquens PA1]
 gi|163664252|gb|ABY31619.1| BolA family protein [Methylobacterium extorquens PA1]
          Length = 119

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 27/46 (58%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
            H+  +++S  F GK+R+++H++V   L       LHAL+++   P
Sbjct: 70  THFRLDVVSAAFEGKSRVERHRIVNGLLDEAFKRGLHALAVRARTP 115


>gi|313231643|emb|CBY08756.1| unnamed protein product [Oikopleura dioica]
 gi|313246884|emb|CBY35739.1| unnamed protein product [Oikopleura dioica]
          Length = 97

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 23 IHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          + DL   G  Y   I+SE F GK  +++H++V ++L  ++   LHA S K+  P
Sbjct: 34 VDDLGTCGTSYQVIIVSEIFEGKKTLEKHKIVNEALAEQISR-LHAFSQKSYTP 86


>gi|119775677|ref|YP_928417.1| putative cell division protein BolA [Shewanella amazonensis SB2B]
 gi|119768177|gb|ABM00748.1| transcriptional regulator BolA [Shewanella amazonensis SB2B]
          Length = 99

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   H+   I S+ F G+  I +H+ V  +L  ++ N +HALS+ T  PD
Sbjct: 34 GSETHFKVVIASDSFEGQRLIGRHRAVNAALAVELANGVHALSMFTYTPD 83


>gi|242210661|ref|XP_002471172.1| predicted protein [Postia placenta Mad-698-R]
 gi|220729731|gb|EED83600.1| predicted protein [Postia placenta Mad-698-R]
          Length = 69

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 38/65 (58%), Gaps = 2/65 (3%)

Query: 7  EIEKMIKKGIPQSIVTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
          E+E  I+  IP + + I D + G G +YA  ++S  F GKN + +H+ + D L +++   
Sbjct: 5  ELEGSIRSAIPITHLEIIDQSNGCGENYAVFVVSAAFEGKNTLARHRFINDLLKDQIAR- 63

Query: 66 LHALS 70
          +HA S
Sbjct: 64 MHAFS 68


>gi|291616547|ref|YP_003519289.1| BolA [Pantoea ananatis LMG 20103]
 gi|291151577|gb|ADD76161.1| BolA [Pantoea ananatis LMG 20103]
 gi|327392978|dbj|BAK10400.1| protein BolA [Pantoea ananatis AJ13355]
          Length = 104

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 40/74 (54%), Gaps = 7/74 (9%)

Query: 7  EIEKMIKKGIPQSIVTIHDL-------AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          +IE+ ++     + + +HD        AG  +H+   I+S+ F G+  + +H+ +Y  L 
Sbjct: 5  QIEEKLRLAFEPAHLEVHDESYRHNVPAGSESHFKVVIVSDRFTGQRFLARHRAIYSELS 64

Query: 60 NKMGNALHALSIKT 73
           ++  ++HAL++ T
Sbjct: 65 AELAGSVHALALHT 78


>gi|59711331|ref|YP_204107.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Vibrio fischeri ES114]
 gi|197335702|ref|YP_002155487.1| BolA protein [Vibrio fischeri MJ11]
 gi|59479432|gb|AAW85219.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Vibrio fischeri ES114]
 gi|197317192|gb|ACH66639.1| BolA protein [Vibrio fischeri MJ11]
          Length = 104

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 45/78 (57%), Gaps = 7/78 (8%)

Query: 3  MNPHEIEKMIKKGIPQSIVTI------HDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVY 55
          M  H+IE+ +++ +  S + +      H++  G  +H+   ++S+EF GK  I +H+ + 
Sbjct: 1  MIQHQIEQKLREALAPSYLKVLNESYMHNVPEGSESHFKVIVVSDEFEGKRLIARHRAIN 60

Query: 56 DSLGNKMGNALHALSIKT 73
          + L  ++ + +HAL+I T
Sbjct: 61 NILAEELSDHIHALAIHT 78


>gi|109896778|ref|YP_660033.1| BolA-like protein [Pseudoalteromonas atlantica T6c]
 gi|109699059|gb|ABG38979.1| transcriptional regulator, BolA protein family [Pseudoalteromonas
          atlantica T6c]
          Length = 104

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 29/46 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   I+S+EF GK  I +H+ V   L +++ N +HAL+I T
Sbjct: 34 GSESHFKVVIVSDEFGGKRLIGRHRAVNQVLADELANDIHALAIHT 79


>gi|168003529|ref|XP_001754465.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162694567|gb|EDQ80915.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 78

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)

Query: 17 PQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          P  +  I    G G  +A  I+S  F GK  +++H++V  +L  +M  ++HALSI  ++ 
Sbjct: 16 PTYLEVIDTSGGCGASFAVAIVSSAFEGKRLLERHRIVNTALAEEM-KSIHALSISKALT 74

Query: 77 DSQ 79
            Q
Sbjct: 75 PKQ 77


>gi|183601059|ref|ZP_02962552.1| hypothetical protein PROSTU_04681 [Providencia stuartii ATCC
          25827]
 gi|188019398|gb|EDU57438.1| hypothetical protein PROSTU_04681 [Providencia stuartii ATCC
          25827]
          Length = 112

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 31/50 (62%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          AG  +H+   ++SE+F  K  + +H+ +Y  L +++  ++HAL++ T  P
Sbjct: 39 AGSESHFKVVLVSEKFENKRMVGRHREIYAILADELAGSIHALALHTYTP 88


>gi|78048069|ref|YP_364244.1| hypothetical protein XCV2513 [Xanthomonas campestris pv.
          vesicatoria str. 85-10]
 gi|325925512|ref|ZP_08186902.1| transcriptional regulator, BolA protein family [Xanthomonas
          perforans 91-118]
 gi|78036499|emb|CAJ24190.1| conserved hypothetical protein [Xanthomonas campestris pv.
          vesicatoria str. 85-10]
 gi|325544079|gb|EGD15472.1| transcriptional regulator, BolA protein family [Xanthomonas
          perforans 91-118]
          Length = 89

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 24 HDLAGDGN-HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          H  A DG  H+   ++S  F GK  + +H+ VY ++G  M   +HALSI+   P
Sbjct: 32 HAGARDGRGHFNVRVVSAAFVGKPPLARHRAVYAAVGEMMQTDIHALSIEAFAP 85


>gi|321248690|ref|XP_003191207.1| hypothetical protein CGB_A1830W [Cryptococcus gattii WM276]
 gi|317457674|gb|ADV19420.1| Conserved hypothetical protein [Cryptococcus gattii WM276]
          Length = 118

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 41/71 (57%), Gaps = 3/71 (4%)

Query: 8   IEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
           I K +K+  P S + + D++G  G+ YA  I S  F+G   ++QH++V + L   +   +
Sbjct: 50  IYKRLKERFPGSKLEVQDVSGGCGSFYAILISSPAFKGLTTVKQHKLVNECLKEDI-KGI 108

Query: 67  HALSIKTSVPD 77
           H L +KT +P+
Sbjct: 109 HGLQLKT-IPE 118


>gi|120555439|ref|YP_959790.1| BolA family protein [Marinobacter aquaeolei VT8]
 gi|120325288|gb|ABM19603.1| transcriptional regulator, BolA protein family [Marinobacter
          aquaeolei VT8]
          Length = 127

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/77 (20%), Positives = 41/77 (53%), Gaps = 7/77 (9%)

Query: 8  IEKMIKKGIPQSIVTIHDLA-------GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          IE+ +  G   S++++ + +           H+   ++S +F G+ ++++HQ +Y  L +
Sbjct: 16 IEEKLVAGFNASVISVENESHMHSVPPNSETHFKVTLVSADFEGQMKVRRHQAIYKVLAD 75

Query: 61 KMGNALHALSIKTSVPD 77
          ++   +HAL++    P+
Sbjct: 76 ELAGPVHALALHLYTPE 92


>gi|148979971|ref|ZP_01815811.1| cell division protein BolA [Vibrionales bacterium SWAT-3]
 gi|145961494|gb|EDK26797.1| cell division protein BolA [Vibrionales bacterium SWAT-3]
          Length = 102

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          AG  +H+   ++S+ F G   I +H+ V  +L  ++ N +HALSI T   D
Sbjct: 32 AGSESHFKVIVVSDAFEGLRLIARHRAVNKALSEELANNIHALSIHTYTKD 82


>gi|295690863|ref|YP_003594556.1| bolA family protein [Caulobacter segnis ATCC 21756]
 gi|295432766|gb|ADG11938.1| BolA family protein [Caulobacter segnis ATCC 21756]
          Length = 90

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 24 HDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          H  AG+ +H+   I +E F GK R+ + +MV   L +++   +HALSI  + P
Sbjct: 36 HSGAGE-SHFTLRIEAEAFAGKARVMRQRMVMKVLADELAGPVHALSIVATAP 87


>gi|254509090|ref|ZP_05121192.1| BolA/YrbA family protein [Vibrio parahaemolyticus 16]
 gi|219547971|gb|EED24994.1| BolA/YrbA family protein [Vibrio parahaemolyticus 16]
          Length = 84

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPD 77
          G+G+HY    +   F G +R+++ Q++Y  L   +  N +HA+SIK   PD
Sbjct: 23 GEGSHYEVIAVDASFDGMSRVKKQQLIYAPLMEYIQRNDIHAVSIKAFTPD 73


>gi|325922794|ref|ZP_08184524.1| transcriptional regulator, BolA protein family [Xanthomonas
          gardneri ATCC 19865]
 gi|325546736|gb|EGD17860.1| transcriptional regulator, BolA protein family [Xanthomonas
          gardneri ATCC 19865]
          Length = 89

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 24 HDLAGDGN-HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          H  A DG  H+   ++S  F GK  + +H+ VY ++G  M   +HALSI+   P
Sbjct: 32 HAGARDGRGHFNVRVVSAAFVGKAPLARHRAVYAAVGEMMQTDIHALSIEAFAP 85


>gi|260461674|ref|ZP_05809921.1| BolA family protein [Mesorhizobium opportunistum WSM2075]
 gi|259032744|gb|EEW34008.1| BolA family protein [Mesorhizobium opportunistum WSM2075]
          Length = 100

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 23 IHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          ++D  G+  H+   +++  F G NRI +H+ V + L +++   +HAL+I+ + P
Sbjct: 42 VYDGTGE-THFRVRVVASAFAGMNRIDRHRAVNELLADELKAGVHALAIEPAAP 94


>gi|254440740|ref|ZP_05054233.1| BolA-like protein [Octadecabacter antarcticus 307]
 gi|198250818|gb|EDY75133.1| BolA-like protein [Octadecabacter antarcticus 307]
          Length = 84

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 30/44 (68%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTS 74
          +H+  EI+S  F G++RI +H+ V+ +LG  +   +HALS++ S
Sbjct: 41 SHWRVEIVSISFAGQSRIAKHRAVHTALGPNIIGRIHALSLQIS 84


>gi|152978278|ref|YP_001343907.1| BolA family protein [Actinobacillus succinogenes 130Z]
 gi|150840001|gb|ABR73972.1| BolA family protein [Actinobacillus succinogenes 130Z]
          Length = 103

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 32/51 (62%), Gaps = 1/51 (1%)

Query: 24 HDLAGDG-NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          H +  DG +H+   ++S++F G  R+ +H++VY  L   + + +HAL++ T
Sbjct: 29 HSVNRDGESHFKIVLVSDKFDGLRRVARHKLVYQCLAQALSDGIHALALHT 79


>gi|322707369|gb|EFY98948.1| benomyl/methotrexate resistance protein [Metarhizium anisopliae
           ARSEF 23]
          Length = 691

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 4/77 (5%)

Query: 2   SMNPHE--IEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSL 58
           SM P E  I  +++  +  + + + D++G  G+ YA +I S  F+G   ++Q +MV  +L
Sbjct: 614 SMTPAESAIADLLRAKLQPTELLVRDVSGGCGSMYAIDIASPAFKGATMLKQQRMVNAAL 673

Query: 59  GNKMGNALHALSIKTSV 75
           G+ M  A H + + T V
Sbjct: 674 GDVM-RAWHGVQLNTRV 689


>gi|262274754|ref|ZP_06052565.1| cell division protein BolA [Grimontia hollisae CIP 101886]
 gi|262221317|gb|EEY72631.1| cell division protein BolA [Grimontia hollisae CIP 101886]
          Length = 107

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 29/46 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   I+S +F G   I +H+ V  +L +++ NA+HAL+I T
Sbjct: 34 GAESHFKVTIVSRQFEGLRLISRHRAVNQTLSDELQNAIHALAIHT 79


>gi|197284025|ref|YP_002149897.1| BolA protein [Proteus mirabilis HI4320]
 gi|227358104|ref|ZP_03842446.1| BolA protein [Proteus mirabilis ATCC 29906]
 gi|194681512|emb|CAR40389.1| BolA protein [Proteus mirabilis HI4320]
 gi|227161839|gb|EEI46871.1| BolA protein [Proteus mirabilis ATCC 29906]
          Length = 104

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 39/70 (55%), Gaps = 6/70 (8%)

Query: 10 KMIKKGIPQSIVTIHDL------AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG 63
          K+I +  P  +  I++       AG  +H+   I+S+ F  K  + +H+ VY +L +++ 
Sbjct: 9  KLISRFSPHFLQVINESHRHNVPAGSESHFKVVIVSDLFNDKRSVSRHRDVYQTLSHELD 68

Query: 64 NALHALSIKT 73
          N +HAL++ T
Sbjct: 69 NGVHALALHT 78


>gi|28899433|ref|NP_799038.1| BolA/YrbA family protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|153839298|ref|ZP_01991965.1| BolA/YrbA family protein [Vibrio parahaemolyticus AQ3810]
 gi|260363398|ref|ZP_05776250.1| BolA/YrbA family protein [Vibrio parahaemolyticus K5030]
 gi|260879333|ref|ZP_05891688.1| BolA/YrbA family protein [Vibrio parahaemolyticus AN-5034]
 gi|260895708|ref|ZP_05904204.1| BolA/YrbA family protein [Vibrio parahaemolyticus Peru-466]
 gi|28807669|dbj|BAC60922.1| BolA/YrbA family protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|149747199|gb|EDM58187.1| BolA/YrbA family protein [Vibrio parahaemolyticus AQ3810]
 gi|308087440|gb|EFO37135.1| BolA/YrbA family protein [Vibrio parahaemolyticus Peru-466]
 gi|308093140|gb|EFO42835.1| BolA/YrbA family protein [Vibrio parahaemolyticus AN-5034]
 gi|308111202|gb|EFO48742.1| BolA/YrbA family protein [Vibrio parahaemolyticus K5030]
          Length = 84

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 46/76 (60%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+  ++++++++ +  ++  +H + G+G+HY    +   F G +R+++ Q++Y  L   +
Sbjct: 1  MDSAKVQQLLEEAL--NLQEVH-VKGEGSHYEVVAVDACFEGMSRVKKQQLIYGPLMEYI 57

Query: 63 -GNALHALSIKTSVPD 77
            N +HALSIK   P+
Sbjct: 58 QRNDIHALSIKALTPE 73


>gi|312071074|ref|XP_003138440.1| hypothetical protein LOAG_02855 [Loa loa]
 gi|307766400|gb|EFO25634.1| hypothetical protein LOAG_02855 [Loa loa]
          Length = 365

 Score = 39.7 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 39/67 (58%), Gaps = 2/67 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          +++ ++  +  S + I D + G G  +   I+S+ F GK  +  H++VYD L  +M  A+
Sbjct: 9  MQEKLEVALKPSHLDIEDFSDGCGLKFRLVIVSDSFDGKTTLASHRLVYDVLKEEM-QAI 67

Query: 67 HALSIKT 73
          HAL IKT
Sbjct: 68 HALEIKT 74


>gi|304395497|ref|ZP_07377380.1| BolA family protein [Pantoea sp. aB]
 gi|304356791|gb|EFM21155.1| BolA family protein [Pantoea sp. aB]
          Length = 104

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 41/74 (55%), Gaps = 7/74 (9%)

Query: 7  EIEKMIKKGIPQSIVTIHDL-------AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          +IE+ ++     + + +HD        AG  +H+   I+S+ F G+  + +H+++Y  L 
Sbjct: 5  QIEEKLRVAFQPAHLEVHDESYRHNVPAGSESHFKVVIVSDCFAGQRFLARHRLIYGELA 64

Query: 60 NKMGNALHALSIKT 73
           ++  ++HAL++ T
Sbjct: 65 AELAGSVHALALHT 78


>gi|114046476|ref|YP_737026.1| transcriptional regulator BolA [Shewanella sp. MR-7]
 gi|113887918|gb|ABI41969.1| transcriptional regulator BolA [Shewanella sp. MR-7]
          Length = 106

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 28/42 (66%)

Query: 32 HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          H+   ++S+EF G   + +H++V + L +++ N +HALSI T
Sbjct: 45 HFKVVVVSDEFDGLRLLARHRLVNNCLAHELANGVHALSIHT 86


>gi|19075579|ref|NP_588079.1| conserved eukaryotic protein [Schizosaccharomyces pombe 972h-]
 gi|74625840|sp|Q9USK1|YJ2B_SCHPO RecName: Full=Uncharacterized bolA-like protein C4B3.11c
 gi|6434019|emb|CAB60685.1| conserved eukaryotic protein [Schizosaccharomyces pombe]
          Length = 116

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 17  PQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           P S+  I    G G+ Y   I S+ F+GKN + QH++V   L  ++ N +H L++ T V 
Sbjct: 46  PSSLRVIDVSGGCGSMYQVAIKSKAFQGKNTLAQHRLVNSILKEEIRN-MHGLNLSTEVE 104

Query: 77  D 77
           D
Sbjct: 105 D 105


>gi|167625101|ref|YP_001675395.1| BolA family protein [Shewanella halifaxensis HAW-EB4]
 gi|167355123|gb|ABZ77736.1| BolA family protein [Shewanella halifaxensis HAW-EB4]
          Length = 106

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+   I S EF GK  I +H+ V ++L  +    LHALS+ T  P
Sbjct: 44 THFKVIITSSEFEGKRLIGRHRAVNEALAEEFARGLHALSMHTYTP 89


>gi|58264168|ref|XP_569240.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|134107948|ref|XP_777356.1| hypothetical protein CNBB1580 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50260046|gb|EAL22709.1| hypothetical protein CNBB1580 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57223890|gb|AAW41933.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 118

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 8   IEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
           I K +K+  P S + + D++G  G+ YA  I S  F+G   ++QH++V + L   +   +
Sbjct: 50  IYKKLKERFPGSRLEVQDVSGGCGSFYAILISSPAFKGLTTVKQHKLVNECLKEDI-KGI 108

Query: 67  HALSIKT 73
           H L +KT
Sbjct: 109 HGLQLKT 115


>gi|322796138|gb|EFZ18714.1| hypothetical protein SINV_04260 [Solenopsis invicta]
          Length = 109

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 47/76 (61%), Gaps = 6/76 (7%)

Query: 6   HEIEKMI---KKGIPQS-IVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
           H  +KMI   +   PQ+ ++ + D++G  G  +   +++ EF+G N ++QH+++ + L  
Sbjct: 34  HAEQKMISILRNRFPQAQLIEVTDVSGGCGAMFDINVVAPEFKGLNTMKQHRIINEVLKE 93

Query: 61  KMGNALHALSIKTSVP 76
           ++ + +H L I+TS+P
Sbjct: 94  EIKD-MHGLRIRTSIP 108


>gi|226329070|ref|ZP_03804588.1| hypothetical protein PROPEN_02973 [Proteus penneri ATCC 35198]
 gi|225202256|gb|EEG84610.1| hypothetical protein PROPEN_02973 [Proteus penneri ATCC 35198]
          Length = 104

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 30/46 (65%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   I+S++F  K  + +H+ VY +L ++M N +HAL++ T
Sbjct: 33 GSESHFKVIIVSDDFNEKRSVTRHRDVYQTLAHEMENGVHALALHT 78


>gi|157120082|ref|XP_001659581.1| hypothetical protein AaeL_AAEL008899 [Aedes aegypti]
 gi|108875059|gb|EAT39284.1| conserved hypothetical protein [Aedes aegypti]
          Length = 107

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 48/74 (64%), Gaps = 3/74 (4%)

Query: 8   IEKMIKKGIPQS-IVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
           + K ++   PQ+  V ++D++G  G+ Y   + + EF+G + ++QH+++ ++L +++ + 
Sbjct: 35  LRKTLQNKFPQAKSVMVNDISGGCGSMYEIYVEAIEFKGLSTVKQHRLITETLKSEIKD- 93

Query: 66  LHALSIKTSVPDSQ 79
           +H L I T+VP S+
Sbjct: 94  MHGLRIHTAVPPSE 107


>gi|261211413|ref|ZP_05925701.1| cell division protein BolA [Vibrio sp. RC341]
 gi|260839368|gb|EEX65994.1| cell division protein BolA [Vibrio sp. RC341]
          Length = 106

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 29/46 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   I+S+ F G   + +H++V  +L +++ N +HAL+I T
Sbjct: 33 GSESHFKVTIVSDRFNGLRPVARHRLVNQTLADELANHIHALAIHT 78


>gi|315125515|ref|YP_004067518.1| transcriptional regulator [Pseudoalteromonas sp. SM9913]
 gi|315014028|gb|ADT67366.1| transcriptional regulator [Pseudoalteromonas sp. SM9913]
          Length = 85

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   ++E +++  +   +  +H +  +G+HY    + E F G +R+++ Q+VY  L N +
Sbjct: 1  METSQVETLLRDEL--QLAEVH-VKANGSHYEVIAVGECFDGLSRVKKQQLVYGPLMNTI 57

Query: 63 GN-ALHALSIKTSVP 76
           +  +HA+SI+   P
Sbjct: 58 SDGTIHAVSIRAFTP 72


>gi|238796194|ref|ZP_04639704.1| hypothetical protein ymoll0001_34510 [Yersinia mollaretii ATCC
          43969]
 gi|238719887|gb|EEQ11693.1| hypothetical protein ymoll0001_34510 [Yersinia mollaretii ATCC
          43969]
          Length = 84

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+ +EI++++ + +  ++   H + GDG+H+    + E F   +R+++ Q VY  L   +
Sbjct: 1  MDTNEIKEVLMRAL--ALQEAH-VTGDGSHFQVIAVGELFADMSRVKKQQAVYAPLMEYI 57

Query: 63 G-NALHALSIKTSVP 76
            N +HALSIK   P
Sbjct: 58 ADNRIHALSIKAYTP 72


>gi|163746151|ref|ZP_02153510.1| BolA protein [Oceanibulbus indolifex HEL-45]
 gi|161380896|gb|EDQ05306.1| BolA protein [Oceanibulbus indolifex HEL-45]
          Length = 85

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 30/44 (68%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSI 71
          G  +H+   I SE F+G+NR+ +H+ V+++LG  +   +HAL++
Sbjct: 38 GGESHFNVRIRSERFKGQNRLARHRAVHNALGPDLMGRIHALAL 81


>gi|301096687|ref|XP_002897440.1| BolA-like protein [Phytophthora infestans T30-4]
 gi|262107131|gb|EEY65183.1| BolA-like protein [Phytophthora infestans T30-4]
          Length = 126

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 29/46 (63%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+   +++++F GK  IQ+H+MV   L  ++ + +HALSI +  P
Sbjct: 42 THFKVVVVTDQFDGKPLIQRHRMVNAVLQQELDDGVHALSILSKTP 87


>gi|224013686|ref|XP_002296507.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220968859|gb|EED87203.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 87

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 1/47 (2%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          +H+A E+ +E F G + +++H+++Y  LG  M   +HAL IK   P 
Sbjct: 40 SHFALEVTAEAFEGLSLVKRHKLIYMLLGEVM-QKIHALEIKAKSPS 85


>gi|126313742|ref|XP_001370241.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 270

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 29/49 (59%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           G   H+   ++S  F G + +Q+H++V+ +L  ++   +HAL+I+   P
Sbjct: 195 GSETHFRVAVVSSRFEGLSYLQRHRLVHAALSEELAGPVHALAIQARTP 243


>gi|304413076|ref|ZP_07394549.1| putative transcriptional regulatorin BolA superfamily [Candidatus
          Regiella insecticola LSR1]
 gi|304283919|gb|EFL92312.1| putative transcriptional regulatorin BolA superfamily [Candidatus
          Regiella insecticola LSR1]
          Length = 90

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 29 DGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-ALHALSIKTSVP 76
          +G+H+   +ISE F   N  Q+HQ VY  L   +   ++HA+SIK   P
Sbjct: 30 EGSHFQVTVISEVFTDMNLRQKHQAVYTVLAEYIAKGSMHAVSIKAYTP 78


>gi|241950389|ref|XP_002417917.1| conserved hypothetical protein [Candida dubliniensis CD36]
 gi|223641255|emb|CAX45635.1| conserved hypothetical protein [Candida dubliniensis CD36]
          Length = 118

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 33/48 (68%), Gaps = 1/48 (2%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-ALHALSIKTSVPD 77
           +H+  EI+S+ F+GK+   +H++VY  + +++ N  +HA+ +KT  P+
Sbjct: 67  SHFRLEIVSDVFKGKSLPARHRLVYSLISDELKNHGVHAVQMKTKTPE 114


>gi|153829798|ref|ZP_01982465.1| BolA family protein [Vibrio cholerae 623-39]
 gi|148874716|gb|EDL72851.1| BolA family protein [Vibrio cholerae 623-39]
          Length = 84

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 45/75 (60%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSL-GNK 61
          M+  ++++++++ +  ++  IH + GDG+HY    +   F   +R+++ QM+Y  L G  
Sbjct: 1  MDSAQVQQILQQAL--NLEEIH-VKGDGSHYEVIAVDACFADMSRVKKQQMIYAPLMGYI 57

Query: 62 MGNALHALSIKTSVP 76
            N +HA+++KT  P
Sbjct: 58 QRNDIHAVTMKTFTP 72


>gi|197104203|ref|YP_002129580.1| stress-induced morphogen [Phenylobacterium zucineum HLK1]
 gi|196477623|gb|ACG77151.1| stress-induced morphogen [Phenylobacterium zucineum HLK1]
          Length = 92

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 28/49 (57%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G  +H+   I +  F G N++ + +MVY +L  ++   +HALS+K   P
Sbjct: 39 GGESHFNVVIEAAAFAGANKVARQRMVYRALAEELAGPVHALSVKALAP 87


>gi|92115110|ref|YP_575038.1| transcriptional regulator BolA [Chromohalobacter salexigens DSM
          3043]
 gi|91798200|gb|ABE60339.1| transcriptional regulator, BolA protein family [Chromohalobacter
          salexigens DSM 3043]
          Length = 103

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 23 IHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          +H++  D   H+   +++E F G   +++HQ VY  L +++   +HAL++    PD
Sbjct: 27 MHNVPPDSATHFKVTLVAERFAGLMPVKRHQQVYALLADELSGPVHALALHLYTPD 82


>gi|21231649|ref|NP_637566.1| hypothetical protein XCC2210 [Xanthomonas campestris pv.
          campestris str. ATCC 33913]
 gi|66768229|ref|YP_242991.1| hypothetical protein XC_1908 [Xanthomonas campestris pv.
          campestris str. 8004]
 gi|188991365|ref|YP_001903375.1| hypothetical protein xccb100_1970 [Xanthomonas campestris pv.
          campestris str. B100]
 gi|21113345|gb|AAM41490.1| conserved hypothetical protein [Xanthomonas campestris pv.
          campestris str. ATCC 33913]
 gi|66573561|gb|AAY48971.1| conserved hypothetical protein [Xanthomonas campestris pv.
          campestris str. 8004]
 gi|167733125|emb|CAP51323.1| Conserved hypothetical protein [Xanthomonas campestris pv.
          campestris]
          Length = 89

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 24 HDLAGDGN-HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          H  A DG  H+   ++S  F GK  + +H+ VY ++G  M   +HALSI+   P
Sbjct: 32 HAGARDGRGHFNVRVVSSVFAGKAPLARHRAVYAAVGEMMQTDIHALSIEALAP 85


>gi|85058647|ref|YP_454349.1| transcriptional regulator BolA [Sodalis glossinidius str.
          'morsitans']
 gi|84779167|dbj|BAE73944.1| cell division protein BolA [Sodalis glossinidius str.
          'morsitans']
          Length = 105

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 30/48 (62%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          LAG  +H+   ++S+ F G+  + +H+ +Y  L +++   +HAL++ T
Sbjct: 32 LAGSESHFKVVLVSDRFNGERILSRHRAIYGVLADELAGPVHALALHT 79


>gi|88858250|ref|ZP_01132892.1| regulator protein [Pseudoalteromonas tunicata D2]
 gi|88819867|gb|EAR29680.1| regulator protein [Pseudoalteromonas tunicata D2]
          Length = 107

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 31/50 (62%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          AG  +H+   I++E+F  +  +Q+H+ +   L +++ N +HAL++ T  P
Sbjct: 31 AGLESHFKVVIVTEDFANQRLLQRHRAINAVLADELANHIHALALHTYTP 80


>gi|146337739|ref|YP_001202787.1| hypothetical protein BRADO0611 [Bradyrhizobium sp. ORS278]
 gi|146190545|emb|CAL74547.1| conserved hypothetical protein. BolA-like protein (fragment)
          [Bradyrhizobium sp. ORS278]
          Length = 57

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 29/46 (63%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+   I+S+ F GK+R+ +H+++  +L  ++  ++HAL++    P
Sbjct: 9  THFRVYIVSQAFAGKSRVDRHRLINAALAEELAGSVHALALHAKAP 54


>gi|91225575|ref|ZP_01260649.1| BolA/YrbA family protein [Vibrio alginolyticus 12G01]
 gi|269967994|ref|ZP_06182032.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
 gi|91189695|gb|EAS75969.1| BolA/YrbA family protein [Vibrio alginolyticus 12G01]
 gi|269827351|gb|EEZ81647.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
          Length = 84

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 46/76 (60%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+  ++++++++ +  ++  +H + G+G+HY    +   F G +R+++ Q++Y  L   +
Sbjct: 1  MDSAKVQQLLEEAL--NLQEVH-VKGEGSHYEVVAVDACFDGMSRVKKQQLIYAPLMEYI 57

Query: 63 -GNALHALSIKTSVPD 77
            N +HALSIK   P+
Sbjct: 58 QRNDIHALSIKAFTPE 73


>gi|302759737|ref|XP_002963291.1| hypothetical protein SELMODRAFT_405062 [Selaginella
          moellendorffii]
 gi|300168559|gb|EFJ35162.1| hypothetical protein SELMODRAFT_405062 [Selaginella
          moellendorffii]
          Length = 107

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 8  IEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALH 67
          +E+ I++ +    V + D  GDG + +  +++  F+GK++I + +MVY ++ +++    H
Sbjct: 27 MERKIREKLGADNVVVKDAYGDGEYLSISVVASVFQGKSKIDRQKMVYKAVWDEVKYQEH 86

Query: 68 ALS-IKTSVPD 77
           +  I+   P+
Sbjct: 87 VIEQIRMETPE 97


>gi|299771500|ref|YP_003733526.1| putative toluene tolerance protein Ttg2F [Acinetobacter sp. DR1]
 gi|298701588|gb|ADI92153.1| putative toluene tolerance protein Ttg2F [Acinetobacter sp. DR1]
          Length = 83

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 40/76 (52%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MN  ++ +++K+  P + V +   +G    +   I+ ++F GK  + + Q+VY  L   +
Sbjct: 1  MNSEQLTQILKEAFPVAEVAV---SGQAGKFDLRIVDDQFEGKRTVARQQLVYAPLNTYI 57

Query: 63 GNA-LHALSIKTSVPD 77
           +  +HA++I+    D
Sbjct: 58 ASGEVHAVTIRAMTKD 73


>gi|323491701|ref|ZP_08096879.1| cell division protein BolA [Vibrio brasiliensis LMG 20546]
 gi|323314063|gb|EGA67149.1| cell division protein BolA [Vibrio brasiliensis LMG 20546]
          Length = 102

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 33/52 (63%), Gaps = 1/52 (1%)

Query: 23 IHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          +H++A G  +H+   I+SE F G   I +H+ V  +L +++ N +HALS+ T
Sbjct: 27 MHNVAPGSESHFKVVIVSENFAGLRLIARHRQVNQALADELANHIHALSMHT 78


>gi|163803758|ref|ZP_02197615.1| BolA/YrbA family protein [Vibrio sp. AND4]
 gi|159172442|gb|EDP57311.1| BolA/YrbA family protein [Vibrio sp. AND4]
          Length = 84

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPD 77
          + G+G+HY    +   F G +R+++ Q++Y  L + +  N +HALSIK   P+
Sbjct: 21 VKGEGSHYEVVAVDACFDGMSRVKKQQLIYGPLMDYIQRNDIHALSIKAFTPE 73


>gi|307200502|gb|EFN80664.1| BolA-like protein 3 [Harpegnathos saltator]
          Length = 101

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/68 (23%), Positives = 46/68 (67%), Gaps = 3/68 (4%)

Query: 11 MIKKGIPQSI-VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHA 68
          +++  +P+++ + + D++G  G  +   +++ EF+G N ++QH+++ ++L  ++ + +H 
Sbjct: 33 ILRNKLPEAVLIEVTDVSGGCGAMFDINVVAPEFKGLNTVKQHRIINEALKEEIKD-MHG 91

Query: 69 LSIKTSVP 76
          + I+TS+P
Sbjct: 92 IRIRTSLP 99


>gi|59711007|ref|YP_203783.1| DNA-binding transcriptional regulator [Vibrio fischeri ES114]
 gi|197334345|ref|YP_002155156.1| toluene tolerance protein TTG2F [Vibrio fischeri MJ11]
 gi|59479108|gb|AAW84895.1| predicted DNA-binding transcriptional regulator [Vibrio fischeri
          ES114]
 gi|197315835|gb|ACH65282.1| toluene tolerance protein TTG2F [Vibrio fischeri MJ11]
 gi|206246614|gb|ACI06208.1| Ttg2F [Aliivibrio fischeri]
          Length = 85

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 42/76 (55%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+  EI++++   +   +  IH + G+G+H+    +   F G +R+++ Q +Y  L   +
Sbjct: 1  MDSAEIKELLDAAL--QLEEIH-VKGEGSHFEVIAVDASFAGMSRVKKQQTIYGPLMEHI 57

Query: 63 G-NALHALSIKTSVPD 77
            N +HALSIK   P+
Sbjct: 58 STNTIHALSIKAFTPE 73


>gi|261250147|ref|ZP_05942723.1| protein yrbA [Vibrio orientalis CIP 102891]
 gi|260939263|gb|EEX95249.1| protein yrbA [Vibrio orientalis CIP 102891]
          Length = 84

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPD 77
          G+G+HY    +   F G +R+++ Q++Y  L   +  N +HA+SIK   PD
Sbjct: 23 GEGSHYEVVAVDACFDGMSRVKKQQLIYAPLMEYIQRNDIHAVSIKAYTPD 73


>gi|171679517|ref|XP_001904705.1| hypothetical protein [Podospora anserina S mat+]
 gi|170939384|emb|CAP64612.1| unnamed protein product [Podospora anserina S mat+]
          Length = 109

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 42/77 (54%), Gaps = 2/77 (2%)

Query: 2  SMNPHEIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          S+    +   +   +  S V + D++G  G  + + I+S EF GKN +++H++V  +L +
Sbjct: 4  SITEDSVRAALTDRLKASHVEVRDMSGGCGQAFTSLIVSPEFVGKNSLKRHRLVNAALKD 63

Query: 61 KMGNALHALSIKTSVPD 77
          ++   +HA S K   P+
Sbjct: 64 EIAQ-IHAWSAKCQTPE 79


>gi|332525966|ref|ZP_08402107.1| BolA-like protein [Rubrivivax benzoatilyticus JA2]
 gi|332109517|gb|EGJ10440.1| BolA-like protein [Rubrivivax benzoatilyticus JA2]
          Length = 87

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%)

Query: 24 HDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          H  A +G H+   I S  F G   + +H++VYD+LG      +HAL+I    P
Sbjct: 32 HAGAREGGHFQVRIRSARFAGLAPLARHRLVYDALGPLGQRGVHALAIDAQPP 84


>gi|281205664|gb|EFA79853.1| bolA family protein [Polysphondylium pallidum PN500]
          Length = 123

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 17  PQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTS 74
           P S+  I    G G+ Y  EIIS+EF  KN + QH+ V +S+  ++   LH L++ TS
Sbjct: 63  PSSLKVIDMSGGCGSMYRIEIISKEFNNKNTLNQHRQV-NSVLKEVIPTLHGLTLYTS 119


>gi|169860729|ref|XP_001836999.1| hypothetical protein CC1G_00135 [Coprinopsis cinerea okayama7#130]
 gi|116501721|gb|EAU84616.1| hypothetical protein CC1G_00135 [Coprinopsis cinerea okayama7#130]
          Length = 117

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 40/66 (60%), Gaps = 3/66 (4%)

Query: 9   EKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALH 67
           +K+I +  P S + + D++G  G  YA  I SE F+G   ++QH++V D+L  ++   +H
Sbjct: 51  KKLIDRFSP-SQLQVEDVSGGCGTFYAIVIASENFKGLPIVKQHRLVTDTLKKEI-EGIH 108

Query: 68  ALSIKT 73
            L +KT
Sbjct: 109 GLQLKT 114


>gi|21243049|ref|NP_642631.1| hypothetical protein XAC2314 [Xanthomonas axonopodis pv. citri
          str. 306]
 gi|21108561|gb|AAM37167.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
          str. 306]
          Length = 89

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 24 HDLAGDGN-HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          H  A DG  H+   ++S  F GK  + +H+ VY ++G  M   +HALSI+   P
Sbjct: 32 HAGARDGRGHFNVRVVSAAFVGKPPLARHRAVYAAVGEMMQTDIHALSIEALAP 85


>gi|71028532|ref|XP_763909.1| hypothetical protein [Theileria parva strain Muguga]
 gi|68350863|gb|EAN31626.1| hypothetical protein TP04_0274 [Theileria parva]
          Length = 84

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 41/70 (58%), Gaps = 2/70 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          +E+ I+  +  +I+ + D +G  G  + A I+S  F GK+ + +H++V  +L  +M + +
Sbjct: 6  VEEKIRSALSPTILKLIDKSGGCGAAFDAVIVSSLFEGKSLLDRHRLVNSALSEEM-DKI 64

Query: 67 HALSIKTSVP 76
          HA S+K   P
Sbjct: 65 HAFSMKCHTP 74


>gi|328541966|ref|YP_004302075.1| BolA-like protein [polymorphum gilvum SL003B-26A1]
 gi|326411716|gb|ADZ68779.1| BolA-like protein [Polymorphum gilvum SL003B-26A1]
          Length = 97

 Score = 39.3 bits (90), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 29/50 (58%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   H+   I++  F G +R+ +H+ V ++L  ++   +HAL+I+   PD
Sbjct: 38 GGETHFRVRIVTAAFAGMSRLARHRAVNEALAAELVGGVHALAIEARAPD 87


>gi|78484893|ref|YP_390818.1| BolA-like protein [Thiomicrospira crunogena XCL-2]
 gi|78363179|gb|ABB41144.1| transcriptional regulator BolA [Thiomicrospira crunogena XCL-2]
          Length = 101

 Score = 39.3 bits (90), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 23 IHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          +H    + +H+   ++S  F G N++++HQ VY +L  +M    HAL++ T  P 
Sbjct: 28 MHSGPAEESHFKLTLVSPAFEGMNKVKRHQAVYKALTEEMP-LFHALALHTYSPS 81


>gi|195025850|ref|XP_001986129.1| GH20705 [Drosophila grimshawi]
 gi|193902129|gb|EDW00996.1| GH20705 [Drosophila grimshawi]
          Length = 87

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 41/70 (58%), Gaps = 2/70 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          +E  +K+ +  + V + D + G G  ++A I+S+ F GK  +Q+H++V  +L  ++   +
Sbjct: 9  LEDKLKEKLDATYVQVCDDSDGCGGKFSAVIVSKAFEGKALLQKHRLVNTTLAEEL-KEI 67

Query: 67 HALSIKTSVP 76
          HA S K+  P
Sbjct: 68 HAFSQKSYTP 77


>gi|241206572|ref|YP_002977668.1| BolA family protein [Rhizobium leguminosarum bv. trifolii
          WSM1325]
 gi|240860462|gb|ACS58129.1| BolA family protein [Rhizobium leguminosarum bv. trifolii
          WSM1325]
          Length = 94

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 40/79 (50%), Gaps = 11/79 (13%)

Query: 9  EKMIKKGIPQSIVTIH----------DLAGDG-NHYAAEIISEEFRGKNRIQQHQMVYDS 57
          EK+++   P+ +  I           D+ G G  H    I+S +F G +R+ +H+ + D 
Sbjct: 10 EKLVEAFAPERLSVIDESHLHAGHQPDITGTGETHMRVRIVSGKFAGLSRLARHRAITDL 69

Query: 58 LGNKMGNALHALSIKTSVP 76
          L  ++   LHAL+++ + P
Sbjct: 70 LKPELDAGLHALAVEPAAP 88


>gi|326432537|gb|EGD78107.1| BolA family protein [Salpingoeca sp. ATCC 50818]
          Length = 125

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 6/74 (8%)

Query: 9   EKMIKKGIPQSIVTIHD------LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
           EK+  +  PQ +  I++        G   H+   I++ EF G   I++ + VY +L  +M
Sbjct: 31  EKLTARFKPQHLEIINESFKHNVPKGSETHFKVIIVAPEFEGMPLIKRSREVYATLDKEM 90

Query: 63  GNALHALSIKTSVP 76
              +HALSI    P
Sbjct: 91  AGPIHALSITARTP 104


>gi|262369180|ref|ZP_06062509.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262316858|gb|EEY97896.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 84

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 40/72 (55%), Gaps = 4/72 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MN  ++ +++K   P++ V +   +G G  +   I+ ++F GK  + + Q VY  L + +
Sbjct: 2  MNSEQLTEILKAAFPEAEVAV---SGQGGKFDLRIVDDQFEGKRPVARQQAVYAPLNSYI 58

Query: 63 GNA-LHALSIKT 73
           +  +HA++I+ 
Sbjct: 59 ASGEVHAVTIRA 70


>gi|260596805|ref|YP_003209376.1| transcriptional regulator BolA [Cronobacter turicensis z3032]
 gi|260215982|emb|CBA28630.1| Protein bolA [Cronobacter turicensis z3032]
          Length = 105

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+++Y  L  ++ + +HAL++ T
Sbjct: 33 AGSESHFKVVLVSDRFVGERFLNRHRLIYSILSEELASTVHALALHT 79


>gi|262393187|ref|YP_003285041.1| protein yrbA [Vibrio sp. Ex25]
 gi|262336781|gb|ACY50576.1| protein yrbA [Vibrio sp. Ex25]
          Length = 84

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 46/76 (60%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+  ++++++++ +  ++  +H + G+G+HY    +   F G +R+++ Q++Y  L   +
Sbjct: 1  MDSAKVQQLLEEAL--NLQEVH-VKGEGSHYEVVAVDACFDGMSRVKKQQLIYGPLMEYI 57

Query: 63 -GNALHALSIKTSVPD 77
            N +HALSIK   P+
Sbjct: 58 QRNDIHALSIKAFTPE 73


>gi|47230428|emb|CAF99621.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 46

 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDS 78
          Y   I S EF+GK  IQQHQ+V  +L  ++   +H L I T+VP+ 
Sbjct: 2  YEVHIESMEFKGKRTIQQHQLVNQALKEEI-QGMHGLRIFTNVPEK 46


>gi|308497338|ref|XP_003110856.1| hypothetical protein CRE_04865 [Caenorhabditis remanei]
 gi|308242736|gb|EFO86688.1| hypothetical protein CRE_04865 [Caenorhabditis remanei]
          Length = 100

 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 3/79 (3%)

Query: 1  MSMNPHEIEKMIKKGI-PQSIVTIHDLAG-DGNHYAAEIISEEFRGKNRIQQHQMVYDSL 58
          M      +++++   I PQ +  + +  G +G  +   IISE F GK  +Q H+MV  +L
Sbjct: 1  MCSPADRVKELLTNAIKPQKLNVVDESGGCEGFKFRILIISEAFGGKRTLQSHRMVQAAL 60

Query: 59 GNKMGNALHALSIKTSVPD 77
             MG   HAL+I    P+
Sbjct: 61 APIMGET-HALTICAYTPE 78


>gi|260775322|ref|ZP_05884219.1| cell division protein BolA [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608503|gb|EEX34668.1| cell division protein BolA [Vibrio coralliilyticus ATCC BAA-450]
          Length = 102

 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 30/50 (60%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          AG  +H+   ++S +F G+  I +H+ V   L +++ N +HALS+ T  P
Sbjct: 32 AGSESHFKVVVVSGKFEGQRLIGRHRQVNHVLADELANHIHALSMHTYTP 81


>gi|292486816|ref|YP_003529686.1| hypothetical protein EAMY_0328 [Erwinia amylovora CFBP1430]
 gi|292900786|ref|YP_003540155.1| hypothetical protein EAM_3092 [Erwinia amylovora ATCC 49946]
 gi|291200634|emb|CBJ47766.1| conserved hypothetical protein [Erwinia amylovora ATCC 49946]
 gi|291552233|emb|CBA19270.1| Uncharacterized protein yrbA [Erwinia amylovora CFBP1430]
 gi|312170884|emb|CBX79143.1| Uncharacterized protein yrbA [Erwinia amylovora ATCC BAA-2158]
          Length = 84

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EI+ ++   +P  +  +H + G+G+H+    + E F   +R+++ Q VY  L   +
Sbjct: 1  MENSEIQSVLMSALP--LQEVH-VTGEGSHFQVIAVGELFGEMSRVKKQQTVYAPLMAYI 57

Query: 63 G-NALHALSIKTSVPD 77
            N +HA+SIKT  P+
Sbjct: 58 ADNRIHAVSIKTYTPE 73


>gi|46202230|ref|ZP_00053537.2| COG0271: Stress-induced morphogen (activity unknown)
          [Magnetospirillum magnetotacticum MS-1]
          Length = 93

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 28/52 (53%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
          G  +H+   I+S  F G  RI++H+ V   L  ++   +HAL++    PD +
Sbjct: 38 GGESHFTVTIVSAAFEGVGRIERHRKVNALLAEELAGRVHALALTLMTPDEE 89


>gi|238758304|ref|ZP_04619482.1| hypothetical protein yaldo0001_1910 [Yersinia aldovae ATCC 35236]
 gi|238703427|gb|EEP95966.1| hypothetical protein yaldo0001_1910 [Yersinia aldovae ATCC 35236]
          Length = 84

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+ +EI+ ++   +  ++  +H + G+G+H+    + E F   +R++Q Q VY  L   +
Sbjct: 1  MDTNEIKDVLMNAL--ALQEVH-VTGEGSHFQVIAVGELFADMSRVKQQQAVYAPLMEYI 57

Query: 63 G-NALHALSIKTSVP 76
            N +HALSIK   P
Sbjct: 58 ADNRIHALSIKAYTP 72


>gi|148258738|ref|YP_001243323.1| hypothetical protein BBta_7570 [Bradyrhizobium sp. BTAi1]
 gi|146410911|gb|ABQ39417.1| hypothetical protein BBta_7570 [Bradyrhizobium sp. BTAi1]
          Length = 68

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 29/46 (63%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+   I+S+ F GK+R+ +H+++  +L  ++  ++HAL++    P
Sbjct: 20 THFRVYIVSQAFAGKSRVDRHRLINAALAAELAGSVHALALHAKAP 65


>gi|326795057|ref|YP_004312877.1| BolA family protein [Marinomonas mediterranea MMB-1]
 gi|326545821|gb|ADZ91041.1| BolA family protein [Marinomonas mediterranea MMB-1]
          Length = 78

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 43/72 (59%), Gaps = 4/72 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MN  E++ +++  I    V      G+G ++   ++S++F G N +++ Q+VY  L + +
Sbjct: 1  MNAGEVKALLESKIEGCQVYAD---GEGCNFQLVVVSDQFEGLNTVKRQQLVYSHLQDAI 57

Query: 63 GN-ALHALSIKT 73
           + A+HA+++KT
Sbjct: 58 SSGAIHAVTMKT 69


>gi|302416169|ref|XP_003005916.1| BolA domain-containing protein [Verticillium albo-atrum VaMs.102]
 gi|261355332|gb|EEY17760.1| BolA domain-containing protein [Verticillium albo-atrum VaMs.102]
          Length = 193

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG--NALHALSIKTSVPDSQ 79
            H+   I+S+ F+ K +  +H+MVY  L  ++G  N +HAL +KT  P+ +
Sbjct: 125 THFRLVIVSDAFKTKMQPARHRMVYALLREELGQENGIHALQLKTLTPEEE 175


>gi|257454738|ref|ZP_05619992.1| transcriptional regulator BolA [Enhydrobacter aerosaccus SK60]
 gi|257447858|gb|EEV22847.1| transcriptional regulator BolA [Enhydrobacter aerosaccus SK60]
          Length = 111

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 3/47 (6%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYD---SLGNKMGNALHALSI 71
          G   H+   I+SE F GK  +Q+HQ+VY    +L ++ G  +HA SI
Sbjct: 39 GKETHFKLTIVSEAFTGKRLVQRHQLVYGLIHTLLSQGGGQIHAFSI 85


>gi|85373354|ref|YP_457416.1| BolA protein [Erythrobacter litoralis HTCC2594]
 gi|84786437|gb|ABC62619.1| BolA protein [Erythrobacter litoralis HTCC2594]
          Length = 89

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 4/57 (7%)

Query: 24 HDLAGDG----NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          H  AGD     +H+   + S  F G +R+Q+ + V  +LG+ +G  +HA++IK S P
Sbjct: 31 HGHAGDDGSGESHFTVAMESAAFEGVSRLQRQRRVIAALGDIVGERVHAVAIKASAP 87


>gi|86145674|ref|ZP_01064004.1| cell division protein BolA [Vibrio sp. MED222]
 gi|218708713|ref|YP_002416334.1| cell division protein BolA [Vibrio splendidus LGP32]
 gi|85836645|gb|EAQ54771.1| cell division protein BolA [Vibrio sp. MED222]
 gi|218321732|emb|CAV17686.1| Cell division protein BolA [Vibrio splendidus LGP32]
          Length = 102

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          AG  +H+   ++S+ F G   I +H+ V  +L  ++ N +HALSI T   D
Sbjct: 32 AGSESHFKVIVVSDAFEGLRLIGRHRAVNKALSEELANNIHALSIHTYTKD 82


>gi|153008247|ref|YP_001369462.1| BolA family protein [Ochrobactrum anthropi ATCC 49188]
 gi|151560135|gb|ABS13633.1| BolA family protein [Ochrobactrum anthropi ATCC 49188]
          Length = 104

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 35/54 (64%), Gaps = 1/54 (1%)

Query: 23 IHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          ++D  G+  H+   I+++ F G +RIQ+H+ + + L  ++ + +HAL+++ S P
Sbjct: 46 VYDGTGE-THFRIRIVAQAFAGMSRIQRHRAINELLKEELDSGVHALALEPSAP 98


>gi|50083889|ref|YP_045399.1| putative toluene tolerance protein Ttg2F [Acinetobacter sp. ADP1]
 gi|49529865|emb|CAG67577.1| putative toluene tolerance protein Ttg2F [Acinetobacter sp. ADP1]
          Length = 102

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 42/73 (57%), Gaps = 4/73 (5%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          ++MN  ++ +++++  P+S V +   +G    +   I+ ++F GK  + + Q VY  L +
Sbjct: 18 LAMNSEQLTQILQEAFPESEVAV---SGQAGKFDLRIVDDQFEGKRTVARQQAVYAPLNS 74

Query: 61 KMGNA-LHALSIK 72
           + +  +HA++I+
Sbjct: 75 YIASGEVHAVTIR 87


>gi|5305148|emb|CAB46187.1| BolA protein [Pseudomonas chlororaphis subsp. aureofaciens]
          Length = 68

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (64%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN 64
          G   H+ A ++SE+F G N +++HQ VY +LG  MG 
Sbjct: 31 GLETHFKAVLVSEQFAGLNSVKRHQKVYATLGELMGE 67


>gi|39945326|ref|XP_362200.1| hypothetical protein MGG_04645 [Magnaporthe oryzae 70-15]
 gi|145021439|gb|EDK05568.1| hypothetical protein MGG_04645 [Magnaporthe oryzae 70-15]
          Length = 109

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN--ALHALSIKTSVPD 77
           H+   + SE+FR KN+  +H+ +Y  L ++M     +HAL +KT  P+
Sbjct: 47 THFRLVVTSEQFRSKNQPARHRAIYSLLKDEMAKEGGIHALQLKTMTPE 95


>gi|90020958|ref|YP_526785.1| transcriptional regulator BolA [Saccharophagus degradans 2-40]
 gi|89950558|gb|ABD80573.1| transcriptional regulator BolA [Saccharophagus degradans 2-40]
          Length = 103

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 24 HDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          H++A G   H+    +S+ F G   +++HQ VY +L +++ + +HAL++    P 
Sbjct: 29 HNVAKGSETHFKVVAVSDAFEGLGLVKRHQAVYAALADELASGVHALALHLFTPS 83


>gi|308452392|ref|XP_003089027.1| hypothetical protein CRE_13824 [Caenorhabditis remanei]
 gi|308243517|gb|EFO87469.1| hypothetical protein CRE_13824 [Caenorhabditis remanei]
          Length = 108

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 32 HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
          H+  +++S+ F GK  I++H++V   L  ++  ++HAL I  ++P S+
Sbjct: 44 HFRVQVVSDAFEGKRVIERHRLVNTCLAEELATSVHALRID-AIPTSK 90


>gi|225025210|ref|ZP_03714402.1| hypothetical protein EIKCOROL_02107 [Eikenella corrodens ATCC
          23834]
 gi|224941968|gb|EEG23177.1| hypothetical protein EIKCOROL_02107 [Eikenella corrodens ATCC
          23834]
          Length = 88

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G HY   I+S +F G NR+ + + +  +L +   + +HALSI+   P+
Sbjct: 37 GGHYRVHIVSTQFAGMNRVVRQRTIQQALHDLYPSQIHALSIRAQTPE 84


>gi|146088153|ref|XP_001466003.1| hypothetical protein [Leishmania infantum JPCM5]
 gi|134070104|emb|CAM68437.1| conserved hypothetical protein [Leishmania infantum JPCM5]
 gi|322499527|emb|CBZ34600.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 88

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 18 QSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          QSI  +   AG G+ +  +I+S  F+GK+ IQQH++V   L  ++ +A+H  ++ T
Sbjct: 31 QSIRVVDVSAGCGSFFNIDIVSPVFQGKSLIQQHRLVNSVLKEEI-SAIHGFTLNT 85


>gi|84996443|ref|XP_952943.1| hypothetical protein [Theileria annulata strain Ankara]
 gi|65303940|emb|CAI76319.1| hypothetical protein, conserved [Theileria annulata]
          Length = 84

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 40/70 (57%), Gaps = 2/70 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          +E+ I+  +  +I+ + D +G  G  + A I+S  F GK+ + +H++V  +L  +M   +
Sbjct: 6  VEEKIRSALSPTILKLVDKSGGCGAAFDAVIVSSLFEGKSLLDRHRLVNSALSEEM-EKI 64

Query: 67 HALSIKTSVP 76
          HA S+K   P
Sbjct: 65 HAFSMKCHTP 74


>gi|325915979|ref|ZP_08178272.1| transcriptional regulator, BolA protein family [Xanthomonas
          vesicatoria ATCC 35937]
 gi|325537789|gb|EGD09492.1| transcriptional regulator, BolA protein family [Xanthomonas
          vesicatoria ATCC 35937]
          Length = 89

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 24 HDLAGDGN-HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          H  A DG  H+   ++S  F GK  + +H+ VY ++G  M   +HALSI+   P
Sbjct: 32 HAGARDGRGHFNVRVVSAVFAGKPPLARHRAVYAAVGEMMQTDIHALSIEAIAP 85


>gi|195121899|ref|XP_002005450.1| GI19066 [Drosophila mojavensis]
 gi|193910518|gb|EDW09385.1| GI19066 [Drosophila mojavensis]
          Length = 86

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 41/70 (58%), Gaps = 2/70 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          +E  +K+ +  + V + D + G G  ++A I+S+ F GK  +Q+H++V  +L  ++   +
Sbjct: 9  LEDKLKEKLDATYVQVTDESDGCGGKFSAIIVSKAFEGKALLQKHRLVNTTLAEEL-KEI 67

Query: 67 HALSIKTSVP 76
          HA S K+  P
Sbjct: 68 HAFSQKSYTP 77


>gi|332163075|ref|YP_004299652.1| BolA-like protein [Yersinia enterocolitica subsp. palearctica
          105.5R(r)]
 gi|318604045|emb|CBY25543.1| yrba protein [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325667305|gb|ADZ43949.1| BolA-like protein [Yersinia enterocolitica subsp. palearctica
          105.5R(r)]
 gi|330862748|emb|CBX72890.1| uncharacterized protein yrbA [Yersinia enterocolitica W22703]
          Length = 84

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+ +EI+ ++ + +  ++   H + GDG+H+    + E F   +R+++ Q VY  L   +
Sbjct: 1  MDTNEIKDVLMRAL--ALQEAH-VTGDGSHFQVIAVGELFADMSRVKKQQAVYAPLMEYI 57

Query: 63 G-NALHALSIKTSVP 76
            N +HALSIK   P
Sbjct: 58 ADNRIHALSIKAYTP 72


>gi|268572367|ref|XP_002648944.1| Hypothetical protein CBG21257 [Caenorhabditis briggsae]
 gi|187022687|emb|CAP38114.1| hypothetical protein CBG_21257 [Caenorhabditis briggsae AF16]
          Length = 108

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 32 HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
          H+  +++S+ F GK  I++H++V   L  ++   +HAL I  ++P S+
Sbjct: 44 HFRVQVVSDAFEGKRVIERHRLVNTCLAEELATTVHALRID-AIPTSK 90


>gi|71990814|ref|NP_001022757.1| hypothetical protein T12D8.10 [Caenorhabditis elegans]
 gi|51014196|emb|CAH10814.1| C. elegans protein T12D8.10, confirmed by transcript evidence
          [Caenorhabditis elegans]
          Length = 98

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 3/79 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAG--DGNHYAAEIISEEFRGKNRIQQHQMVYDSL 58
          M+     +  ++ + I   I+ + D +G  DG  +   I+SE F GK  +Q H++V  +L
Sbjct: 1  MASPVERVNALLTEAIKPQILKVVDESGGCDGYKFRLLIVSEAFEGKCTLQSHRLVQAAL 60

Query: 59 GNKMGNALHALSIKTSVPD 77
             M +  HAL+I    P+
Sbjct: 61 APIM-DETHALTICAYTPE 78


>gi|259907023|ref|YP_002647379.1| transcriptional regulator (BolA family) [Erwinia pyrifoliae
          Ep1/96]
 gi|224962645|emb|CAX54100.1| transcriptional regulator (BolA family) [Erwinia pyrifoliae
          Ep1/96]
 gi|283476818|emb|CAY72656.1| Uncharacterized protein yrbA [Erwinia pyrifoliae DSM 12163]
 gi|310766235|gb|ADP11185.1| transcriptional regulator (BolA family) [Erwinia sp. Ejp617]
          Length = 84

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 4/76 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EI+ ++   +P  +  +H + G+G+H+    + E F   +R+++ Q VY  L   +
Sbjct: 1  MENSEIQSVLMSALP--LQEVH-VTGEGSHFQVIAVGELFGELSRVKKQQTVYAPLMAYI 57

Query: 63 G-NALHALSIKTSVPD 77
            N +HA+SIKT  P+
Sbjct: 58 ADNRIHAVSIKTYTPE 73


>gi|321263037|ref|XP_003196237.1| hypothetical Protein CGB_I3350C [Cryptococcus gattii WM276]
 gi|317462712|gb|ADV24450.1| conserved hypothetical protein [Cryptococcus gattii WM276]
          Length = 164

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 28  GDG-NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVP 76
           G G  H+A  ++SE F+GK  I +H+MV   L  +     LHALS++   P
Sbjct: 102 GSGETHFAIHLVSESFKGKTAIARHRMVNALLKTEFDEQGLHALSLRLKTP 152


>gi|114570827|ref|YP_757507.1| transcriptional regulator BolA [Maricaulis maris MCS10]
 gi|114341289|gb|ABI66569.1| transcriptional regulator, BolA protein family [Maricaulis maris
          MCS10]
          Length = 89

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 39/77 (50%), Gaps = 11/77 (14%)

Query: 7  EIEKMIKKGIPQSIVTIHDLA-----------GDGNHYAAEIISEEFRGKNRIQQHQMVY 55
           IE  ++K    S +T+ D +           G  +H+  +I++  F G +R+  H++V 
Sbjct: 7  RIETKLQKAFTPSALTVTDDSHLHAGHAGARPGGESHFTVDIVASRFDGLSRVACHRLVN 66

Query: 56 DSLGNKMGNALHALSIK 72
          ++L  ++   +HAL I+
Sbjct: 67 EALAEELAGPVHALVIR 83


>gi|332530713|ref|ZP_08406643.1| BolA family protein [Hylemonella gracilis ATCC 19624]
 gi|332039834|gb|EGI76230.1| BolA family protein [Hylemonella gracilis ATCC 19624]
          Length = 109

 Score = 38.9 bits (89), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 17/62 (27%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSL-----------------GNKMGNALHALS 70
           G G H+   I S  F G++R+ QH++VYD+L                 G   G+++HAL+
Sbjct: 46  GLGTHFRVRIASPLFAGRSRVAQHRLVYDALHDFFDPYNKHSATAGTRGEPRGSSVHALA 105

Query: 71  IK 72
           I+
Sbjct: 106 IE 107


>gi|258620960|ref|ZP_05715994.1| BolA protein [Vibrio mimicus VM573]
 gi|258627316|ref|ZP_05722100.1| BolA protein [Vibrio mimicus VM603]
 gi|262170739|ref|ZP_06038417.1| cell division protein BolA [Vibrio mimicus MB-451]
 gi|258580354|gb|EEW05319.1| BolA protein [Vibrio mimicus VM603]
 gi|258586348|gb|EEW11063.1| BolA protein [Vibrio mimicus VM573]
 gi|261891815|gb|EEY37801.1| cell division protein BolA [Vibrio mimicus MB-451]
          Length = 106

 Score = 38.9 bits (89), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 29/46 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   I+S+ F G   + +H++V  +L +++ N +HAL+I T
Sbjct: 33 GSESHFKVTIVSDRFDGLRLVARHRLVNQTLADELANHIHALAIHT 78


>gi|119946505|ref|YP_944185.1| BolA family protein [Psychromonas ingrahamii 37]
 gi|119865109|gb|ABM04586.1| BolA family protein [Psychromonas ingrahamii 37]
          Length = 82

 Score = 38.9 bits (89), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 39/70 (55%), Gaps = 2/70 (2%)

Query: 10 KMIKKGIPQSIVTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALH 67
          ++IK+ + Q++     +  G+   +    +S  F   +R+++ Q +YD L  ++  NA+H
Sbjct: 4  EIIKEKLEQALALDECIVKGENGTFQVIAVSAMFADMSRVKKQQAIYDPLTEEIASNAIH 63

Query: 68 ALSIKTSVPD 77
          ALSIK   PD
Sbjct: 64 ALSIKALTPD 73


>gi|270008808|gb|EFA05256.1| hypothetical protein TcasGA2_TC015408 [Tribolium castaneum]
          Length = 533

 Score = 38.9 bits (89), Expect = 0.27,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 34/55 (61%), Gaps = 1/55 (1%)

Query: 23  IHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           I +  G G  ++  I+S++FRGK  +Q+H++V   L  ++  ++HA S KT  P+
Sbjct: 73  IDESDGCGGKFSCVIVSDKFRGKPLLQRHRLVNSVLQEEL-KSIHAFSQKTYTPE 126


>gi|330722165|gb|EGH00065.1| Cell division protein BolA [gamma proteobacterium IMCC2047]
          Length = 92

 Score = 38.5 bits (88), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          +H+ A I+S  F G   + +HQ VY  L   M N +HAL +KT   +
Sbjct: 39 SHFKAVIVSSAFDGVGMVARHQHVYKILAEMMNNPIHALVLKTYTAE 85


>gi|123443930|ref|YP_001007901.1| BolA-like protein [Yersinia enterocolitica subsp. enterocolitica
          8081]
 gi|122090891|emb|CAL13773.1| BolA-like protein [Yersinia enterocolitica subsp. enterocolitica
          8081]
          Length = 87

 Score = 38.5 bits (88), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+ +EI+ ++ + +  ++   H + GDG+H+    + E F   +R+++ Q VY  L   +
Sbjct: 4  MDTNEIKDVLMRAL--ALQEAH-VTGDGSHFQVIAVGELFADMSRVKKQQAVYAPLMEYI 60

Query: 63 G-NALHALSIKTSVP 76
            N +HALSIK   P
Sbjct: 61 ADNRIHALSIKAYTP 75


>gi|119505148|ref|ZP_01627224.1| putative toluene tolerance protein Ttg2F [marine gamma
          proteobacterium HTCC2080]
 gi|119459130|gb|EAW40229.1| putative toluene tolerance protein Ttg2F [marine gamma
          proteobacterium HTCC2080]
          Length = 77

 Score = 38.5 bits (88), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+ +E+  ++    P+  V + +LAG   HY   +ISE F G   + + Q VY  L + +
Sbjct: 1  MDVNEVRDLVLAAFPEGEVDV-ELAG--GHYTVTVISEIFGGVRSVARQQRVYAPLASAI 57

Query: 63 GNA-LHALSIKTSVP 76
              +HA++I+   P
Sbjct: 58 AAGHMHAVNIRALTP 72


>gi|13473078|ref|NP_104645.1| hypothetical protein mlr3565 [Mesorhizobium loti MAFF303099]
 gi|14023826|dbj|BAB50431.1| mlr3565 [Mesorhizobium loti MAFF303099]
          Length = 100

 Score = 38.5 bits (88), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 28/46 (60%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+   ++S  F G +RI +H+ V + L +++   +HAL+I+ S P
Sbjct: 49 THFRVRVVSSAFAGMSRIDRHRAVNELLADELKAGVHALAIEPSAP 94


>gi|302916345|ref|XP_003051983.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256732922|gb|EEU46270.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 92

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          + + IK+ +    V + D++G  G  + + I+S +F+G N +++H++V  +L +++ N +
Sbjct: 9  MREAIKERLGAVHVEVTDMSGGCGQAFNSLIVSSQFQGLNSLKRHRLVNAALKDEIAN-I 67

Query: 67 HALSIKTSVPD 77
          HA + K   PD
Sbjct: 68 HAWTAKCQTPD 78


>gi|114766302|ref|ZP_01445288.1| BolA protein, truncation [Pelagibaca bermudensis HTCC2601]
 gi|114541419|gb|EAU44465.1| BolA protein, truncation [Roseovarius sp. HTCC2601]
          Length = 85

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 42/76 (55%), Gaps = 11/76 (14%)

Query: 7  EIEKMIKKGIPQSIVTIHDLAG--------DGN---HYAAEIISEEFRGKNRIQQHQMVY 55
          EIE  +++    S + + + +G        DG+   H+   + + E  GK+RI +H+ V+
Sbjct: 6  EIETRLREAFTPSELEVRNDSGRHAGHAGDDGSGESHFHVRLRAPELAGKSRIARHRAVH 65

Query: 56 DSLGNKMGNALHALSI 71
           +LG ++  A+HALS+
Sbjct: 66 AALGAELTTAIHALSL 81


>gi|77361454|ref|YP_341029.1| transcriptional regulator [Pseudoalteromonas haloplanktis TAC125]
 gi|76876365|emb|CAI87587.1| putative transcriptional regulator (BolA family)
          [Pseudoalteromonas haloplanktis TAC125]
          Length = 85

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-ALHALSIKTSVP 76
           +G+HY    + E F G +R+++ Q+VY  L N + +  +HA+SI+   P
Sbjct: 23 ANGSHYEVIAVGECFDGLSRVKKQQLVYGPLMNTISDGTIHAVSIRAFTP 72


>gi|315053897|ref|XP_003176323.1| BolA domain-containing protein [Arthroderma gypseum CBS 118893]
 gi|311338169|gb|EFQ97371.1| BolA domain-containing protein [Arthroderma gypseum CBS 118893]
          Length = 96

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          +++ P  I+ ++   I    V + DL+G  G  + A I+S +F  K  + +H++V  +L 
Sbjct: 13 LAVTPDSIKSILTTKIGAQHVEVEDLSGGCGQAFQAIIVSPQFESKTTLARHRLVNSALK 72

Query: 60 NKMGNALHALSIKTSVPD 77
           ++  A+HA + K   P+
Sbjct: 73 AEIA-AIHAWTPKCYTPE 89


>gi|291411706|ref|XP_002722128.1| PREDICTED: bolA homolog 3-like [Oryctolagus cuniculus]
          Length = 109

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 2/63 (3%)

Query: 17  PQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSV 75
           P + + + D++G  G  Y  +I  E+F+ K  +QQHQMV  +L   +   +H L I T V
Sbjct: 48  PATAIKVTDISGGCGALYEIKIELEDFKEKRTVQQHQMVNQALKEAI-KEMHGLRIFTLV 106

Query: 76  PDS 78
           P  
Sbjct: 107 PRC 109


>gi|255722629|ref|XP_002546249.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
 gi|240136738|gb|EER36291.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
          Length = 88

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 43/76 (56%), Gaps = 2/76 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNK 61
          +    +  +I   +  ++V + D++G  G  +A  I+S  F+GKN++ +H++V   L  +
Sbjct: 5  LTSDSLRDIIAARLQANLVQVEDMSGGCGQAFAVIIVSPVFQGKNKLARHRLVNTQLKQE 64

Query: 62 MGNALHALSIKTSVPD 77
          +  ++HA + K+  P+
Sbjct: 65 IA-SIHAFTQKSFTPE 79


>gi|148652312|ref|YP_001279405.1| BolA family protein [Psychrobacter sp. PRwf-1]
 gi|148571396|gb|ABQ93455.1| BolA family protein [Psychrobacter sp. PRwf-1]
          Length = 84

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          MSMN  ++   ++   P++ +     A  GN +   ++   F GK  +Q+ Q +Y  + +
Sbjct: 1  MSMNADDLIAFLQPHFPEAFIQA---ANQGNKFDVRVVDASFEGKRLVQRQQAIYGLVND 57

Query: 61 KMGNA-LHALSIKTSVP 76
           + +  +HAL+I+   P
Sbjct: 58 IIASGEIHALNIQALTP 74


>gi|120611613|ref|YP_971291.1| transcriptional regulator BolA [Acidovorax citrulli AAC00-1]
 gi|120590077|gb|ABM33517.1| transcriptional regulator, BolA protein family [Acidovorax
          citrulli AAC00-1]
          Length = 88

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIK 72
          G G H+   I S  F  ++R+ +H++VYD+L   +    HA++I+
Sbjct: 42 GAGTHFRVRISSPLFTARSRVARHRLVYDALQEFIDQGAHAIAIE 86


>gi|332974543|gb|EGK11463.1| DEAD/DEAH box family ATP-dependent helicase [Kingella kingae ATCC
          23330]
          Length = 90

 Score = 38.5 bits (88), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVP 76
          G HYA  I+S+ F GKNRI + +MV  +         +HALSI    P
Sbjct: 38 GGHYAVLIVSDVFAGKNRIARWRMVQAAFAPLFDAGKIHALSIDAQTP 85


>gi|322506335|gb|ADX01789.1| morphogenic pathway activator [Acinetobacter baumannii 1656-2]
          Length = 102

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 11/86 (12%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDG-------NHYAAEIISEEFRGKNRIQQHQM 53
          MS+    IE++ +   P  +  I++ AG G       +H+   ++SEEF G   +Q+HQ 
Sbjct: 1  MSLEQQLIERL-QTLAPSYLEVINESAGHGGYFPGKESHFKVIVVSEEFNGLRLVQRHQK 59

Query: 54 VYDSLGNKMGNA--LHALSIKTSVPD 77
          VY +L + + N   +HAL+I   +P 
Sbjct: 60 VY-ALASDLMNPGQIHALAIHAYLPS 84


>gi|227328847|ref|ZP_03832871.1| transcriptional regulator BolA [Pectobacterium carotovorum subsp.
          carotovorum WPP14]
          Length = 104

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S++F G+  I +H+ VY  L  ++  ++HAL++ T
Sbjct: 32 AGAESHFKVVLVSDKFTGERVIGRHRAVYAVLAEELAGSVHALALHT 78


>gi|218510605|ref|ZP_03508483.1| BolA family protein [Rhizobium etli Brasil 5]
          Length = 69

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 25 DLAGDG-NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          D+ G G  H    I+S +F G +R+ +H+ + D L  ++   LHAL+++ + P
Sbjct: 11 DITGTGETHMRVRIVSAKFAGLSRLARHRAITDLLKPELDAGLHALAVEPAAP 63


>gi|321476627|gb|EFX87587.1| hypothetical protein DAPPUDRAFT_43049 [Daphnia pulex]
          Length = 112

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 28/50 (56%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   H+   ++S +F     +Q+H++V + L +++ N +HALSI    P 
Sbjct: 42 GSETHFKVVVVSSKFENTPLLQRHRLVNEVLCDELKNGVHALSIVAKTPS 91


>gi|261493729|ref|ZP_05990247.1| putative transcriptional regulator, BolA [Mannheimia haemolytica
          serotype A2 str. BOVINE]
 gi|261494551|ref|ZP_05991035.1| putative transcriptional regulator, BolA [Mannheimia haemolytica
          serotype A2 str. OVINE]
 gi|261309800|gb|EEY11019.1| putative transcriptional regulator, BolA [Mannheimia haemolytica
          serotype A2 str. OVINE]
 gi|261310619|gb|EEY11804.1| putative transcriptional regulator, BolA [Mannheimia haemolytica
          serotype A2 str. BOVINE]
          Length = 112

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 28/44 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSI 71
          G  +H+   ++S++F G+  + +H+ VY  L  ++ N +HAL++
Sbjct: 43 GAESHFKLTLVSDKFEGQRTVARHRAVYACLAEELANGVHALAL 86


>gi|261822509|ref|YP_003260615.1| transcriptional regulator BolA [Pectobacterium wasabiae WPP163]
 gi|261606522|gb|ACX89008.1| BolA family protein [Pectobacterium wasabiae WPP163]
          Length = 104

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S++F G+  I +H+ VY  L  ++  ++HAL++ T
Sbjct: 32 AGAESHFKVVLVSDKFTGERVIGRHRSVYAVLATELAGSVHALALHT 78


>gi|324563881|gb|ADY49867.1| BolA-like protein 2 [Ascaris suum]
          Length = 83

 Score = 38.5 bits (88), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 9  EKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHA 68
          EK+ ++  P  +    +  G G  +   I+SE+F  K  I  H++V  +L ++M +++HA
Sbjct: 9  EKLTQQLNPSHLEVEDESDGCGAKFRVVIVSEQFNDKPTIACHRLVQAALKDEM-SSIHA 67

Query: 69 LSIKTSVPD 77
          L+IKT  P+
Sbjct: 68 LTIKTFSPE 76


>gi|156935014|ref|YP_001438930.1| transcriptional regulator BolA [Cronobacter sakazakii ATCC
          BAA-894]
 gi|156533268|gb|ABU78094.1| hypothetical protein ESA_02865 [Cronobacter sakazakii ATCC
          BAA-894]
          Length = 111

 Score = 38.5 bits (88), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+++Y  L  ++ + +HAL++ T
Sbjct: 39 AGSESHFKVVLVSDRFVGERFLNRHRLIYGILSEELASTVHALALHT 85


>gi|253687441|ref|YP_003016631.1| BolA family protein [Pectobacterium carotovorum subsp.
          carotovorum PC1]
 gi|251754019|gb|ACT12095.1| BolA family protein [Pectobacterium carotovorum subsp.
          carotovorum PC1]
          Length = 104

 Score = 38.5 bits (88), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S++F G+  I +H+ VY  L  ++  ++HAL++ T
Sbjct: 32 AGAESHFKVVLVSDKFTGERVIGRHRAVYAVLAEELAGSVHALALHT 78


>gi|221119918|ref|XP_002159781.1| PREDICTED: similar to BolA-2 protein [Hydra magnipapillata]
          Length = 83

 Score = 38.5 bits (88), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 42/72 (58%), Gaps = 2/72 (2%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNK 61
          M   +IE +IK+ +      I D +G  G+ +A  I+S+EF GK  +Q+H++V   L + 
Sbjct: 1  MTAEKIEALIKEKLNPVHFEITDKSGGCGSMFAVVIVSDEFNGKPLLQRHRLVNTILKDI 60

Query: 62 MGNALHALSIKT 73
          +  ++HA  +KT
Sbjct: 61 LP-SIHAFEMKT 71


>gi|299473621|emb|CBN78015.1| BolA protein [Ectocarpus siliculosus]
          Length = 171

 Score = 38.5 bits (88), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%)

Query: 23  IHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           +H      +H+   ++S+EF GK  + +H+MV      +M   +HALSI+   P
Sbjct: 92  MHSGPAKESHFKVIVVSDEFEGKPLLARHRMVNALFAEEMKGKMHALSIQGKTP 145


>gi|326476742|gb|EGE00752.1| BolA domain-containing protein [Trichophyton tonsurans CBS
          112818]
          Length = 64

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 9/63 (14%)

Query: 19 SIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN--ALHALSIKTSVP 76
          S++TI+        Y+  IIS  F  K +  +H+MVY+ L  +M     +HAL +KT  P
Sbjct: 3  SLLTIYS-------YSVTIISSAFASKTQPARHRMVYNLLKEEMAQEGGIHALQLKTRTP 55

Query: 77 DSQ 79
          + +
Sbjct: 56 EEE 58


>gi|323497939|ref|ZP_08102948.1| cell division protein BolA [Vibrio sinaloensis DSM 21326]
 gi|323316984|gb|EGA69986.1| cell division protein BolA [Vibrio sinaloensis DSM 21326]
          Length = 102

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 33/52 (63%), Gaps = 1/52 (1%)

Query: 23 IHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          +H++A G  +H+   ++S  F G   I +H++V  +L +++ N +HALSI T
Sbjct: 27 MHNVAPGSESHFKVIVVSAAFEGLRLIGRHRLVNQALADELANHIHALSIHT 78


>gi|300715589|ref|YP_003740392.1| transcriptional regulator BolA [Erwinia billingiae Eb661]
 gi|299061425|emb|CAX58537.1| Transcriptional regulator BolA [Erwinia billingiae Eb661]
          Length = 104

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 40/74 (54%), Gaps = 7/74 (9%)

Query: 7  EIEKMIKKGIPQSIVTIHD-------LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          EIE+ ++  +    + +HD        AG  +H+   I+S+ F  +  + +H+ +Y +L 
Sbjct: 5  EIEEKLRTALAPVHLEVHDESYRHNVPAGAESHFKVVIVSDHFINQRFLMRHRTIYSALA 64

Query: 60 NKMGNALHALSIKT 73
           ++  ++HAL++ T
Sbjct: 65 AELAGSVHALALHT 78


>gi|212709195|ref|ZP_03317323.1| hypothetical protein PROVALCAL_00228 [Providencia alcalifaciens
          DSM 30120]
 gi|212688107|gb|EEB47635.1| hypothetical protein PROVALCAL_00228 [Providencia alcalifaciens
          DSM 30120]
          Length = 112

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 30/51 (58%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          L G  +H+   ++S++F  K  I +H+ +Y  L +++   +HAL++ T  P
Sbjct: 38 LPGSESHFKVVLVSDKFENKRMIGRHREIYAILADELAGGIHALALHTYTP 88


>gi|50119260|ref|YP_048427.1| putative bolA family protein [Pectobacterium atrosepticum
          SCRI1043]
 gi|49609786|emb|CAG73220.1| putative bolA family protein [Pectobacterium atrosepticum
          SCRI1043]
          Length = 84

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVPD 77
          ++GDG+H+    +   F G +R+++ Q VY  L   +  N +HALSIK   P+
Sbjct: 21 VSGDGSHFQVIAVGGLFAGMSRVKKQQAVYAPLMEYIADNRIHALSIKAYTPE 73


>gi|254468904|ref|ZP_05082310.1| BolA family protein [beta proteobacterium KB13]
 gi|207087714|gb|EDZ64997.1| BolA family protein [beta proteobacterium KB13]
          Length = 80

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G HY   I S+    +NRIQ H+ +YD L + +   +HAL IK 
Sbjct: 35 GGHYTIIIKSDLLEKQNRIQSHRQIYDLLDDLIPQKIHALQIKV 78


>gi|212532621|ref|XP_002146467.1| BolA domain protein [Penicillium marneffei ATCC 18224]
 gi|210071831|gb|EEA25920.1| BolA domain protein [Penicillium marneffei ATCC 18224]
          Length = 141

 Score = 38.5 bits (88), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN--ALHALSIKTSVPDSQ 79
            H+   I SE F+ K++  +H+MVY  L ++M     +HAL ++T  P+ +
Sbjct: 81  THFHVTITSEAFQSKSQPVRHRMVYSLLKDEMAREGGIHALQLRTRTPEEE 131


>gi|293394228|ref|ZP_06638528.1| BolA superfamily transcriptional regulator [Serratia odorifera
          DSM 4582]
 gi|291423206|gb|EFE96435.1| BolA superfamily transcriptional regulator [Serratia odorifera
          DSM 4582]
          Length = 84

 Score = 38.5 bits (88), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVPD 77
          + GDG+H+    + E F   +R+++ Q VY  L   +  N +HALSIK   P+
Sbjct: 21 VTGDGSHFQVIAVGEIFATMSRVKKQQAVYAPLMEYIADNRIHALSIKAYTPE 73


>gi|262166368|ref|ZP_06034105.1| cell division protein BolA [Vibrio mimicus VM223]
 gi|262026084|gb|EEY44752.1| cell division protein BolA [Vibrio mimicus VM223]
          Length = 106

 Score = 38.5 bits (88), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 29/46 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   I+S+ F G   + +H++V  +L +++ N +HAL+I T
Sbjct: 33 GSESHFKVTIVSDHFDGLRLVARHRLVNQTLADELANHIHALAIHT 78


>gi|169797675|ref|YP_001715468.1| putative activator of morphogenic pathway (BolA), important in
          general stress response [Acinetobacter baumannii AYE]
 gi|213155531|ref|YP_002317576.1| BolA family protein [Acinetobacter baumannii AB0057]
 gi|301345539|ref|ZP_07226280.1| BolA family protein [Acinetobacter baumannii AB056]
 gi|301511375|ref|ZP_07236612.1| BolA family protein [Acinetobacter baumannii AB058]
 gi|301597577|ref|ZP_07242585.1| BolA family protein [Acinetobacter baumannii AB059]
 gi|169150602|emb|CAM88511.1| putative activator of morphogenic pathway (BolA) , important in
          general stress response [Acinetobacter baumannii AYE]
 gi|213054691|gb|ACJ39593.1| BolA family protein [Acinetobacter baumannii AB0057]
          Length = 102

 Score = 38.5 bits (88), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 11/86 (12%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDG-------NHYAAEIISEEFRGKNRIQQHQM 53
          MS+    IE++ +   P  +  I++ AG G       +H+   ++SEEF G   +Q+HQ 
Sbjct: 1  MSLEQQLIERL-QTLAPSHLEVINESAGHGGYFPGKESHFKVIVVSEEFNGLRLVQRHQK 59

Query: 54 VYDSLGNKMGNA--LHALSIKTSVPD 77
          VY +L + + N   +HAL+I   +P 
Sbjct: 60 VY-ALASDLMNPGQIHALAIHAYLPS 84


>gi|332852623|ref|ZP_08434277.1| BolA-like protein [Acinetobacter baumannii 6013150]
 gi|332869338|ref|ZP_08438716.1| BolA-like protein [Acinetobacter baumannii 6013113]
 gi|332875600|ref|ZP_08443412.1| BolA-like protein [Acinetobacter baumannii 6014059]
 gi|332729091|gb|EGJ60438.1| BolA-like protein [Acinetobacter baumannii 6013150]
 gi|332732756|gb|EGJ63972.1| BolA-like protein [Acinetobacter baumannii 6013113]
 gi|332736173|gb|EGJ67188.1| BolA-like protein [Acinetobacter baumannii 6014059]
          Length = 121

 Score = 38.1 bits (87), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 11/86 (12%)

Query: 1   MSMNPHEIEKMIKKGIPQSIVTIHDLAGDG-------NHYAAEIISEEFRGKNRIQQHQM 53
           MS+    IE++ +   P  +  I++ AG G       +H+   ++SEEF G   +Q+HQ 
Sbjct: 20  MSLEQQLIERL-QTLAPSHLEVINESAGHGGYFPGKESHFKVIVVSEEFNGLRLVQRHQK 78

Query: 54  VYDSLGNKMGNA--LHALSIKTSVPD 77
           VY +L + + N   +HAL+I   +P 
Sbjct: 79  VY-ALASDLMNPGQIHALAIHAYLPS 103


>gi|188534637|ref|YP_001908434.1| transcriptional regulator BolA [Erwinia tasmaniensis Et1/99]
 gi|188029679|emb|CAO97558.1| Morphogene, putative regulator of murein genes [Erwinia
          tasmaniensis Et1/99]
          Length = 104

 Score = 38.1 bits (87), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 30/50 (60%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          AG  +H+   I+SE F  +  + +H+ +Y  L +++  ++HAL++ +  P
Sbjct: 32 AGAESHFKVVIVSESFNDQRSLARHRAIYAVLADELAGSVHALALHSYTP 81


>gi|241759340|ref|ZP_04757446.1| BolA/YrbA family protein [Neisseria flavescens SK114]
 gi|241320476|gb|EER56773.1| BolA/YrbA family protein [Neisseria flavescens SK114]
          Length = 90

 Score = 38.1 bits (87), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL-HALSIKTSVPD 77
          G HYA  ++S  F    R+Q+ +M+   L +   + L HALSIK + PD
Sbjct: 38 GGHYAIVVVSNAFENIGRLQRQRMIKQLLQDLFSDGLIHALSIKAATPD 86


>gi|58260248|ref|XP_567534.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|134116312|ref|XP_773110.1| hypothetical protein CNBJ1050 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50255731|gb|EAL18463.1| hypothetical protein CNBJ1050 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57229584|gb|AAW46017.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 161

 Score = 38.1 bits (87), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 28  GDG-NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVP 76
           G G  H+A  ++SE F+GK  I +H+MV   L  +     LHALS++   P
Sbjct: 99  GSGETHFAIHLVSESFKGKTAIARHRMVNALLKPEFDERGLHALSLRLKTP 149


>gi|330830794|ref|YP_004393746.1| RNA polymerase sigma factor [Aeromonas veronii B565]
 gi|328805930|gb|AEB51129.1| RNA polymerase sigma factor [Aeromonas veronii B565]
          Length = 104

 Score = 38.1 bits (87), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 29/46 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   I+SE+F G+  + +H+ V   L +++  A+HAL++ T
Sbjct: 34 GSESHFKVVIVSEQFAGQRLLARHRQVNAVLADELAGAVHALALHT 79


>gi|225075433|ref|ZP_03718632.1| hypothetical protein NEIFLAOT_00438 [Neisseria flavescens
          NRL30031/H210]
 gi|261380079|ref|ZP_05984652.1| BolA protein [Neisseria subflava NJ9703]
 gi|224953251|gb|EEG34460.1| hypothetical protein NEIFLAOT_00438 [Neisseria flavescens
          NRL30031/H210]
 gi|284797295|gb|EFC52642.1| BolA protein [Neisseria subflava NJ9703]
          Length = 90

 Score = 38.1 bits (87), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL-HALSIKTSVPD 77
          G HYA  ++S  F    R+Q+ +M+   L +   + L HALSIK + PD
Sbjct: 38 GGHYAIVVVSNAFENIGRLQRQRMIKQLLQDLFSDGLIHALSIKAATPD 86


>gi|163750779|ref|ZP_02158014.1| bolA protein [Shewanella benthica KT99]
 gi|161329474|gb|EDQ00468.1| bolA protein [Shewanella benthica KT99]
          Length = 99

 Score = 38.1 bits (87), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 10/58 (17%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT----------SVPDS 78
          +H+   I S  F GK  + +H+ V ++L ++  N LHALSI T          +VPDS
Sbjct: 37 SHFKVIITSAAFEGKRLLGRHRSVNEALADEFANGLHALSIHTFTAEEWLVESNVPDS 94


>gi|238789750|ref|ZP_04633532.1| hypothetical protein yfred0001_28990 [Yersinia frederiksenii ATCC
          33641]
 gi|238793699|ref|ZP_04637321.1| hypothetical protein yinte0001_760 [Yersinia intermedia ATCC
          29909]
 gi|238722109|gb|EEQ13767.1| hypothetical protein yfred0001_28990 [Yersinia frederiksenii ATCC
          33641]
 gi|238726940|gb|EEQ18472.1| hypothetical protein yinte0001_760 [Yersinia intermedia ATCC
          29909]
          Length = 84

 Score = 38.1 bits (87), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+ +EI+ ++ + +  ++   H + GDG+H+    + E F   +R+++ Q VY  L   +
Sbjct: 1  MDTNEIKDVLMQAL--ALQEAH-VTGDGSHFQVIAVGELFADMSRVKKQQAVYAPLMEYI 57

Query: 63 G-NALHALSIKTSVP 76
            N +HALSIK   P
Sbjct: 58 ADNRIHALSIKAYTP 72


>gi|238751351|ref|ZP_04612844.1| hypothetical protein yrohd0001_15360 [Yersinia rohdei ATCC 43380]
 gi|238710409|gb|EEQ02634.1| hypothetical protein yrohd0001_15360 [Yersinia rohdei ATCC 43380]
          Length = 84

 Score = 38.1 bits (87), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+  EI+ ++ + +  ++  +H + G+G+H+    + E F   +R+++ Q VY  L   +
Sbjct: 1  MDTSEIKDVLMRAL--ALQEVH-VTGEGSHFQVIAVGELFADMSRVKKQQAVYAPLMEYI 57

Query: 63 G-NALHALSIKTSVP 76
            N +HALSIK   P
Sbjct: 58 ADNRIHALSIKAYTP 72


>gi|238765435|ref|ZP_04626356.1| hypothetical protein ykris0001_44020 [Yersinia kristensenii ATCC
          33638]
 gi|238696329|gb|EEP89125.1| hypothetical protein ykris0001_44020 [Yersinia kristensenii ATCC
          33638]
          Length = 107

 Score = 38.1 bits (87), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 31/47 (65%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   I+S++F+ +  + +H+ +Y +L  ++ + +HAL++ T
Sbjct: 35 AGSESHFKIVIVSDKFQDQRFLTRHRAIYSALAEELASTVHALALHT 81


>gi|126640225|ref|YP_001083209.1| putative morphogenic pathway activator (BolA) [Acinetobacter
          baumannii ATCC 17978]
 gi|169632138|ref|YP_001705874.1| putative activator of morphogenic pathway (BolA), important in
          general stress response [Acinetobacter baumannii SDF]
 gi|184156467|ref|YP_001844806.1| stress-induced morphogen [Acinetobacter baumannii ACICU]
 gi|215485029|ref|YP_002327270.1| Protein bolA [Acinetobacter baumannii AB307-0294]
 gi|239503074|ref|ZP_04662384.1| Protein bolA [Acinetobacter baumannii AB900]
 gi|260551312|ref|ZP_05825513.1| stress-induced morphogen [Acinetobacter sp. RUH2624]
 gi|260557618|ref|ZP_05829832.1| stress-induced morphogen [Acinetobacter baumannii ATCC 19606]
 gi|299771975|ref|YP_003734001.1| Protein bolA [Acinetobacter sp. DR1]
 gi|126386109|gb|ABO10607.1| putative morphogenic pathway activator (BolA) [Acinetobacter
          baumannii ATCC 17978]
 gi|169150930|emb|CAO99541.1| putative activator of morphogenic pathway (BolA) , important in
          general stress response [Acinetobacter baumannii]
 gi|183208061|gb|ACC55459.1| stress-induced morphogen [Acinetobacter baumannii ACICU]
 gi|213986921|gb|ACJ57220.1| Protein bolA [Acinetobacter baumannii AB307-0294]
 gi|260405626|gb|EEW99117.1| stress-induced morphogen [Acinetobacter sp. RUH2624]
 gi|260408791|gb|EEX02095.1| stress-induced morphogen [Acinetobacter baumannii ATCC 19606]
 gi|298702063|gb|ADI92628.1| Protein bolA [Acinetobacter sp. DR1]
          Length = 102

 Score = 38.1 bits (87), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 11/86 (12%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDG-------NHYAAEIISEEFRGKNRIQQHQM 53
          MS+    IE++ +   P  +  I++ AG G       +H+   ++SEEF G   +Q+HQ 
Sbjct: 1  MSLEQQLIERL-QTLAPSHLEVINESAGHGGYFPGKESHFKVIVVSEEFNGLRLVQRHQK 59

Query: 54 VYDSLGNKMGNA--LHALSIKTSVPD 77
          VY +L + + N   +HAL+I   +P 
Sbjct: 60 VY-ALASDLMNPGQIHALAIHAYLPS 84


>gi|164656078|ref|XP_001729167.1| hypothetical protein MGL_3634 [Malassezia globosa CBS 7966]
 gi|159103057|gb|EDP41953.1| hypothetical protein MGL_3634 [Malassezia globosa CBS 7966]
          Length = 256

 Score = 38.1 bits (87), Expect = 0.38,   Method: Composition-based stats.
 Identities = 24/69 (34%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 7  EIEKMIKKGIPQ-SIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN 64
          E+E  I + + Q   + + D++G  G  Y   I+S++F GK+ +Q+H++V D L N++  
Sbjct: 6  ELEHAIHEKVGQVDTLFVSDVSGGCGQAYDIVIVSDQFDGKSTLQRHRLVNDRLKNEIA- 64

Query: 65 ALHALSIKT 73
          ++HA S KT
Sbjct: 65 SMHAFSQKT 73


>gi|301154872|emb|CBW14335.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Haemophilus parainfluenzae
          T3T1]
          Length = 103

 Score = 38.1 bits (87), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 27/44 (61%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSI 71
          G  +H+   I+S+ F G  ++Q+HQ +Y    + + N +HAL++
Sbjct: 34 GADSHFKLVIVSDAFEGMRKVQRHQKLYQLFADDLKNGIHALAL 77


>gi|171685224|ref|XP_001907553.1| hypothetical protein [Podospora anserina S mat+]
 gi|170942573|emb|CAP68225.1| unnamed protein product [Podospora anserina S mat+]
          Length = 159

 Score = 38.1 bits (87), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 23  IHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           + D++G  G+ Y  +I SE+FRG N ++Q ++V  +LG+ +    H + +KT  P
Sbjct: 106 VQDISGGCGSMYGIDISSEKFRGLNMLKQQRLVNAALGD-LVKEWHGVQLKTRAP 159


>gi|49476241|ref|YP_034282.1| transcriptional regulator bolA [Bartonella henselae str.
          Houston-1]
 gi|49239049|emb|CAF28349.1| Transcriptional regulator bolA [Bartonella henselae str.
          Houston-1]
          Length = 92

 Score = 38.1 bits (87), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 24 HDLAGDG---NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIK 72
          H+ A DG    H+  +I+S  F G  R++ H+ +Y  L  ++   +HAL+++
Sbjct: 37 HEHAFDGKGETHFRVKILSASFSGMTRVEIHRAIYKVLQKELATCVHALALE 88


>gi|322492262|emb|CBZ27536.1| conserved hypothetical protein [Leishmania mexicana
          MHOM/GT/2001/U1103]
          Length = 88

 Score = 38.1 bits (87), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 18 QSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          QSI  +   AG G+ +  +I+S  F+GK+ IQQH++V   L  ++ +A+H  ++ T
Sbjct: 31 QSIRVVDVSAGCGSFFNIDIVSPVFQGKSLIQQHRLVNGVLKEEI-SAIHGFTLNT 85


>gi|149185977|ref|ZP_01864292.1| BolA-like protein [Erythrobacter sp. SD-21]
 gi|148830538|gb|EDL48974.1| BolA-like protein [Erythrobacter sp. SD-21]
          Length = 90

 Score = 38.1 bits (87), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 43/81 (53%), Gaps = 11/81 (13%)

Query: 7  EIEKMIKKGI-PQSIVTIHDLA---------GDG-NHYAAEIISEEFRGKNRIQQHQMVY 55
          E+E+++ +   P  +  I+D A         G G +H+   I +  F  K+R+ + +MV 
Sbjct: 8  EMERLLTQAFSPTRLEVINDSAKHHGHAGDDGSGESHFTVVIEAPAFADKSRLDRQRMVN 67

Query: 56 DSLGNKMGNALHALSIKTSVP 76
           +LG+  G  +HAL+I+ S P
Sbjct: 68 KALGDIPGERVHALAIQASAP 88


>gi|313222419|emb|CBY39343.1| unnamed protein product [Oikopleura dioica]
          Length = 97

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 23 IHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          + DL   G  Y   I+S+ F GK  +++H++V ++L  ++   LHA S K+  P
Sbjct: 34 VDDLGTCGTSYQVIIVSDIFEGKKTLEKHKIVNEALAEQISR-LHAFSQKSYTP 86


>gi|167644683|ref|YP_001682346.1| BolA family protein [Caulobacter sp. K31]
 gi|167347113|gb|ABZ69848.1| BolA family protein [Caulobacter sp. K31]
          Length = 90

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 29/49 (59%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G  +H+   I ++ F GK R+ + ++++ +L ++M   +HALSI    P
Sbjct: 39 GGESHFNLLIEAQAFAGKGRVARQRLIFQALADEMAGPVHALSIVARAP 87


>gi|227113463|ref|ZP_03827119.1| transcriptional regulator BolA [Pectobacterium carotovorum subsp.
          brasiliensis PBR1692]
          Length = 104

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S++F G+  I +H+ VY  L  ++  ++HAL++ T
Sbjct: 32 AGAESHFKVVLVSDKFTGERVIGRHRAVYAVLAAELAGSVHALALHT 78


>gi|156839835|ref|XP_001643604.1| hypothetical protein Kpol_1049p3 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156114222|gb|EDO15746.1| hypothetical protein Kpol_1049p3 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 124

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 33/49 (67%), Gaps = 1/49 (2%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
           +H+  E++++EF+G    ++H++++D L N+M + +HAL IK    D +
Sbjct: 69  SHFRIELVTDEFKGIPLPKRHRIIFDLLSNEM-DKIHALQIKARSQDEE 116


>gi|152996246|ref|YP_001341081.1| BolA family protein [Marinomonas sp. MWYL1]
 gi|150837170|gb|ABR71146.1| BolA family protein [Marinomonas sp. MWYL1]
          Length = 104

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 30/45 (66%), Gaps = 1/45 (2%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSI 71
          AG  +H+   ++S+ F GK  +Q+HQ+VY  L ++M   +HAL++
Sbjct: 33 AGSESHFKLVLVSDAFEGKRLVQRHQLVYGVLQDEM-TKIHALAM 76


>gi|326437653|gb|EGD83223.1| BolA domain-containing protein [Salpingoeca sp. ATCC 50818]
          Length = 87

 Score = 38.1 bits (87), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          M++    I   ++  +    V + D +G  G  + A I+S +F+G   +++H++V  +L 
Sbjct: 1  MAITAESIRAKLQDALEAQHVEVEDTSGGCGQAFEAVIVSTQFQGLPLLKRHRLVNTALE 60

Query: 60 NKMGNALHALSIKTSVPD 77
          +++  A+HA S KT  P+
Sbjct: 61 DEL-KAIHAFSQKTYTPE 77


>gi|319639213|ref|ZP_07993964.1| BolA/YrbA family protein [Neisseria mucosa C102]
 gi|317399397|gb|EFV80067.1| BolA/YrbA family protein [Neisseria mucosa C102]
          Length = 90

 Score = 38.1 bits (87), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL-HALSIKTSVPD 77
          G HYA  ++S  F    R+Q+ +M+   L +   + L HALSIK + PD
Sbjct: 38 GGHYAILVVSNAFENIGRLQRQRMIKQLLQDLFSDGLIHALSIKAATPD 86


>gi|322491691|emb|CBZ26964.1| conserved hypothetical protein [Leishmania mexicana
          MHOM/GT/2001/U1103]
          Length = 79

 Score = 38.1 bits (87), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 23 IHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPDS 78
          + +++ +   Y   I+S  F G   IQ+H+MV D  G ++    +HALSI    P S
Sbjct: 23 VTEISAEEAKYNVRIVSAAFAGVPLIQRHRMVNDLFGEELRSGTIHALSISAKPPPS 79


>gi|187477573|ref|YP_785597.1| BolA-like protein [Bordetella avium 197N]
 gi|115422159|emb|CAJ48683.1| BolA-like protein [Bordetella avium 197N]
          Length = 89

 Score = 38.1 bits (87), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          Y   I+SE F+G   + +H++VY  L + +   +HAL++ T  P
Sbjct: 45 YRVLIVSESFKGLTPVARHRLVYHYLQDLIPFPIHALALDTQTP 88


>gi|84388939|ref|ZP_00991147.1| cell division protein BolA [Vibrio splendidus 12B01]
 gi|84377003|gb|EAP93875.1| cell division protein BolA [Vibrio splendidus 12B01]
          Length = 102

 Score = 38.1 bits (87), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 11/63 (17%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT-----------SV 75
          AG  +H+   ++S+ F G   I +H+ V  +L  ++ N +HALSI T           +V
Sbjct: 32 AGSESHFKVIVVSDVFEGLRLIARHRAVNKALSEELANNIHALSIHTYTKYEWMKQLNNV 91

Query: 76 PDS 78
          PDS
Sbjct: 92 PDS 94


>gi|50120085|ref|YP_049252.1| transcriptional regulator BolA [Pectobacterium atrosepticum
          SCRI1043]
 gi|49610611|emb|CAG74056.1| morphogene, putative regulator of murein genes [Pectobacterium
          atrosepticum SCRI1043]
          Length = 104

 Score = 38.1 bits (87), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S++F G+  I +H+ VY  L  ++  ++HAL++ T
Sbjct: 32 AGAESHFKVVLVSDKFTGERVIGRHRAVYAVLAAELAGSVHALALHT 78


>gi|30248917|ref|NP_840987.1| BolA-like protein [Nitrosomonas europaea ATCC 19718]
 gi|30138534|emb|CAD84824.1| BolA-like protein [Nitrosomonas europaea ATCC 19718]
          Length = 113

 Score = 38.1 bits (87), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 30/49 (61%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G  +H+   I+S+ F GK  + +H++V  +L  ++  ++HAL++ T  P
Sbjct: 34 GSESHFKVTIVSDAFDGKTLVARHRLVNTTLTQEIIRSIHALALHTLTP 82


>gi|308048608|ref|YP_003912174.1| BolA family transcriptional regulator [Ferrimonas balearica DSM
          9799]
 gi|307630798|gb|ADN75100.1| transcriptional regulator, BolA protein family [Ferrimonas
          balearica DSM 9799]
          Length = 98

 Score = 38.1 bits (87), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 31/54 (57%)

Query: 23 IHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          +H    + +H+   ++SE+F G+  + +H+ V  +L  ++   LHAL++ T  P
Sbjct: 28 MHRGPAEESHFKLIVVSEQFDGQRLLARHRAVNAALAEELAGTLHALALHTYTP 81


>gi|88608831|ref|YP_506657.1| BolA family protein [Neorickettsia sennetsu str. Miyayama]
 gi|88601000|gb|ABD46468.1| BolA family protein [Neorickettsia sennetsu str. Miyayama]
          Length = 95

 Score = 38.1 bits (87), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           +H+   ++S  FRG ++I +H+MV+  L       LHALS+K    D
Sbjct: 43 ASHFEVIVVSPSFRGLSKISRHRMVFKILEAHFKLGLHALSMKLWTED 90


>gi|74183522|dbj|BAE36620.1| unnamed protein product [Mus musculus]
          Length = 39

 Score = 38.1 bits (87), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 25/40 (62%), Gaps = 1/40 (2%)

Query: 39 SEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDS 78
          SEEF+ K  +QQHQMV  +L  ++   +H L I TSVP  
Sbjct: 1  SEEFKEKRTVQQHQMVNQALKEEI-KGMHGLRIFTSVPKC 39


>gi|312222327|emb|CBY02267.1| similar to BolA domain containing protein [Leptosphaeria maculans]
          Length = 128

 Score = 38.1 bits (87), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 41/71 (57%), Gaps = 2/71 (2%)

Query: 8   IEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
           I++ +++G+    V I DL+G  G  Y A I+S +F  K  + +H++V  +L  ++  A+
Sbjct: 51  IKRKLEEGMEAVHVEIEDLSGGCGQMYEAIIVSPQFTKKTTLARHRLVNATLKQEIA-AI 109

Query: 67  HALSIKTSVPD 77
           HA + K   P+
Sbjct: 110 HAWTAKCHTPE 120


>gi|83647681|ref|YP_436116.1| stress-induced morphogen [Hahella chejuensis KCTC 2396]
 gi|83635724|gb|ABC31691.1| stress-induced morphogen [Hahella chejuensis KCTC 2396]
          Length = 107

 Score = 38.1 bits (87), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 25/46 (54%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+   +++ +F     +Q+HQ VY  LG  M   +HAL++ T  P
Sbjct: 37 THFKVVLVTPQFTDMRSVQRHQKVYAVLGELMQQGIHALALHTFTP 82


>gi|218673216|ref|ZP_03522885.1| BolA family protein [Rhizobium etli GR56]
          Length = 104

 Score = 38.1 bits (87), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 43/87 (49%), Gaps = 11/87 (12%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIH----------DLAGDG-NHYAAEIISEEFRGKNRIQ 49
          M++     EK+++   P+ +  I           D+ G G  H    I+S +F G +R+ 
Sbjct: 12 MTLRTRIEEKLVEAFAPERLSVIDESHLHAGHQPDITGTGETHMRVRIVSAKFAGLSRLA 71

Query: 50 QHQMVYDSLGNKMGNALHALSIKTSVP 76
          +H+ + + L  ++   LHAL+++ + P
Sbjct: 72 RHRAITELLKPELDAGLHALAVEPAAP 98


>gi|110834113|ref|YP_692972.1| bolA protein [Alcanivorax borkumensis SK2]
 gi|110647224|emb|CAL16700.1| bolA protein [Alcanivorax borkumensis SK2]
          Length = 119

 Score = 38.1 bits (87), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+   ++SE F G   +++HQM+Y  L  ++   +HAL++ T  P
Sbjct: 37 THFKLVLVSEVFAGMMPVRRHQMLYKILAEELEGPVHALALHTHTP 82


>gi|302383369|ref|YP_003819192.1| BolA family protein [Brevundimonas subvibrioides ATCC 15264]
 gi|302193997|gb|ADL01569.1| BolA family protein [Brevundimonas subvibrioides ATCC 15264]
          Length = 99

 Score = 38.1 bits (87), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G  +H+   ++S  F G+ R+Q+ + V   L  ++   +HALSI+   PD
Sbjct: 46 GGESHFNLTVVSAAFVGQGRVQRQRAVNALLSEELAGPVHALSIRALTPD 95


>gi|212634022|ref|YP_002310547.1| cell division protein BolA [Shewanella piezotolerans WP3]
 gi|212555506|gb|ACJ27960.1| Cell division protein BolA, putative [Shewanella piezotolerans
          WP3]
          Length = 99

 Score = 38.1 bits (87), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           H+   I S +F GK  I +H+ V ++L  +    LHALS+ T  P+
Sbjct: 37 THFKVIISSSQFEGKRLIGRHRAVNEALAEEFAQGLHALSMHTFTPE 83


>gi|322514907|ref|ZP_08067922.1| regulator of penicillin binding proteins and beta lactamase
          transcription [Actinobacillus ureae ATCC 25976]
 gi|322119095|gb|EFX91249.1| regulator of penicillin binding proteins and beta lactamase
          transcription [Actinobacillus ureae ATCC 25976]
          Length = 103

 Score = 38.1 bits (87), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 28/50 (56%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G  +H+   ++SE F  +  + +H+ VY+ L  ++ N +HAL++    P 
Sbjct: 34 GAESHFKVTLVSENFAAQRVVARHRAVYNCLAYELENGVHALALHLFTPQ 83


>gi|258542209|ref|YP_003187642.1| stress response and cell division protein BolA [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256633287|dbj|BAH99262.1| stress response and cell division protein BolA [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256636346|dbj|BAI02315.1| stress response and cell division protein BolA [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256639399|dbj|BAI05361.1| stress response and cell division protein BolA [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256642455|dbj|BAI08410.1| stress response and cell division protein BolA [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256645510|dbj|BAI11458.1| stress response and cell division protein BolA [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256648563|dbj|BAI14504.1| stress response and cell division protein BolA [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256651616|dbj|BAI17550.1| stress response and cell division protein BolA [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256654607|dbj|BAI20534.1| stress response and cell division protein BolA [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 112

 Score = 38.1 bits (87), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 27/46 (58%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
            H+   ++S  F G NR+ + +MV+++L  +  + LHAL++    P
Sbjct: 60  THFRVLMVSAAFEGVNRVNRSRMVHEALAPEFSSGLHALALTLRTP 105


>gi|33152800|ref|NP_874153.1| putative transcriptional regulator, BolA [Haemophilus ducreyi
          35000HP]
 gi|33149024|gb|AAP96542.1| putative transcriptional regulator, BolA [Haemophilus ducreyi
          35000HP]
          Length = 103

 Score = 38.1 bits (87), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 29/46 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   ++S+ F  +  + +HQ VY+ L +++ N +HAL++ T
Sbjct: 34 GAESHFKVILVSDLFIAQRVVARHQAVYNCLSDELANGVHALALHT 79


>gi|329113378|ref|ZP_08242159.1| Protein BolA [Acetobacter pomorum DM001]
 gi|326697203|gb|EGE48863.1| Protein BolA [Acetobacter pomorum DM001]
          Length = 112

 Score = 37.7 bits (86), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 27/46 (58%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
            H+   ++S  F G NR+ + +MV+++L  +  + LHAL++    P
Sbjct: 60  THFRVLMVSAAFEGVNRVNRSRMVHEALAPEFSSGLHALALTLRTP 105


>gi|317492911|ref|ZP_07951335.1| BolA protein [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316919033|gb|EFV40368.1| BolA protein [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 104

 Score = 37.7 bits (86), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F+G+  + +H+ +Y  L  ++ + +HAL++ T
Sbjct: 32 AGSESHFKVVLVSDRFQGERFLTRHRSIYGVLSEELADGVHALALHT 78


>gi|327298599|ref|XP_003233993.1| BolA domain-containing protein [Trichophyton rubrum CBS 118892]
 gi|326464171|gb|EGD89624.1| BolA domain-containing protein [Trichophyton rubrum CBS 118892]
          Length = 108

 Score = 37.7 bits (86), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN--ALHALSIKTSVPDSQ 79
            H+   IIS  F  K +  +H+MVY+ L  +M     +HAL +KT  P+ +
Sbjct: 52  THFHVTIISSAFASKTQPARHRMVYNLLKEEMAQEGGIHALQLKTKTPEEE 102


>gi|300176421|emb|CBK23732.2| unnamed protein product [Blastocystis hominis]
          Length = 230

 Score = 37.7 bits (86), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 3/78 (3%)

Query: 1   MSMNPHEIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
           M M    I+K +KK    +IV I D++ D G      ++S +FRG   IQQH+++   L 
Sbjct: 146 MKMQEMMIDK-VKKQAEATIVDIKDISYDAGFLLEMLVVSPKFRGMKLIQQHRLMNKILS 204

Query: 60  NKMGNALHALSIKTSVPD 77
           +++ + LH ++ K   P+
Sbjct: 205 DEL-SILHGITFKCMTPE 221


>gi|260779430|ref|ZP_05888321.1| protein yrbA [Vibrio coralliilyticus ATCC BAA-450]
 gi|260604520|gb|EEX30820.1| protein yrbA [Vibrio coralliilyticus ATCC BAA-450]
          Length = 84

 Score = 37.7 bits (86), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPD 77
          + G+G+HY    +   F G +R+++ Q++Y  L   +  N +HA+SIK   P+
Sbjct: 21 VKGEGSHYEVVAVDASFEGMSRVKKQQLIYAPLMEYIQRNDIHAVSIKAYSPE 73


>gi|85094886|ref|XP_959969.1| hypothetical protein NCU06107 [Neurospora crassa OR74A]
 gi|28921427|gb|EAA30733.1| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 114

 Score = 37.7 bits (86), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 21 VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          V + D++G  G  + + I+S +F GKN +++H++V  +L  ++   +HA S K   PD
Sbjct: 27 VEVTDMSGGCGASFTSLIVSPDFVGKNSLKRHRLVNAALKEEIAR-IHAWSAKCQTPD 83


>gi|326484814|gb|EGE08824.1| BolA domain-containing protein [Trichophyton equinum CBS 127.97]
          Length = 108

 Score = 37.7 bits (86), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN--ALHALSIKTSVPDSQ 79
            H+   IIS  F  K +  +H+MVY+ L  +M     +HAL +KT  P+ +
Sbjct: 52  THFHVTIISSAFASKTQPARHRMVYNLLKEEMAQEGGIHALQLKTRTPEEE 102


>gi|154245819|ref|YP_001416777.1| BolA family protein [Xanthobacter autotrophicus Py2]
 gi|154159904|gb|ABS67120.1| BolA family protein [Xanthobacter autotrophicus Py2]
          Length = 124

 Score = 37.7 bits (86), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 29/49 (59%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           G   H    +++ +F GK+RI++H++V   L  ++   LHA++I+   P
Sbjct: 74  GGVTHLRVRVVATDFTGKSRIERHRIVNGLLQGEIAKGLHAIAIEAKAP 122


>gi|282600360|ref|ZP_05974010.2| BolA protein [Providencia rustigianii DSM 4541]
 gi|282565681|gb|EFB71216.1| BolA protein [Providencia rustigianii DSM 4541]
          Length = 138

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 29/51 (56%)

Query: 26  LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           L G  +H+   ++SE+F     I +H+ +Y  L +++   +HAL++ T  P
Sbjct: 64  LPGSESHFKVVLVSEKFENMRMIGRHREIYAILADELAGGIHALALHTYTP 114


>gi|197129757|gb|ACH46255.1| putative bolA variant 2 [Taeniopygia guttata]
 gi|197129915|gb|ACH46413.1| putative bolA variant 3 [Taeniopygia guttata]
          Length = 131

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 28/50 (56%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   H+   ++S  F G   +Q+H++V+++L  ++   LHAL +    P+
Sbjct: 45 GAETHFGVLVVSGRFAGLPPLQRHRLVHEALRAELAGPLHALQVVARTPE 94


>gi|238764268|ref|ZP_04625220.1| hypothetical protein ykris0001_25330 [Yersinia kristensenii ATCC
          33638]
 gi|238697549|gb|EEP90314.1| hypothetical protein ykris0001_25330 [Yersinia kristensenii ATCC
          33638]
          Length = 84

 Score = 37.7 bits (86), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M+ +EI+ ++ + +  ++   H + GDG+H+    + E F   +R+++ Q VY  L   +
Sbjct: 1  MDTNEIKDVLMQAL--ALQEAH-VTGDGSHFQVIAVGELFVDMSRVKKQQAVYAPLMEYI 57

Query: 63 G-NALHALSIKTSVP 76
            N +HALSIK   P
Sbjct: 58 ADNRIHALSIKAYTP 72


>gi|195384084|ref|XP_002050748.1| GJ20037 [Drosophila virilis]
 gi|194145545|gb|EDW61941.1| GJ20037 [Drosophila virilis]
          Length = 89

 Score = 37.7 bits (86), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 40/70 (57%), Gaps = 2/70 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          +E  +K  +  + V + D + G G  ++A I+S+ F GK  +Q+H++V  +L  ++   +
Sbjct: 9  LEDKLKDKLEATYVHVSDDSDGCGGKFSAVIVSKAFEGKALLQKHRLVNTTLAEEL-KEI 67

Query: 67 HALSIKTSVP 76
          HA S K+  P
Sbjct: 68 HAFSQKSYTP 77


>gi|163792801|ref|ZP_02186778.1| BolA-like protein [alpha proteobacterium BAL199]
 gi|159182506|gb|EDP67015.1| BolA-like protein [alpha proteobacterium BAL199]
          Length = 137

 Score = 37.7 bits (86), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 30/49 (61%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           G   H+   + S  F G +RI++H++V   L +++ + +HAL++  +VP
Sbjct: 73  GGQTHFRVSMTSAAFVGTSRIERHRLVNAVLADELNDRVHALALTLNVP 121


>gi|326539739|gb|ADZ87954.1| bolA protein [Brucella melitensis M5-90]
          Length = 94

 Score = 37.7 bits (86), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 34/52 (65%), Gaps = 1/52 (1%)

Query: 24 HDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSV 75
          +D AG+  H+   I++E F G +R+Q+H+ + D L  ++ + +HAL+++ S 
Sbjct: 37 YDGAGE-THFRIRIVAEAFTGMSRVQRHRAINDLLKEELESGVHALALEPSA 87


>gi|322702200|gb|EFY93948.1| hypothetical protein MAC_00439 [Metarhizium acridum CQMa 102]
          Length = 77

 Score = 37.7 bits (86), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 42/78 (53%), Gaps = 4/78 (5%)

Query: 3  MNPHE--IEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          M P E  I  +++  +  + + + D++G  G+ YA +I S  F+G   ++Q +MV  +LG
Sbjct: 1  MTPAEAAIADLLRAKLQPTELLVRDVSGGCGSMYAIDIASPAFKGATMLKQQRMVNAALG 60

Query: 60 NKMGNALHALSIKTSVPD 77
          + M    H + + T V +
Sbjct: 61 DVM-RGWHGVQLNTRVSE 77


>gi|170064836|ref|XP_001867693.1| conserved hypothetical protein [Culex quinquefasciatus]
 gi|167882066|gb|EDS45449.1| conserved hypothetical protein [Culex quinquefasciatus]
          Length = 106

 Score = 37.7 bits (86), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 44/72 (61%), Gaps = 3/72 (4%)

Query: 8   IEKMIKKGIPQSI-VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
           + K ++   PQ+  V + D++G  G+ Y   + + EF+G   ++QH+++ ++L +++ + 
Sbjct: 35  LRKTLQGKFPQAKNVVVSDISGGCGSMYEIFVETTEFKGLTTVKQHRLITETLKSEIKD- 93

Query: 66  LHALSIKTSVPD 77
           +H L I T++P 
Sbjct: 94  MHGLRIHTAIPS 105


>gi|238783611|ref|ZP_04627632.1| hypothetical protein yberc0001_13940 [Yersinia bercovieri ATCC
          43970]
 gi|238715489|gb|EEQ07480.1| hypothetical protein yberc0001_13940 [Yersinia bercovieri ATCC
          43970]
          Length = 107

 Score = 37.7 bits (86), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 36/63 (57%), Gaps = 11/63 (17%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT-----------SV 75
          AG  +H+   I+S +F+ +  + +H+ +Y +L +++  ++HAL++ T           +V
Sbjct: 35 AGSESHFKIVIVSNKFQDQRFLSRHRAIYGALADELAGSVHALALHTYTLKEWAGLQDTV 94

Query: 76 PDS 78
          PDS
Sbjct: 95 PDS 97


>gi|170063883|ref|XP_001867297.1| conserved hypothetical protein [Culex quinquefasciatus]
 gi|170063885|ref|XP_001867298.1| conserved hypothetical protein [Culex quinquefasciatus]
 gi|167881372|gb|EDS44755.1| conserved hypothetical protein [Culex quinquefasciatus]
 gi|167881373|gb|EDS44756.1| conserved hypothetical protein [Culex quinquefasciatus]
          Length = 106

 Score = 37.7 bits (86), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 45/72 (62%), Gaps = 3/72 (4%)

Query: 8   IEKMIKKGIPQSI-VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
           + K ++   PQ+  V + D++G  G+ Y   + + EF+G + ++QH+++ ++L +++ + 
Sbjct: 35  LRKTLQGKFPQAKNVVVSDISGGCGSMYEIFVETTEFKGLSTVKQHRLITETLKSEIKD- 93

Query: 66  LHALSIKTSVPD 77
           +H L I T++P 
Sbjct: 94  MHGLRIHTAIPS 105


>gi|225853460|ref|YP_002733693.1| BolA protein [Brucella melitensis ATCC 23457]
 gi|256263060|ref|ZP_05465592.1| basic helix-loop-helix dimerization domain bHLH protein [Brucella
          melitensis bv. 2 str. 63/9]
 gi|225641825|gb|ACO01739.1| bolA protein [Brucella melitensis ATCC 23457]
 gi|263092937|gb|EEZ17112.1| basic helix-loop-helix dimerization domain bHLH protein [Brucella
          melitensis bv. 2 str. 63/9]
 gi|326410022|gb|ADZ67087.1| BolA protein [Brucella melitensis M28]
          Length = 104

 Score = 37.7 bits (86), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 23 IHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSV 75
           +D AG+  H+   I++E F G +R+Q+H+ + D L  ++ + +HAL+++ S 
Sbjct: 46 TYDGAGE-THFRIRIVAEAFTGMSRVQRHRAINDLLKEELESGVHALALEPSA 97


>gi|241603702|ref|XP_002405732.1| conserved hypothetical protein [Ixodes scapularis]
 gi|215502559|gb|EEC12053.1| conserved hypothetical protein [Ixodes scapularis]
          Length = 105

 Score = 37.7 bits (86), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 43/72 (59%), Gaps = 3/72 (4%)

Query: 8   IEKMIKKGIPQ-SIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
           +  ++++  P+ S + + D++G  G  Y   + S  FR   R+QQH++V ++L  ++ + 
Sbjct: 34  LASILQQKFPEASNIQVKDISGGCGAMYEVYVQSSIFRNLPRVQQHRLVNEALKTEIQD- 92

Query: 66  LHALSIKTSVPD 77
           +H + I T+VPD
Sbjct: 93  MHGIRIATAVPD 104


>gi|149911096|ref|ZP_01899723.1| bolA protein [Moritella sp. PE36]
 gi|149805846|gb|EDM65835.1| bolA protein [Moritella sp. PE36]
          Length = 103

 Score = 37.7 bits (86), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%)

Query: 32 HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          H++  I++ EF GK  I +H+MV  +L  +    +HALSI    P+
Sbjct: 38 HFSVVIVATEFEGKMLIARHRMVNTALVAQFEAGIHALSIHAYTPE 83


>gi|91776232|ref|YP_545988.1| transcriptional regulator BolA [Methylobacillus flagellatus KT]
 gi|91710219|gb|ABE50147.1| transcriptional regulator, BolA protein family [Methylobacillus
          flagellatus KT]
          Length = 92

 Score = 37.7 bits (86), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 28/45 (62%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          +   I S EF GK+++ +H+ VY  LG+ + + +HALSI+    D
Sbjct: 40 FFLTIASAEFSGKSQVMRHRQVYAMLGDLIPHKIHALSIQAIATD 84


>gi|56552445|ref|YP_163284.1| BolA family protein [Zymomonas mobilis subsp. mobilis ZM4]
 gi|56544019|gb|AAV90173.1| BolA family protein [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 101

 Score = 37.7 bits (86), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 30/49 (61%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
           +H+   ++S+ F  ++RI + +MV+ +L + + + +HAL +K   P  Q
Sbjct: 52  SHFTVTLVSQAFENESRISRERMVHKALSDLLPDRIHALRLKLDTPLRQ 100


>gi|253996059|ref|YP_003048123.1| BolA family protein [Methylotenera mobilis JLW8]
 gi|253982738|gb|ACT47596.1| BolA family protein [Methylotenera mobilis JLW8]
          Length = 84

 Score = 37.7 bits (86), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%)

Query: 33 YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          Y  +I S  F GK++I +H++VY  L + + + +HALSI     D
Sbjct: 38 YKLDITSSHFCGKSQIMRHRLVYQVLADLIPHKIHALSIHAIATD 82


>gi|153215728|ref|ZP_01950109.1| BolA family protein [Vibrio cholerae 1587]
 gi|124114646|gb|EAY33466.1| BolA family protein [Vibrio cholerae 1587]
          Length = 84

 Score = 37.7 bits (86), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 45/75 (60%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSL-GNK 61
          M+  ++++++++ +  ++  IH + G+G+HY    +   F   +R+++ QM+Y  L G  
Sbjct: 1  MDSAQVQQILQQAL--NLEEIH-VKGEGSHYEVIAVDACFADMSRVKKQQMIYTPLMGYI 57

Query: 62 MGNALHALSIKTSVP 76
            N +HA+++KT  P
Sbjct: 58 QRNDIHAVTMKTFTP 72


>gi|302785642|ref|XP_002974592.1| hypothetical protein SELMODRAFT_414903 [Selaginella
          moellendorffii]
 gi|300157487|gb|EFJ24112.1| hypothetical protein SELMODRAFT_414903 [Selaginella
          moellendorffii]
          Length = 107

 Score = 37.7 bits (86), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 21 VTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALS-IKTSVPD 77
          V + D  GDG + +  +++  F+GK++I + +MVY ++ +++    H +  I+   P+
Sbjct: 40 VVVKDAYGDGEYLSISVVASVFQGKSKIDRQKMVYKAVWDEVKYQEHVIEQIRMETPE 97


>gi|262375607|ref|ZP_06068839.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
 gi|262309210|gb|EEY90341.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
          Length = 84

 Score = 37.7 bits (86), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 40/72 (55%), Gaps = 4/72 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MN  ++ ++++   P++ V +   +G G  +   I+ ++F GK  + + Q VY  L   +
Sbjct: 2  MNNEQLAEILEAAFPEADVAV---SGQGGKFDLRIVDDQFEGKRPVARQQAVYAPLNAHI 58

Query: 63 GN-ALHALSIKT 73
           + A+HA++I+ 
Sbjct: 59 ASGAVHAVTIRA 70


>gi|304414044|ref|ZP_07395412.1| putative transcriptional regulator [Candidatus Regiella
          insecticola LSR1]
 gi|304283258|gb|EFL91654.1| putative transcriptional regulator [Candidatus Regiella
          insecticola LSR1]
          Length = 108

 Score = 37.7 bits (86), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 39/71 (54%), Gaps = 6/71 (8%)

Query: 9  EKMIKKGIPQSIVTIHDL------AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          EK+ K+  P  +  I++       AG  +H+   I+SE+F  +  +++HQ VY  L ++ 
Sbjct: 10 EKLRKEFKPTHLEVINESYNHNVPAGYESHFKVVIVSEQFSNQRHLKRHQEVYSLLKDEF 69

Query: 63 GNALHALSIKT 73
             +HAL++ T
Sbjct: 70 MGGVHALALHT 80


>gi|238751004|ref|ZP_04612500.1| hypothetical protein yrohd0001_1360 [Yersinia rohdei ATCC 43380]
 gi|238710694|gb|EEQ02916.1| hypothetical protein yrohd0001_1360 [Yersinia rohdei ATCC 43380]
          Length = 106

 Score = 37.7 bits (86), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   I+S +F  +  + +H+ +Y +L +++ + +HAL++ T
Sbjct: 34 AGSESHFKIVIVSNKFEDQRFLSRHRAIYSALADELASTVHALALHT 80


>gi|118790123|ref|XP_318038.3| AGAP004778-PA [Anopheles gambiae str. PEST]
 gi|116122366|gb|EAA13135.3| AGAP004778-PA [Anopheles gambiae str. PEST]
          Length = 105

 Score = 37.7 bits (86), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 46/72 (63%), Gaps = 3/72 (4%)

Query: 8   IEKMIKKGIPQSI-VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
           + K ++   PQ+  + + D++G  G+ Y   + S+EF+G + ++QH+++ ++L +++ + 
Sbjct: 35  LRKTLEAKFPQAKNIVVSDISGGCGSMYEIYVESKEFKGLSTVKQHRLITETLKSEIKD- 93

Query: 66  LHALSIKTSVPD 77
           +H L I TS+ +
Sbjct: 94  MHGLRIHTSIAE 105


>gi|310789899|gb|EFQ25432.1| BolA-like protein [Glomerella graminicola M1.001]
          Length = 134

 Score = 37.4 bits (85), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN--ALHALSIKTSVPDSQ 79
            H+   I SE FR K +  +H+MVY  L  +M     +HAL +KT  P+ +
Sbjct: 66  THFRLVITSESFRSKMQSARHRMVYALLREEMAREGGIHALQLKTLTPEEE 116


>gi|262376890|ref|ZP_06070117.1| BolA family protein [Acinetobacter lwoffii SH145]
 gi|262308235|gb|EEY89371.1| BolA family protein [Acinetobacter lwoffii SH145]
          Length = 102

 Score = 37.4 bits (85), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHALSIKTSVPD 77
            G  +H+   I+S+ F G   +Q+HQ VY + G+ +  + +HAL+I   +P+
Sbjct: 32 FPGKESHFKTVIVSQAFAGLRPVQRHQKVYAAAGDLLSKDKIHALAIHAFLPE 84


>gi|325577510|ref|ZP_08147872.1| regulator of penicillin binding proteins and beta lactamase
          transcription [Haemophilus parainfluenzae ATCC 33392]
 gi|325160614|gb|EGC72738.1| regulator of penicillin binding proteins and beta lactamase
          transcription [Haemophilus parainfluenzae ATCC 33392]
          Length = 113

 Score = 37.4 bits (85), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 27/44 (61%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSI 71
          G  +H+   I+S+ F G  ++Q+HQ +Y    + + N +HAL++
Sbjct: 44 GADSHFKLVIVSDAFEGMRKVQRHQKLYQLFDDDLKNGIHALAL 87


>gi|83591544|ref|YP_425296.1| transcriptional regulator BolA [Rhodospirillum rubrum ATCC 11170]
 gi|83574458|gb|ABC21009.1| transcriptional regulator BolA [Rhodospirillum rubrum ATCC 11170]
          Length = 114

 Score = 37.4 bits (85), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 34/55 (61%), Gaps = 1/55 (1%)

Query: 25  DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
           D AG+  H++ +I+S  F G +R+++ ++V   +  ++   +HALS++   P+ Q
Sbjct: 60  DGAGE-THFSLDIVSARFSGMSRLERQRLVNALVAEELRERVHALSLRCRSPEEQ 113


>gi|328870997|gb|EGG19369.1| bolA family protein [Dictyostelium fasciculatum]
          Length = 128

 Score = 37.4 bits (85), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 45/68 (66%), Gaps = 2/68 (2%)

Query: 7   EIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA 65
           +I+ ++++ +  +++ + D++G  G+ Y  E+ S EF+GK+ +QQH+ V + L  ++  +
Sbjct: 49  KIKSVLQEALNPTVLEVLDMSGGCGSMYRIEVESHEFKGKSTLQQHKRV-NQLLKEVIPS 107

Query: 66  LHALSIKT 73
           LH L++ T
Sbjct: 108 LHGLTLFT 115


>gi|332994368|gb|AEF04423.1| BolA-like protein [Alteromonas sp. SN2]
          Length = 85

 Score = 37.4 bits (85), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 47/79 (59%), Gaps = 5/79 (6%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EIEK++   +   +  +H + G+G+H+    + + F   +R+++ Q VY  L +K+
Sbjct: 1  MELSEIEKILTDAL--ELQEVH-VKGEGSHFNIIAVGDIFNEMSRVKRQQAVYAPLSDKI 57

Query: 63 GN-ALHALSIKT-SVPDSQ 79
           + ++HA++IKT SV D +
Sbjct: 58 ADGSMHAITIKTFSVKDWE 76


>gi|270263568|ref|ZP_06191837.1| transcriptional regulatory protein [Serratia odorifera 4Rx13]
 gi|270042452|gb|EFA15547.1| transcriptional regulatory protein [Serratia odorifera 4Rx13]
          Length = 104

 Score = 37.4 bits (85), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+ +Y  L +++ + +HAL++ T
Sbjct: 32 AGSESHFKVVLVSDRFVGERFLTRHRSIYGVLSDELADGVHALALHT 78


>gi|320163798|gb|EFW40697.1| transcriptional regulator BolA [Capsaspora owczarzaki ATCC 30864]
          Length = 163

 Score = 37.4 bits (85), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 30/50 (60%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           G   H+   ++S+ F+G++ I +H+ V   L +++   +HALSI+   P+
Sbjct: 87  GSETHFNVVVVSDAFKGRSLIDRHRQVNALLKDELKAGVHALSIQAQTPE 136


>gi|241761520|ref|ZP_04759607.1| BolA family protein [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|241373828|gb|EER63361.1| BolA family protein [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 101

 Score = 37.4 bits (85), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 30/49 (61%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
           +H+   ++S+ F  ++RI + +MV+ +L + + + +HAL +K   P  Q
Sbjct: 52  SHFTVTLVSQAFENESRISRERMVHKALSDLLPDRIHALRLKLDTPLRQ 100


>gi|119944516|ref|YP_942196.1| BolA family protein [Psychromonas ingrahamii 37]
 gi|119863120|gb|ABM02597.1| transcriptional regulator BolA [Psychromonas ingrahamii 37]
          Length = 103

 Score = 37.4 bits (85), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 37/76 (48%), Gaps = 7/76 (9%)

Query: 8  IEKMIKKGIPQSIVTIHD-------LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          IEK I+  I    + + +        A    H+   ++SEEF G   I +H+++   L +
Sbjct: 7  IEKKIRDNISLEFLQVENESHRHSVPANSETHFKVTLVSEEFEGMPLIARHRLINALLKD 66

Query: 61 KMGNALHALSIKTSVP 76
          ++   +HAL++ T  P
Sbjct: 67 ELAGPVHALALHTMTP 82


>gi|298709748|emb|CBJ31551.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 106

 Score = 37.4 bits (85), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 6/74 (8%)

Query: 9  EKMIKKGIPQSIVTIHDLAGDG------NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          EK+  +  P  I  I++    G      +H+   ++S +F GK  + +H+MV  +L  ++
Sbjct: 9  EKLTTELTPSHIEVINESGNHGAPLGAESHFKVIVVSTKFEGKPLLARHRMVNAALKEEL 68

Query: 63 GNALHALSIKTSVP 76
             +HALS+ T  P
Sbjct: 69 VEDIHALSMTTRTP 82


>gi|323516204|gb|ADX90585.1| stress-induced morphogen [Acinetobacter baumannii TCDC-AB0715]
          Length = 102

 Score = 37.4 bits (85), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 11/86 (12%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDG-------NHYAAEIISEEFRGKNRIQQHQM 53
          MS+    IE++ +   P  +  I++ AG G       +H+   ++SEEF G   +Q+HQ 
Sbjct: 1  MSLEQQLIERL-QILAPSHLEVINESAGHGGYFPGKESHFKVIVVSEEFNGLRLVQRHQK 59

Query: 54 VYDSLGNKMGNA--LHALSIKTSVPD 77
          VY +L + + N   +HAL+I   +P 
Sbjct: 60 VY-ALASDLMNPGQIHALAIHAYLPS 84


>gi|126173165|ref|YP_001049314.1| BolA family protein [Shewanella baltica OS155]
 gi|125996370|gb|ABN60445.1| transcriptional regulator BolA [Shewanella baltica OS155]
          Length = 97

 Score = 37.4 bits (85), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 27/42 (64%)

Query: 32 HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          H+   ++SE+F G   + +H++V   L +++ N +HALSI T
Sbjct: 36 HFKVVLVSEQFDGLRLLARHRLVNTHLAHELANGVHALSIHT 77


>gi|254579429|ref|XP_002495700.1| ZYRO0C00880p [Zygosaccharomyces rouxii]
 gi|238938591|emb|CAR26767.1| ZYRO0C00880p [Zygosaccharomyces rouxii]
          Length = 110

 Score = 37.4 bits (85), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM---GNALHALSIKTSVPDSQ 79
            H+  EI+S+EF G    Q+H+MVY  L  +M   G  +HAL + T     Q
Sbjct: 53  THFRLEIVSDEFSGVPLPQRHRMVYQLLQEEMSAAGGGVHALQLTTRTVGEQ 104


>gi|308185905|ref|YP_003930036.1| Possible regulator of murein genes bolA [Pantoea vagans C9-1]
 gi|308056415|gb|ADO08587.1| Possible regulator of murein genes bolA [Pantoea vagans C9-1]
          Length = 104

 Score = 37.4 bits (85), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 17/74 (22%), Positives = 40/74 (54%), Gaps = 7/74 (9%)

Query: 7  EIEKMIKKGIPQSIVTIHDL-------AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
          +IE+ ++     + + +HD        AG  +H+   I+S+ F  +  + +H+++Y  L 
Sbjct: 5  QIEEKLRVAFQPAHLEVHDESYRHNVPAGSESHFKVVIVSDCFADQRFLARHRLIYSELA 64

Query: 60 NKMGNALHALSIKT 73
           ++  ++HAL++ T
Sbjct: 65 AELAGSVHALALHT 78


>gi|293392547|ref|ZP_06636867.1| regulator of penicillin binding proteins and beta lactamase
          transcription [Serratia odorifera DSM 4582]
 gi|291424949|gb|EFE98158.1| regulator of penicillin binding proteins and beta lactamase
          transcription [Serratia odorifera DSM 4582]
          Length = 104

 Score = 37.4 bits (85), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+ +Y  L +++ + +HAL++ T
Sbjct: 32 AGSESHFKVVMVSDRFLGERFLTRHRSIYGVLADELADGVHALALHT 78


>gi|290561705|gb|ADD38252.1| BolA-like protein 2 [Lepeophtheirus salmonis]
          Length = 84

 Score = 37.4 bits (85), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 10 KMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHAL 69
          K+ K+  P+ +  + +  G G  Y   I+S++F GK  +Q+H++V   L  ++   +HA 
Sbjct: 10 KLQKELAPKHLDIVDESDGCGAKYNVVIVSDKFEGKPLLQRHRLVNSILEEEL-KIIHAF 68

Query: 70 SIKTSVPD 77
          S KT  P+
Sbjct: 69 SQKTYTPE 76


>gi|154338503|ref|XP_001565476.1| hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
 gi|134062525|emb|CAM42387.1| conserved hypothetical protein [Leishmania braziliensis
          MHOM/BR/75/M2904]
          Length = 94

 Score = 37.4 bits (85), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 34/56 (60%), Gaps = 1/56 (1%)

Query: 18 QSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          QSI  +   AG G+ +  +I+S  F+GK+ I QH++V   L  ++ +A+H  ++ T
Sbjct: 31 QSISVVDASAGCGSFFNIDIVSPAFQGKSLIDQHRLVNGVLKEEI-SAIHGFTLNT 85


>gi|325124110|gb|ADY83633.1| putative activator of morphogenic pathway (BolA) , important in
          general stress response [Acinetobacter calcoaceticus
          PHEA-2]
          Length = 102

 Score = 37.4 bits (85), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 11/86 (12%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDG-------NHYAAEIISEEFRGKNRIQQHQM 53
          MS+    IE++ +   P  +  I++ AG G       +H+   I+S+EF G   +Q+HQ 
Sbjct: 1  MSLEQQLIERL-QTLAPSHLEVINESAGHGGYFPGKESHFKVIIVSDEFNGLRLVQRHQK 59

Query: 54 VYDSLGNKMGNA--LHALSIKTSVPD 77
          VY +L + + N   +HAL+I   +P 
Sbjct: 60 VY-ALASDLMNPGQIHALAIHAYLPS 84


>gi|323491740|ref|ZP_08096917.1| protein yrbA [Vibrio brasiliensis LMG 20546]
 gi|323313996|gb|EGA67083.1| protein yrbA [Vibrio brasiliensis LMG 20546]
          Length = 84

 Score = 37.4 bits (85), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPD 77
          G+G+HY    +   F G +R+++ Q++Y  L   +  N +HA+SIK   P+
Sbjct: 23 GEGSHYEVVAVDACFDGMSRVKKQQLIYAPLMEYIQRNDIHAVSIKAYTPE 73


>gi|160876673|ref|YP_001555989.1| BolA family protein [Shewanella baltica OS195]
 gi|217974526|ref|YP_002359277.1| BolA family protein [Shewanella baltica OS223]
 gi|304410479|ref|ZP_07392097.1| BolA family protein [Shewanella baltica OS183]
 gi|307304571|ref|ZP_07584321.1| BolA family protein [Shewanella baltica BA175]
 gi|160862195|gb|ABX50729.1| BolA family protein [Shewanella baltica OS195]
 gi|217499661|gb|ACK47854.1| BolA family protein [Shewanella baltica OS223]
 gi|304350963|gb|EFM15363.1| BolA family protein [Shewanella baltica OS183]
 gi|306911973|gb|EFN42397.1| BolA family protein [Shewanella baltica BA175]
 gi|315268873|gb|ADT95726.1| BolA family protein [Shewanella baltica OS678]
          Length = 106

 Score = 37.4 bits (85), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 27/42 (64%)

Query: 32 HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          H+   ++SE+F G   + +H++V   L +++ N +HALSI T
Sbjct: 45 HFKVVLVSEQFDGLRLLARHRLVNTHLAHELANGVHALSIHT 86


>gi|15642511|ref|NP_232144.1| BolA/YrbA family protein [Vibrio cholerae O1 biovar El Tor str.
          N16961]
 gi|121591411|ref|ZP_01678691.1| BolA family protein [Vibrio cholerae 2740-80]
 gi|121727459|ref|ZP_01680587.1| BolA family protein [Vibrio cholerae V52]
 gi|147673378|ref|YP_001218013.1| BolA family protein [Vibrio cholerae O395]
 gi|153801125|ref|ZP_01955711.1| BolA family protein [Vibrio cholerae MZO-3]
 gi|153818022|ref|ZP_01970689.1| BolA family protein [Vibrio cholerae NCTC 8457]
 gi|153822403|ref|ZP_01975070.1| BolA family protein [Vibrio cholerae B33]
 gi|153825780|ref|ZP_01978447.1| BolA family protein [Vibrio cholerae MZO-2]
 gi|227082634|ref|YP_002811185.1| BolA/YrbA family protein [Vibrio cholerae M66-2]
 gi|229507427|ref|ZP_04396932.1| BolA/YrbA family protein [Vibrio cholerae BX 330286]
 gi|229509648|ref|ZP_04399129.1| BolA/YrbA family protein [Vibrio cholerae B33]
 gi|229513441|ref|ZP_04402905.1| BolA/YrbA family protein [Vibrio cholerae TMA 21]
 gi|229516773|ref|ZP_04406219.1| BolA/YrbA family protein [Vibrio cholerae RC9]
 gi|229524498|ref|ZP_04413903.1| BolA/YrbA family protein [Vibrio cholerae bv. albensis VL426]
 gi|229527550|ref|ZP_04416942.1| BolA/YrbA family protein [Vibrio cholerae 12129(1)]
 gi|229606934|ref|YP_002877582.1| BolA/YrbA family protein [Vibrio cholerae MJ-1236]
 gi|254291433|ref|ZP_04962225.1| BolA family protein [Vibrio cholerae AM-19226]
 gi|254851059|ref|ZP_05240409.1| BolA family protein [Vibrio cholerae MO10]
 gi|255744507|ref|ZP_05418459.1| protein yrbA [Vibrio cholera CIRS 101]
 gi|258622791|ref|ZP_05717809.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|258625817|ref|ZP_05720696.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|261211077|ref|ZP_05925366.1| protein yrbA [Vibrio sp. RC341]
 gi|262154669|ref|ZP_06028795.1| protein yrbA [Vibrio cholerae INDRE 91/1]
 gi|262167545|ref|ZP_06035250.1| protein yrbA [Vibrio cholerae RC27]
 gi|262170542|ref|ZP_06038220.1| protein yrbA [Vibrio mimicus MB-451]
 gi|262191031|ref|ZP_06049240.1| protein yrbA [Vibrio cholerae CT 5369-93]
 gi|262401806|ref|ZP_06078371.1| protein yrbA [Vibrio sp. RC586]
 gi|297581362|ref|ZP_06943285.1| BolA/YrbA family protein [Vibrio cholerae RC385]
 gi|298500655|ref|ZP_07010459.1| BolA family protein [Vibrio cholerae MAK 757]
 gi|9657098|gb|AAF95657.1| BolA/YrbA family protein [Vibrio cholerae O1 biovar El Tor str.
          N16961]
 gi|121546727|gb|EAX56902.1| BolA family protein [Vibrio cholerae 2740-80]
 gi|121630231|gb|EAX62631.1| BolA family protein [Vibrio cholerae V52]
 gi|124123358|gb|EAY42101.1| BolA family protein [Vibrio cholerae MZO-3]
 gi|126511457|gb|EAZ74051.1| BolA family protein [Vibrio cholerae NCTC 8457]
 gi|126520046|gb|EAZ77269.1| BolA family protein [Vibrio cholerae B33]
 gi|146315261|gb|ABQ19800.1| BolA family protein [Vibrio cholerae O395]
 gi|149740503|gb|EDM54618.1| BolA family protein [Vibrio cholerae MZO-2]
 gi|150422623|gb|EDN14578.1| BolA family protein [Vibrio cholerae AM-19226]
 gi|227010522|gb|ACP06734.1| BolA/YrbA family protein [Vibrio cholerae M66-2]
 gi|227014405|gb|ACP10615.1| BolA/YrbA family protein [Vibrio cholerae O395]
 gi|229335182|gb|EEO00667.1| BolA/YrbA family protein [Vibrio cholerae 12129(1)]
 gi|229338079|gb|EEO03096.1| BolA/YrbA family protein [Vibrio cholerae bv. albensis VL426]
 gi|229345836|gb|EEO10808.1| BolA/YrbA family protein [Vibrio cholerae RC9]
 gi|229349318|gb|EEO14274.1| BolA/YrbA family protein [Vibrio cholerae TMA 21]
 gi|229353122|gb|EEO18061.1| BolA/YrbA family protein [Vibrio cholerae B33]
 gi|229354932|gb|EEO19853.1| BolA/YrbA family protein [Vibrio cholerae BX 330286]
 gi|229369589|gb|ACQ60012.1| BolA/YrbA family protein [Vibrio cholerae MJ-1236]
 gi|254846764|gb|EET25178.1| BolA family protein [Vibrio cholerae MO10]
 gi|255738032|gb|EET93425.1| protein yrbA [Vibrio cholera CIRS 101]
 gi|258582055|gb|EEW06925.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|258584979|gb|EEW09710.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|260839578|gb|EEX66189.1| protein yrbA [Vibrio sp. RC341]
 gi|261891618|gb|EEY37604.1| protein yrbA [Vibrio mimicus MB-451]
 gi|262023998|gb|EEY42694.1| protein yrbA [Vibrio cholerae RC27]
 gi|262030509|gb|EEY49147.1| protein yrbA [Vibrio cholerae INDRE 91/1]
 gi|262033094|gb|EEY51623.1| protein yrbA [Vibrio cholerae CT 5369-93]
 gi|262351778|gb|EEZ00909.1| protein yrbA [Vibrio sp. RC586]
 gi|297534200|gb|EFH73038.1| BolA/YrbA family protein [Vibrio cholerae RC385]
 gi|297540824|gb|EFH76881.1| BolA family protein [Vibrio cholerae MAK 757]
 gi|327485002|gb|AEA79409.1| YrbA protein [Vibrio cholerae LMA3894-4]
          Length = 84

 Score = 37.4 bits (85), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 45/75 (60%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSL-GNK 61
          M+  ++++++++ +  ++  IH + G+G+HY    +   F   +R+++ QM+Y  L G  
Sbjct: 1  MDSAQVQQILQQAL--NLEEIH-VKGEGSHYEVIAVDACFADMSRVKKQQMIYAPLMGYI 57

Query: 62 MGNALHALSIKTSVP 76
            N +HA+++KT  P
Sbjct: 58 QRNDIHAVTMKTFTP 72


>gi|261819647|ref|YP_003257753.1| BolA family protein [Pectobacterium wasabiae WPP163]
 gi|261603660|gb|ACX86146.1| BolA family protein [Pectobacterium wasabiae WPP163]
          Length = 84

 Score = 37.4 bits (85), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA-LHALSIKTSVPD 77
          ++GDG+H+    +S  F   +R+++ Q VY  L   + +  +HALSIK   P+
Sbjct: 21 VSGDGSHFQVIAVSGIFAEMSRVKKQQAVYAPLAECIADGRIHALSIKAYTPE 73


>gi|296116139|ref|ZP_06834757.1| BolA family protein [Gluconacetobacter hansenii ATCC 23769]
 gi|295977245|gb|EFG84005.1| BolA family protein [Gluconacetobacter hansenii ATCC 23769]
          Length = 104

 Score = 37.4 bits (85), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          +HY   +IS+ F    R+Q+ ++V+D L  +    +HALS+    P
Sbjct: 50 SHYNVLVISDAFANMGRVQRSRLVHDLLAAEFAGGMHALSLTLRTP 95


>gi|148652027|ref|YP_001279120.1| BolA family protein [Psychrobacter sp. PRwf-1]
 gi|148571111|gb|ABQ93170.1| transcriptional regulator BolA [Psychrobacter sp. PRwf-1]
          Length = 110

 Score = 37.4 bits (85), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM---GNALHALSIKTSVPD 77
          G  +H+   I+S +F  K  + +HQ++Y   G  M   G ++HAL+I    P+
Sbjct: 34 GKESHFKLTIVSPDFVSKRAVARHQLIYAQAGELMTSQGGSIHALAIHAYTPE 86


>gi|326386555|ref|ZP_08208177.1| transcriptional regulator BolA [Novosphingobium nitrogenifigens
          DSM 19370]
 gi|326208870|gb|EGD59665.1| transcriptional regulator BolA [Novosphingobium nitrogenifigens
          DSM 19370]
          Length = 96

 Score = 37.4 bits (85), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 28/46 (60%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          +H+   I S  F G++R+ + +MV  +LG+  G  +HAL+++   P
Sbjct: 46 SHFTVVIESAAFTGQSRLARQRMVNAALGDIPGGRVHALAVRARAP 91


>gi|290977031|ref|XP_002671242.1| predicted protein [Naegleria gruberi]
 gi|284084809|gb|EFC38498.1| predicted protein [Naegleria gruberi]
          Length = 129

 Score = 37.4 bits (85), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 30/45 (66%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSI 71
          AG  +H    I+S+ F G+  +++H+M++ ++ ++  + LHAL+I
Sbjct: 44 AGGESHLRITIVSDNFEGQTMVKRHRMIHKAISDEFRDGLHALTI 88


>gi|260772167|ref|ZP_05881084.1| BolA/YrbA family protein [Vibrio metschnikovii CIP 69.14]
 gi|260613034|gb|EEX38236.1| BolA/YrbA family protein [Vibrio metschnikovii CIP 69.14]
          Length = 84

 Score = 37.4 bits (85), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVP 76
          G+G+HY    I   F   +R+++ Q++Y  L   +  N +HA+SIKT  P
Sbjct: 23 GEGSHYEVIAIDASFETMSRVKKQQLIYAPLMAYIQRNDIHAVSIKTFTP 72


>gi|238795544|ref|ZP_04639059.1| hypothetical protein ymoll0001_11350 [Yersinia mollaretii ATCC
          43969]
 gi|238720663|gb|EEQ12464.1| hypothetical protein ymoll0001_11350 [Yersinia mollaretii ATCC
          43969]
          Length = 106

 Score = 37.4 bits (85), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 35/63 (55%), Gaps = 11/63 (17%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT-----------SV 75
          AG  +H+   I+S +F+ +  + +H+ +Y  L +++  ++HAL++ T           +V
Sbjct: 34 AGSESHFKIVIVSNKFQDQRFLSRHRAIYSVLADELAASVHALALHTYTLKEWAGLQDTV 93

Query: 76 PDS 78
          PDS
Sbjct: 94 PDS 96


>gi|260798708|ref|XP_002594342.1| hypothetical protein BRAFLDRAFT_201421 [Branchiostoma floridae]
 gi|229279575|gb|EEN50353.1| hypothetical protein BRAFLDRAFT_201421 [Branchiostoma floridae]
          Length = 91

 Score = 37.4 bits (85), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 39/65 (60%), Gaps = 3/65 (4%)

Query: 11 MIKKGIPQSI-VTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHA 68
          ++K   P ++ + + D++G  G  Y   I+++EF+GK  + QH+MV ++L  ++   +H 
Sbjct: 19 ILKVKFPGAVEIKVDDISGGCGAMYEVHIVADEFKGKRTVMQHRMVNEALAEEV-KQMHG 77

Query: 69 LSIKT 73
          + I T
Sbjct: 78 IRINT 82


>gi|149378019|ref|ZP_01895743.1| predicted transcriptional regulator, BolA superfamily protein
          [Marinobacter algicola DG893]
 gi|149357674|gb|EDM46172.1| predicted transcriptional regulator, BolA superfamily protein
          [Marinobacter algicola DG893]
          Length = 80

 Score = 37.4 bits (85), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNK- 61
          M   E+ +++K+ +P   V +     DGNHY   ++ + F G   I++ Q++  +L    
Sbjct: 1  MEATEVAELVKEALPDCEVEVQ---VDGNHYLVVVVGDVFEGLPTIKRQQLINKALFQHI 57

Query: 62 MGNALHALSIKTSVP 76
          +   +HAL  K   P
Sbjct: 58 LDGTIHALHPKAFTP 72


>gi|312384507|gb|EFR29221.1| hypothetical protein AND_02037 [Anopheles darlingi]
          Length = 269

 Score = 37.0 bits (84), Expect = 0.79,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 23  IHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           I +  G G  + A ++S +F+GK  +Q+H++V  +L  ++   +HA S KT  P+
Sbjct: 205 IDESDGCGGKFRAIVVSPQFQGKALLQRHRLVNAALAEEL-KTIHAFSQKTYTPE 258


>gi|22124932|ref|NP_668355.1| transcriptional regulator BolA [Yersinia pestis KIM 10]
 gi|45440620|ref|NP_992159.1| transcriptional regulator BolA [Yersinia pestis biovar Microtus
          str. 91001]
 gi|51595306|ref|YP_069497.1| transcriptional regulator BolA [Yersinia pseudotuberculosis IP
          32953]
 gi|108808645|ref|YP_652561.1| transcriptional regulator BolA [Yersinia pestis Antiqua]
 gi|108811096|ref|YP_646863.1| transcriptional regulator BolA [Yersinia pestis Nepal516]
 gi|145600054|ref|YP_001164130.1| transcriptional regulator BolA [Yersinia pestis Pestoides F]
 gi|149364994|ref|ZP_01887029.1| possible regulator of murein genes [Yersinia pestis CA88-4125]
 gi|153949281|ref|YP_001402054.1| BolA family transcriptional regulator [Yersinia
          pseudotuberculosis IP 31758]
 gi|162420531|ref|YP_001607422.1| transcriptional regulator BolA [Yersinia pestis Angola]
 gi|165926610|ref|ZP_02222442.1| bolA protein [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165935935|ref|ZP_02224505.1| bolA protein [Yersinia pestis biovar Orientalis str. IP275]
 gi|166011129|ref|ZP_02232027.1| bolA protein [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166213066|ref|ZP_02239101.1| bolA protein [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167398901|ref|ZP_02304425.1| bolA protein [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167421461|ref|ZP_02313214.1| bolA protein [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167423221|ref|ZP_02314974.1| bolA protein [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|170025454|ref|YP_001721959.1| transcriptional regulator BolA [Yersinia pseudotuberculosis
          YPIII]
 gi|186894323|ref|YP_001871435.1| transcriptional regulator BolA [Yersinia pseudotuberculosis
          PB1/+]
 gi|218930190|ref|YP_002348065.1| transcriptional regulator BolA [Yersinia pestis CO92]
 gi|229838764|ref|ZP_04458923.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Yersinia pestis biovar
          Orientalis str. PEXU2]
 gi|229896082|ref|ZP_04511252.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Yersinia pestis Pestoides
          A]
 gi|229899332|ref|ZP_04514475.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Yersinia pestis biovar
          Orientalis str. India 195]
 gi|229901324|ref|ZP_04516446.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Yersinia pestis Nepal516]
 gi|270489511|ref|ZP_06206585.1| BolA-like protein [Yersinia pestis KIM D27]
 gi|294504890|ref|YP_003568952.1| BolA protein [Yersinia pestis Z176003]
 gi|21957771|gb|AAM84606.1|AE013706_1 possible regulator of murein genes [Yersinia pestis KIM 10]
 gi|45435477|gb|AAS61036.1| BolA protein [Yersinia pestis biovar Microtus str. 91001]
 gi|51588588|emb|CAH20196.1| activator of morphogenic pathway (BolA family), important in
          general stress response [Yersinia pseudotuberculosis IP
          32953]
 gi|108774744|gb|ABG17263.1| transcriptional regulator BolA [Yersinia pestis Nepal516]
 gi|108780558|gb|ABG14616.1| transcriptional regulator BolA [Yersinia pestis Antiqua]
 gi|115348801|emb|CAL21755.1| BolA protein [Yersinia pestis CO92]
 gi|145211750|gb|ABP41157.1| transcriptional regulator BolA [Yersinia pestis Pestoides F]
 gi|149291407|gb|EDM41481.1| possible regulator of murein genes [Yersinia pestis CA88-4125]
 gi|152960776|gb|ABS48237.1| bolA protein [Yersinia pseudotuberculosis IP 31758]
 gi|162353346|gb|ABX87294.1| bolA protein [Yersinia pestis Angola]
 gi|165916080|gb|EDR34687.1| bolA protein [Yersinia pestis biovar Orientalis str. IP275]
 gi|165921538|gb|EDR38735.1| bolA protein [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165990129|gb|EDR42430.1| bolA protein [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166205853|gb|EDR50333.1| bolA protein [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166960380|gb|EDR56401.1| bolA protein [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167051405|gb|EDR62813.1| bolA protein [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167057391|gb|EDR67137.1| bolA protein [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|169751988|gb|ACA69506.1| BolA family protein [Yersinia pseudotuberculosis YPIII]
 gi|186697349|gb|ACC87978.1| BolA family protein [Yersinia pseudotuberculosis PB1/+]
 gi|229681253|gb|EEO77347.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Yersinia pestis Nepal516]
 gi|229687734|gb|EEO79807.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Yersinia pestis biovar
          Orientalis str. India 195]
 gi|229695130|gb|EEO85177.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Yersinia pestis biovar
          Orientalis str. PEXU2]
 gi|229701005|gb|EEO89034.1| regulator of penicillin binding proteins and beta lactamase
          transcription (morphogene) [Yersinia pestis Pestoides
          A]
 gi|262362956|gb|ACY59677.1| BolA protein [Yersinia pestis D106004]
 gi|262366875|gb|ACY63432.1| BolA protein [Yersinia pestis D182038]
 gi|270338015|gb|EFA48792.1| BolA-like protein [Yersinia pestis KIM D27]
 gi|294355349|gb|ADE65690.1| BolA protein [Yersinia pestis Z176003]
 gi|320016346|gb|ADV99917.1| transcriptional regulator BolA [Yersinia pestis biovar Medievalis
          str. Harbin 35]
          Length = 106

 Score = 37.0 bits (84), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 31/47 (65%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   I+S++F+ +  + +H+ +Y  L +++  ++HAL++ T
Sbjct: 34 AGSESHFKIVIVSDKFQDQRFLSRHRSIYSVLADELAGSVHALALHT 80


>gi|198435151|ref|XP_002127300.1| PREDICTED: similar to bolA-like 1 [Ciona intestinalis]
          Length = 153

 Score = 37.0 bits (84), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 30/49 (61%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           G  +H+   ++S+ F G++ IQ+H+ V + L  ++   +HALSI+   P
Sbjct: 80  GSESHFKVVVVSDIFDGQSHIQRHRGVNNLLKEELSGKIHALSIQAKTP 128


>gi|254465661|ref|ZP_05079072.1| BolA protein [Rhodobacterales bacterium Y4I]
 gi|206686569|gb|EDZ47051.1| BolA protein [Rhodobacterales bacterium Y4I]
          Length = 84

 Score = 37.0 bits (84), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 29/45 (64%), Gaps = 1/45 (2%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSV 75
          +H+A  I SE F G +R+ QH+ V+ +LG  +   +HAL++ T V
Sbjct: 41 SHFAVRIRSEAFGGMSRVAQHRAVHKALGGIVPR-IHALALDTGV 84


>gi|163802391|ref|ZP_02196285.1| RNA polymerase sigma factor [Vibrio sp. AND4]
 gi|159173920|gb|EDP58734.1| RNA polymerase sigma factor [Vibrio sp. AND4]
          Length = 102

 Score = 37.0 bits (84), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 29/46 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   ++SE F G+  I +H+ V+  L +++ N +HAL+I T
Sbjct: 33 GSESHFKVIVVSETFAGERLIGRHRRVHKVLADELENHIHALAIHT 78


>gi|254571641|ref|XP_002492930.1| Putative protein of unknown function [Pichia pastoris GS115]
 gi|238032728|emb|CAY70751.1| Putative protein of unknown function [Pichia pastoris GS115]
 gi|328353060|emb|CCA39458.1| BolA-like protein 1 [Pichia pastoris CBS 7435]
          Length = 119

 Score = 37.0 bits (84), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 43/69 (62%), Gaps = 2/69 (2%)

Query: 6   HEIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN 64
            +I  M++K    +I+++ D++G  G+ +A ++ S +F+G   ++QH++V + L +++  
Sbjct: 48  QKIADMLQKEFNPTILSVRDVSGGCGSMFAIQVESAKFKGIPMVKQHRLVNELLKDEISQ 107

Query: 65  ALHALSIKT 73
             H L +KT
Sbjct: 108 -WHGLQLKT 115


>gi|254780586|ref|YP_003064999.1| BolA family protein [Candidatus Liberibacter asiaticus str.
          psy62]
 gi|254040263|gb|ACT57059.1| BolA family protein [Candidatus Liberibacter asiaticus str.
          psy62]
          Length = 101

 Score = 37.0 bits (84), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 28/49 (57%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
           H   +I+S  F G ++  +H+ +YD L  ++   LHALSI+   PD +
Sbjct: 47 THIRIKIVSPTFTGISKTFRHRKIYDLLHKEIKEELHALSIEAFSPDEK 95


>gi|50083429|ref|YP_044939.1| putative activator of morphogenic pathway (BolA), important in
          general stress response [Acinetobacter sp. ADP1]
 gi|49529405|emb|CAG67117.1| putative activator of morphogenic pathway (BolA) , important in
          general stress response [Acinetobacter sp. ADP1]
          Length = 102

 Score = 37.0 bits (84), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA-LHALSIKTSVPD 77
            G  +H+   ++S EF G   +Q+HQ VY    + M    +HAL+I   VP+
Sbjct: 32 FPGKESHFKVVVVSNEFNGLRLVQRHQKVYAVASDLMSPGRIHALAIHAYVPE 84


>gi|110680515|ref|YP_683522.1| BolA protein [Roseobacter denitrificans OCh 114]
 gi|109456631|gb|ABG32836.1| BolA protein [Roseobacter denitrificans OCh 114]
          Length = 85

 Score = 37.0 bits (84), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 31/48 (64%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSV 75
          G  +H+   I S+ F G NRIQ+H+ ++ +LG ++   +HAL++  +V
Sbjct: 38 GVESHFNVMIRSDHFAGMNRIQRHRAIHGALGPELIAQIHALALDVNV 85


>gi|318604626|emb|CBY26124.1| cell division protein BolA [Yersinia enterocolitica subsp.
          palearctica Y11]
          Length = 110

 Score = 37.0 bits (84), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   I+S +F+ +  + +H+ +Y +L  ++ + +HAL++ T
Sbjct: 34 AGSESHFKIVIVSNKFQDQRFLNRHRAIYSALAEELASTVHALALHT 80


>gi|253990897|ref|YP_003042253.1| transcriptional regulator BolA [Photorhabdus asymbiotica subsp.
          asymbiotica ATCC 43949]
 gi|253782347|emb|CAQ85511.1| BolA protein [Photorhabdus asymbiotica]
          Length = 119

 Score = 37.0 bits (84), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 29/46 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   IIS++F G+  + +H+ VY +L  ++   +HAL++ T
Sbjct: 47 GSESHFKVVIISDKFVGERMLNRHRSVYGTLSAELAAGVHALALHT 92


>gi|123443345|ref|YP_001007319.1| transcriptional regulator BolA [Yersinia enterocolitica subsp.
          enterocolitica 8081]
 gi|332160747|ref|YP_004297324.1| transcriptional regulator BolA [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|122090306|emb|CAL13172.1| BolA protein [Yersinia enterocolitica subsp. enterocolitica 8081]
 gi|325664977|gb|ADZ41621.1| transcriptional regulator BolA [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|330859953|emb|CBX70282.1| protein bolA [Yersinia enterocolitica W22703]
          Length = 110

 Score = 37.0 bits (84), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   I+S +F+ +  + +H+ +Y +L  ++ + +HAL++ T
Sbjct: 34 AGSESHFKIVIVSNKFQDQRFLNRHRAIYSALAEELASTVHALALHT 80


>gi|238788006|ref|ZP_04631802.1| hypothetical protein yfred0001_14960 [Yersinia frederiksenii ATCC
          33641]
 gi|238723954|gb|EEQ15598.1| hypothetical protein yfred0001_14960 [Yersinia frederiksenii ATCC
          33641]
          Length = 107

 Score = 37.0 bits (84), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   I+S +F+ +  + +H+ +Y  L +++ + +HAL++ T
Sbjct: 35 AGSESHFKIVIVSNKFQDQRFLSRHRAIYSVLADELASTVHALALHT 81


>gi|294669051|ref|ZP_06734137.1| BolA protein [Neisseria elongata subsp. glycolytica ATCC 29315]
 gi|291309043|gb|EFE50286.1| BolA protein [Neisseria elongata subsp. glycolytica ATCC 29315]
          Length = 93

 Score = 37.0 bits (84), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA-LHALSIKTSVPD 77
          G HY   ++S  F G  R+Q+ +MV ++L     +  +HALSI+   PD
Sbjct: 39 GGHYRILVVSTAFNGVLRLQRQRMVKEALHEWFSDGRIHALSIRALTPD 87


>gi|90410919|ref|ZP_01218933.1| putative cell division protein BolA [Photobacterium profundum
          3TCK]
 gi|90328132|gb|EAS44443.1| putative cell division protein BolA [Photobacterium profundum
          3TCK]
          Length = 102

 Score = 37.0 bits (84), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 29/46 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   ++S++F G   I +H+ V  +L +++ N +HAL+I T
Sbjct: 33 GSESHFKVIVVSDQFEGTRLIGRHRAVNSALAHELANDIHALAIHT 78


>gi|327308892|ref|XP_003239137.1| BolA domain-containing protein [Trichophyton rubrum CBS 118892]
 gi|326459393|gb|EGD84846.1| BolA domain-containing protein [Trichophyton rubrum CBS 118892]
          Length = 96

 Score = 37.0 bits (84), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 41/77 (53%), Gaps = 2/77 (2%)

Query: 2  SMNPHEIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          ++ P  I+ ++   +    V + DL+G  G  + A I+S +F  K  + +H++V  +L  
Sbjct: 14 AVTPDSIKSILTNKLEAQHVEVEDLSGGCGQAFQAIIVSPQFESKTTLARHRLVNSALKA 73

Query: 61 KMGNALHALSIKTSVPD 77
          ++  A+HA + K   P+
Sbjct: 74 EIA-AIHAWTPKCYTPE 89


>gi|296284335|ref|ZP_06862333.1| transcriptional regulator BolA [Citromicrobium bathyomarinum
          JL354]
          Length = 84

 Score = 37.0 bits (84), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 30/46 (65%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          +H+   I +  F  K+R+++ +MV  +LG+  G+ +HAL+IK + P
Sbjct: 35 SHFTILIEAPAFVDKSRLERQRMVNAALGDIPGDRVHALAIKATAP 80


>gi|126666028|ref|ZP_01737008.1| stress-induced morphogen [Marinobacter sp. ELB17]
 gi|126629350|gb|EAZ99967.1| stress-induced morphogen [Marinobacter sp. ELB17]
          Length = 116

 Score = 37.0 bits (84), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 12/46 (26%), Positives = 28/46 (60%)

Query: 32 HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          H+   ++S  F G++++++HQ +Y  L  ++   +HAL++    P+
Sbjct: 38 HFKVTLVSPAFVGQSKVKRHQAIYQVLAAELAAGVHALAMHPFTPE 83


>gi|149919523|ref|ZP_01908003.1| putative cell division protein BolA [Plesiocystis pacifica SIR-1]
 gi|149819648|gb|EDM79075.1| putative cell division protein BolA [Plesiocystis pacifica SIR-1]
          Length = 106

 Score = 37.0 bits (84), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 25/46 (54%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G   H+   ++S  F GK  + +H+ V  +L  ++   +HALSI+ 
Sbjct: 36 GSETHFKVIVVSPAFEGKTLVARHRAVNSALAEQLAGPVHALSIQA 81


>gi|262281339|ref|ZP_06059120.1| stress-induced morphogen [Acinetobacter calcoaceticus RUH2202]
 gi|262257165|gb|EEY75902.1| stress-induced morphogen [Acinetobacter calcoaceticus RUH2202]
          Length = 102

 Score = 37.0 bits (84), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 46/86 (53%), Gaps = 11/86 (12%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDG-------NHYAAEIISEEFRGKNRIQQHQM 53
          MS+    IE++ +   P  +  I++ AG G       +H+   ++S+EF G   +Q+HQ 
Sbjct: 1  MSLEQQLIERL-QTLAPSHLEVINESAGHGGYFPGKESHFKVIVVSDEFSGLRLVQRHQK 59

Query: 54 VYDSLGNKMGNA--LHALSIKTSVPD 77
          VY +L + + N   +HAL+I   +P 
Sbjct: 60 VY-ALASDLMNPGQIHALAIHAYLPS 84


>gi|50294924|ref|XP_449873.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49529187|emb|CAG62853.1| unnamed protein product [Candida glabrata]
          Length = 144

 Score = 37.0 bits (84), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-ALHALSIKTSVPD 77
           +H   EI++E F+G N  ++H++VY  L  +  +  LHAL + T  P+
Sbjct: 80  SHIRLEIVTEAFKGLNLPKRHRLVYGLLKEEFDDMGLHALQLTTKTPE 127


>gi|195426365|ref|XP_002061305.1| GK19316 [Drosophila willistoni]
 gi|194157390|gb|EDW72291.1| GK19316 [Drosophila willistoni]
          Length = 88

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 40/71 (56%), Gaps = 2/71 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          +E  +K+ +    V + D + G G  ++  I+SE F+ K  +Q+H++V  +L  ++   +
Sbjct: 9  LEDKLKEQLQAQHVQVTDESDGCGGKFSVVIVSEAFKNKTLLQKHRLVNSTLAEEL-KEI 67

Query: 67 HALSIKTSVPD 77
          HA S K+  P+
Sbjct: 68 HAFSQKSYTPE 78


>gi|255600593|ref|XP_002537488.1| conserved hypothetical protein [Ricinus communis]
 gi|223516151|gb|EEF24895.1| conserved hypothetical protein [Ricinus communis]
          Length = 385

 Score = 37.0 bits (84), Expect = 1.0,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 35/50 (70%), Gaps = 1/50 (2%)

Query: 25  DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-ALHALSIKT 73
           ++ GDG H+   ++S+ F G + +++ Q+VY +L  ++ + ++HA+++KT
Sbjct: 325 EVTGDGRHFDIVVVSDAFVGLSPLKKQQLVYGALQAEIADGSVHAVNMKT 374


>gi|331225583|ref|XP_003325462.1| hypothetical protein PGTG_07295 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309304452|gb|EFP81043.1| hypothetical protein PGTG_07295 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 186

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 4/50 (8%)

Query: 28  GDG-NHYAAEIISEEFRGKNRIQQHQMVYDSLG---NKMGNALHALSIKT 73
           G G  H++ +++S++F GK  I +H++VY  L     K    +HALS+KT
Sbjct: 127 GSGETHFSVKVVSDQFVGKPTIARHRLVYQILDVELTKNTAGIHALSLKT 176


>gi|240960498|ref|XP_002400558.1| conserved hypothetical protein [Ixodes scapularis]
 gi|215490701|gb|EEC00344.1| conserved hypothetical protein [Ixodes scapularis]
          Length = 86

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 39/70 (55%), Gaps = 2/70 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          +E  ++K +    + + D++ G G  Y A I+S +F GK  +++H+MV   L  ++   +
Sbjct: 9  LEDKLRKELDAVHIDLEDISDGCGAKYNAIIVSPKFEGKALLERHRMVNTILAEEL-QVI 67

Query: 67 HALSIKTSVP 76
          HA S KT  P
Sbjct: 68 HAFSQKTLTP 77


>gi|83313012|ref|YP_423276.1| stress-induced morphogen [Magnetospirillum magneticum AMB-1]
 gi|82947853|dbj|BAE52717.1| Stress-induced morphogen [Magnetospirillum magneticum AMB-1]
          Length = 121

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 29  DG-NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           DG +H+   I+S  F G +R+++H+ V   L  ++   +HA+++    PD
Sbjct: 66  DGESHFTVTIVSAAFEGVSRVERHRKVNALLAEELAGRVHAMALTLMTPD 115


>gi|323450030|gb|EGB05914.1| hypothetical protein AURANDRAFT_30104 [Aureococcus anophagefferens]
          Length = 106

 Score = 36.6 bits (83), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 2/77 (2%)

Query: 1   MSMNPHEIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59
           +S    ++E  +K  +    V + D++G  G  Y   I S  F G N I+QH++V   L 
Sbjct: 30  LSTPSEQMEVKLKAELGAVEVAVEDVSGGCGAMYKCYIESPRFAGLNTIKQHKLVQGVLK 89

Query: 60  NKMGNALHALSIKTSVP 76
           +++ + +H   +KT++P
Sbjct: 90  DEIAD-MHGFQLKTALP 105


>gi|260439737|ref|ZP_05793553.1| BolA/YrbA family protein [Neisseria gonorrhoeae DGI2]
 gi|291042987|ref|ZP_06568725.1| BolA/YrbA family protein [Neisseria gonorrhoeae DGI2]
 gi|291013126|gb|EFE05095.1| BolA/YrbA family protein [Neisseria gonorrhoeae DGI2]
          Length = 92

 Score = 36.6 bits (83), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPD 77
          G HYA  ++S  F G +R+ + + V   L +   G  +HAL I+ + PD
Sbjct: 37 GGHYAVLVVSGRFEGLSRLNRQKTVKSLLKDLFSGGMIHALGIRAATPD 85


>gi|326570040|gb|EGE20086.1| BolA familiy protein [Moraxella catarrhalis BC7]
          Length = 80

 Score = 36.6 bits (83), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MN   + ++++     + +   D   +GN +   I+ + F GK  + + QMVY  +   +
Sbjct: 1  MNAQALIELLRPHFADAYI---DAVNEGNKFELLIVDDAFEGKRLVARQQMVYTLVNQYI 57

Query: 63 GN-ALHALSIKTSVP 76
           N A+HAL+I    P
Sbjct: 58 QNGAMHALTIHALTP 72


>gi|325203457|gb|ADY98910.1| BolA family protein [Neisseria meningitidis M01-240355]
          Length = 92

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPD 77
          G HYA  ++S  F G +R+ + + V   L +   G  +HAL I+ + PD
Sbjct: 37 GGHYAVLVVSGRFEGVSRLNRQKTVKSLLKDLFSGGMIHALGIRAATPD 85


>gi|303310425|ref|XP_003065225.1| BolA-like family protein [Coccidioides posadasii C735 delta SOWgp]
 gi|240104885|gb|EER23080.1| BolA-like family protein [Coccidioides posadasii C735 delta SOWgp]
 gi|320033848|gb|EFW15794.1| BolA domain-containing protein [Coccidioides posadasii str.
           Silveira]
          Length = 137

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN--ALHALSIKTSVPDSQ 79
            H+   I+S  F  K +  +H+MVY  L ++M     +HAL ++T  P+ +
Sbjct: 79  THFNVTIVSSAFASKPQPARHRMVYSLLKDEMAQEGGIHALQLRTKTPEEE 129


>gi|254428056|ref|ZP_05041763.1| BolA-like protein [Alcanivorax sp. DG881]
 gi|196194225|gb|EDX89184.1| BolA-like protein [Alcanivorax sp. DG881]
          Length = 119

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 27/46 (58%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+   ++S+ F G   +++HQM+Y  L  ++   +HAL++ T  P
Sbjct: 37 THFKLVLVSDVFDGMMPVRRHQMLYKILAEELNGPVHALALHTHTP 82


>gi|238759264|ref|ZP_04620431.1| hypothetical protein yaldo0001_8120 [Yersinia aldovae ATCC 35236]
 gi|238702551|gb|EEP95101.1| hypothetical protein yaldo0001_8120 [Yersinia aldovae ATCC 35236]
          Length = 106

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 31/47 (65%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   I+S++F+ +  + +H+ +Y  L +++  ++HAL++ T
Sbjct: 34 AGSESHFKIVIVSDKFQDQRFLSRHRAIYGVLADELAGSVHALALHT 80


>gi|59801984|ref|YP_208696.1| hypothetical protein NGO1657 [Neisseria gonorrhoeae FA 1090]
 gi|194099537|ref|YP_002002667.1| BolA/YrbA family protein [Neisseria gonorrhoeae NCCP11945]
 gi|239999743|ref|ZP_04719667.1| BolA/YrbA family protein [Neisseria gonorrhoeae 35/02]
 gi|240014901|ref|ZP_04721814.1| BolA/YrbA family protein [Neisseria gonorrhoeae DGI18]
 gi|240017349|ref|ZP_04723889.1| BolA/YrbA family protein [Neisseria gonorrhoeae FA6140]
 gi|240081491|ref|ZP_04726034.1| BolA/YrbA family protein [Neisseria gonorrhoeae FA19]
 gi|240113771|ref|ZP_04728261.1| BolA/YrbA family protein [Neisseria gonorrhoeae MS11]
 gi|240116506|ref|ZP_04730568.1| BolA/YrbA family protein [Neisseria gonorrhoeae PID18]
 gi|240118729|ref|ZP_04732791.1| BolA/YrbA family protein [Neisseria gonorrhoeae PID1]
 gi|240121971|ref|ZP_04734933.1| BolA/YrbA family protein [Neisseria gonorrhoeae PID24-1]
 gi|240124268|ref|ZP_04737224.1| BolA/YrbA family protein [Neisseria gonorrhoeae PID332]
 gi|240126478|ref|ZP_04739364.1| BolA/YrbA family protein [Neisseria gonorrhoeae SK-92-679]
 gi|240128941|ref|ZP_04741602.1| BolA/YrbA family protein [Neisseria gonorrhoeae SK-93-1035]
 gi|254494531|ref|ZP_05107702.1| BolA/YrbA family protein [Neisseria gonorrhoeae 1291]
 gi|268595557|ref|ZP_06129724.1| BolA/YrbA family protein [Neisseria gonorrhoeae 35/02]
 gi|268597592|ref|ZP_06131759.1| BolA/YrbA family protein [Neisseria gonorrhoeae FA19]
 gi|268599843|ref|ZP_06134010.1| BolA/YrbA family protein [Neisseria gonorrhoeae MS11]
 gi|268602177|ref|ZP_06136344.1| BolA/YrbA family protein [Neisseria gonorrhoeae PID18]
 gi|268604443|ref|ZP_06138610.1| BolA/YrbA family protein [Neisseria gonorrhoeae PID1]
 gi|268682897|ref|ZP_06149759.1| BolA/YrbA family protein [Neisseria gonorrhoeae PID332]
 gi|268685063|ref|ZP_06151925.1| BolA/YrbA family protein [Neisseria gonorrhoeae SK-92-679]
 gi|268687327|ref|ZP_06154189.1| BolA/YrbA family protein [Neisseria gonorrhoeae SK-93-1035]
 gi|293398328|ref|ZP_06642519.1| BolA protein [Neisseria gonorrhoeae F62]
 gi|59718879|gb|AAW90284.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|193934827|gb|ACF30651.1| BolA/YrbA family protein [Neisseria gonorrhoeae NCCP11945]
 gi|226513571|gb|EEH62916.1| BolA/YrbA family protein [Neisseria gonorrhoeae 1291]
 gi|268548946|gb|EEZ44364.1| BolA/YrbA family protein [Neisseria gonorrhoeae 35/02]
 gi|268551380|gb|EEZ46399.1| BolA/YrbA family protein [Neisseria gonorrhoeae FA19]
 gi|268583974|gb|EEZ48650.1| BolA/YrbA family protein [Neisseria gonorrhoeae MS11]
 gi|268586308|gb|EEZ50984.1| BolA/YrbA family protein [Neisseria gonorrhoeae PID18]
 gi|268588574|gb|EEZ53250.1| BolA/YrbA family protein [Neisseria gonorrhoeae PID1]
 gi|268623181|gb|EEZ55581.1| BolA/YrbA family protein [Neisseria gonorrhoeae PID332]
 gi|268625347|gb|EEZ57747.1| BolA/YrbA family protein [Neisseria gonorrhoeae SK-92-679]
 gi|268627611|gb|EEZ60011.1| BolA/YrbA family protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291611252|gb|EFF40336.1| BolA protein [Neisseria gonorrhoeae F62]
 gi|317165035|gb|ADV08576.1| hypothetical protein NGTW08_1618 [Neisseria gonorrhoeae
          TCDC-NG08107]
          Length = 92

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPD 77
          G HYA  ++S  F G +R+ + + V   L +   G  +HAL I+ + PD
Sbjct: 37 GGHYAVLVVSGRFEGLSRLNRQKTVKSLLKDLFSGGMIHALGIRAATPD 85


>gi|289614242|emb|CBI59009.1| unnamed protein product [Sordaria macrospora]
          Length = 135

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 41/71 (57%), Gaps = 2/71 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          +  ++K  +  + V + D++G  G  + + I+S +F GKN +++H++V  +L  ++   +
Sbjct: 14 LSAVLKTRLNATHVEVTDMSGGCGASFTSLIVSPDFVGKNSLKRHRLVNAALKEEIAR-I 72

Query: 67 HALSIKTSVPD 77
          HA S K   P+
Sbjct: 73 HAWSAKCQTPE 83


>gi|15676259|ref|NP_273393.1| BolA/YrbA family protein [Neisseria meningitidis MC58]
 gi|121635520|ref|YP_975765.1| hypothetical protein NMC1826 [Neisseria meningitidis FAM18]
 gi|161870725|ref|YP_001599898.1| BolA/YrbA family protein [Neisseria meningitidis 053442]
 gi|254805620|ref|YP_003083841.1| BolA-like protein [Neisseria meningitidis alpha14]
 gi|7225565|gb|AAF40787.1| BolA/YrbA family protein [Neisseria meningitidis MC58]
 gi|120867226|emb|CAM10995.1| conserved hypothetical protein [Neisseria meningitidis FAM18]
 gi|161596278|gb|ABX73938.1| BolA/YrbA family protein [Neisseria meningitidis 053442]
 gi|254669162|emb|CBA07864.1| BolA-like protein [Neisseria meningitidis alpha14]
 gi|254671969|emb|CBA04397.1| conserved hypothetical protein [Neisseria meningitidis alpha275]
 gi|261391869|emb|CAX49328.1| BolA-like protein [Neisseria meningitidis 8013]
 gi|316984349|gb|EFV63323.1| bolA-like family protein [Neisseria meningitidis H44/76]
 gi|325128930|gb|EGC51784.1| BolA family protein [Neisseria meningitidis N1568]
 gi|325132899|gb|EGC55576.1| BolA family protein [Neisseria meningitidis M6190]
 gi|325134925|gb|EGC57557.1| BolA family protein [Neisseria meningitidis M13399]
 gi|325138884|gb|EGC61434.1| BolA family protein [Neisseria meningitidis ES14902]
 gi|325140993|gb|EGC63499.1| BolA family protein [Neisseria meningitidis CU385]
 gi|325199538|gb|ADY94993.1| BolA family protein [Neisseria meningitidis H44/76]
 gi|325202836|gb|ADY98290.1| BolA family protein [Neisseria meningitidis M01-240149]
 gi|325205421|gb|ADZ00874.1| BolA family protein [Neisseria meningitidis M04-240196]
 gi|325208829|gb|ADZ04281.1| BolA family protein [Neisseria meningitidis NZ-05/33]
          Length = 92

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPD 77
          G HYA  ++S  F G +R+ + + V   L +   G  +HAL I+ + PD
Sbjct: 37 GGHYAVLVVSGRFEGVSRLNRQKTVKSLLKDLFSGGMIHALGIRAATPD 85


>gi|323306134|gb|EGA59866.1| YAL044W-A-like protein [Saccharomyces cerevisiae FostersB]
          Length = 110

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM--GNALHALSIKTSVP 76
            H+  E++S++F G    Q+H+MVY  L ++M   N +HAL +    P
Sbjct: 55  THFRIEMVSKKFEGLKLPQRHRMVYSLLQDEMAQANGIHALQLSLKTP 102


>gi|12621476|ref|NP_075206.1| hypothetical protein YAL044W-A [Saccharomyces cerevisiae S288c]
 gi|114154873|sp|Q3E793|YA044_YEAST RecName: Full=Uncharacterized bolA-like protein YAL044W-A
 gi|285810155|tpg|DAA06941.1| TPA: hypothetical protein YAL044W-A [Saccharomyces cerevisiae
           S288c]
          Length = 110

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM--GNALHALSIKTSVP 76
            H+  E++S++F G    Q+H+MVY  L ++M   N +HAL +    P
Sbjct: 55  THFRIEMVSKKFEGLKLPQRHRMVYSLLQDEMAQANGIHALQLSLKTP 102


>gi|320588397|gb|EFX00866.1| bola-like protein [Grosmannia clavigera kw1407]
          Length = 96

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 39/71 (54%), Gaps = 2/71 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          +E  +++ +    V + D++G  G  + A I+S  F   N +++H++V  +L +++   +
Sbjct: 11 LENTLREKLQAQHVKVTDVSGGCGQAFTAVIVSPSFNALNSLKRHRLVNATLRDEIAR-I 69

Query: 67 HALSIKTSVPD 77
          HA S K   PD
Sbjct: 70 HAWSAKCQTPD 80


>gi|255067237|ref|ZP_05319092.1| BolA protein [Neisseria sicca ATCC 29256]
 gi|255048605|gb|EET44069.1| BolA protein [Neisseria sicca ATCC 29256]
          Length = 89

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL-HALSIKTSVPD 77
          G HY   ++SE F G +R+ + + +   L +     L HALSIK + PD
Sbjct: 37 GGHYTVVVVSEAFGGVSRLNRQRTIKTLLHDLFSEGLIHALSIKAATPD 85


>gi|254448683|ref|ZP_05062141.1| morphogene BolA protein [gamma proteobacterium HTCC5015]
 gi|198261691|gb|EDY85978.1| morphogene BolA protein [gamma proteobacterium HTCC5015]
          Length = 91

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 29 DGN-HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          DG  H+   ++SE F G   +Q+H+ V+ ++G+ M   +HALSIK 
Sbjct: 37 DGRGHFNVLVVSEAFDGLLPLQRHRKVFAAVGSLMETDIHALSIKA 82


>gi|319781247|ref|YP_004140723.1| BolA family protein [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
 gi|317167135|gb|ADV10673.1| BolA family protein [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
          Length = 100

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 28/46 (60%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+   +++  F G +RI +H+ V + L +++   +HAL+I+ + P
Sbjct: 49 THFRVRVVASAFAGMSRIDRHRAVNELLADELKAGVHALAIEPAAP 94


>gi|262166546|ref|ZP_06034283.1| BolA/YrbA family protein [Vibrio mimicus VM223]
 gi|262026262|gb|EEY44930.1| BolA/YrbA family protein [Vibrio mimicus VM223]
          Length = 64

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 26 LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSL-GNKMGNALHALSIKTSVP 76
          + G+G+HY    +   F   +R+++ QM+Y  L G    N +HA+++KT  P
Sbjct: 1  MKGEGSHYEVIAVDACFADMSRVKKQQMIYAPLMGYIQRNDIHAVTMKTFTP 52


>gi|163856018|ref|YP_001630316.1| BolA-like protein [Bordetella petrii DSM 12804]
 gi|163259746|emb|CAP42047.1| BolA-like protein [Bordetella petrii]
          Length = 106

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 27/46 (58%)

Query: 33  YAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDS 78
           Y   I++  F G + + +H++VYD L + + + +HAL++    P S
Sbjct: 59  YHVHIVAARFAGLSPVARHRLVYDLLHDLIPHPVHALALDAQAPKS 104


>gi|323356367|gb|EGA88167.1| YAL044W-A-like protein [Saccharomyces cerevisiae VL3]
          Length = 110

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM--GNALHALSIKTSVP 76
            H+  E++S++F G    Q+H+MVY  L ++M   N +HAL +    P
Sbjct: 55  THFRIEMVSKKFEGLKLPQRHRMVYSLLQDEMAQANGIHALQLSLKTP 102


>gi|325145139|gb|EGC67421.1| BolA family protein [Neisseria meningitidis M01-240013]
          Length = 92

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPD 77
          G HYA  ++S  F G +R+ + + V   L +   G  +HAL I+ + PD
Sbjct: 37 GGHYAVLVVSGRFEGVSRLNRQKTVKSLLKDLFSGGMIHALGIRAATPD 85


>gi|308388553|gb|ADO30873.1| BolA/YbrA family protein [Neisseria meningitidis alpha710]
 gi|325136919|gb|EGC59516.1| BolA family protein [Neisseria meningitidis M0579]
 gi|325143030|gb|EGC65382.1| BolA family protein [Neisseria meningitidis 961-5945]
 gi|325198966|gb|ADY94422.1| BolA family protein [Neisseria meningitidis G2136]
          Length = 92

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVPD 77
          G HYA  ++S  F G +R+ + + V   L +   G  +HAL I+ + PD
Sbjct: 37 GGHYAVLVVSGRFEGVSRLNRQKTVKSLLKDLFSGGMIHALGIRAATPD 85


>gi|170577984|ref|XP_001894213.1| BolA-like protein [Brugia malayi]
 gi|158599280|gb|EDP36949.1| BolA-like protein [Brugia malayi]
          Length = 358

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 2/71 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          I++ ++  +  S + I D + G G  +   I+S+ F  K  +  H++VY+ L  +M   +
Sbjct: 5  IQQKLEIALKPSHLDIEDFSDGCGLKFRLIIVSDSFDNKTTLASHRLVYEVLKEEM-QLI 63

Query: 67 HALSIKTSVPD 77
          HAL IKT  P+
Sbjct: 64 HALEIKTYTPE 74


>gi|151941345|gb|EDN59716.1| conserved protein [Saccharomyces cerevisiae YJM789]
 gi|190406695|gb|EDV09962.1| conserved hypothetical protein [Saccharomyces cerevisiae RM11-1a]
 gi|256272283|gb|EEU07268.1| YAL044W-A-like protein [Saccharomyces cerevisiae JAY291]
 gi|259144658|emb|CAY77599.1| EC1118_1A20_0265p [Saccharomyces cerevisiae EC1118]
 gi|323334775|gb|EGA76147.1| YAL044W-A-like protein [Saccharomyces cerevisiae AWRI796]
 gi|323338870|gb|EGA80084.1| YAL044W-A-like protein [Saccharomyces cerevisiae Vin13]
 gi|323349923|gb|EGA84133.1| YAL044W-A-like protein [Saccharomyces cerevisiae Lalvin QA23]
          Length = 110

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM--GNALHALSIKTSVP 76
            H+  E++S++F G    Q+H+MVY  L ++M   N +HAL +    P
Sbjct: 55  THFRIEMVSKKFEGLKLPQRHRMVYSLLQDEMAQANGIHALQLSLKTP 102


>gi|229521581|ref|ZP_04410999.1| BolA/YrbA family protein [Vibrio cholerae TM 11079-80]
 gi|229341175|gb|EEO06179.1| BolA/YrbA family protein [Vibrio cholerae TM 11079-80]
          Length = 84

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 45/75 (60%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSL-GNK 61
          M+  ++++++++ +  ++  IH + G+G+HY    +   F   +R+++ QM+Y  L G  
Sbjct: 1  MDNAQVQQILQQAL--NLEEIH-VKGEGSHYEVIAVDACFADMSRVKKQQMIYAPLMGYI 57

Query: 62 MGNALHALSIKTSVP 76
            N +HA+++KT  P
Sbjct: 58 QRNDIHAVTMKTFTP 72


>gi|157369336|ref|YP_001477325.1| transcriptional regulator BolA [Serratia proteamaculans 568]
 gi|157321100|gb|ABV40197.1| BolA family protein [Serratia proteamaculans 568]
          Length = 104

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 29/47 (61%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S+ F G+  + +H+ +Y  L  ++ + +HAL++ T
Sbjct: 32 AGSESHFKVVLVSDRFVGERFLTRHRSIYGVLSEELSDGVHALALHT 78


>gi|238791429|ref|ZP_04635067.1| hypothetical protein yinte0001_25800 [Yersinia intermedia ATCC
          29909]
 gi|238729045|gb|EEQ20561.1| hypothetical protein yinte0001_25800 [Yersinia intermedia ATCC
          29909]
          Length = 107

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   I+S +F+ +  + +H+ +Y  L +++  ++HAL++ T
Sbjct: 35 AGSESHFKIVIVSNKFQDQRFLSRHRAIYSVLADELAGSVHALALHT 81


>gi|326485202|gb|EGE09212.1| BolA domain-containing protein [Trichophyton equinum CBS 127.97]
          Length = 96

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 41/77 (53%), Gaps = 2/77 (2%)

Query: 2  SMNPHEIEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          ++ P  I+ ++   +    V + DL+G  G  + A I+S +F  K  + +H++V  +L  
Sbjct: 14 AVTPDSIKSILTNKLDAQHVEVEDLSGGCGQAFQAIIVSPQFESKTTLARHRLVNSALKA 73

Query: 61 KMGNALHALSIKTSVPD 77
          ++  A+HA + K   P+
Sbjct: 74 EIA-AIHAWTPKCYTPE 89


>gi|226940619|ref|YP_002795693.1| BolA [Laribacter hongkongensis HLHK9]
 gi|226715546|gb|ACO74684.1| BolA [Laribacter hongkongensis HLHK9]
          Length = 86

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 25 DLAGD--GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
          D AG+  G HY   I+S  F G   I++H++V   + + +   +HALS+K   P  +
Sbjct: 30 DHAGNTGGGHYELTIVSPHFEGLRLIERHRLVNALVADLIPQQIHALSLKAVAPSER 86


>gi|156537803|ref|XP_001608275.1| PREDICTED: similar to GA17237-PA [Nasonia vitripennis]
          Length = 85

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G G  +A  I+S++F GK  +Q+H++V   L  ++  ++HA S KT  P+
Sbjct: 29 GCGGKFAVLIVSDKFEGKPLLQRHRLVNSILEEEL-KSIHAFSQKTLTPE 77


>gi|121700078|ref|XP_001268304.1| BolA domain protein [Aspergillus clavatus NRRL 1]
 gi|119396446|gb|EAW06878.1| BolA domain protein [Aspergillus clavatus NRRL 1]
          Length = 92

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 20 IVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          +V I DL+G  G  + A I+S +F  KN + +H++V   L  ++  A+HA + K   P+
Sbjct: 25 VVEIEDLSGGCGQAFQAVIVSPQFEKKNMLARHRLVNSVLKAEIA-AIHAWTPKCYTPE 82


>gi|311695322|gb|ADP98195.1| transcriptional regulator, BolA superfamily protein [marine
          bacterium HP15]
          Length = 80

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNK- 61
          M+  ++ +++K+ +P   V +     DG HY   ++ + F G   I++ Q++  +L  + 
Sbjct: 1  MDAAQVTELVKEALPGCEVQVQV---DGTHYLVVVVGDVFEGLPTIKRQQLINKALFQQI 57

Query: 62 MGNALHALSIKTSVP 76
          M  ++HAL  K   P
Sbjct: 58 MDGSIHALHPKAFTP 72


>gi|260753884|ref|YP_003226777.1| BolA family protein [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|258553247|gb|ACV76193.1| BolA family protein [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 101

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 29/49 (59%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
           +H+   ++S+ F  ++RI + +MV  +L + + + +HAL +K   P  Q
Sbjct: 52  SHFTVTLVSQAFENESRISRERMVQKALSDLLPDRIHALRLKLDTPLRQ 100


>gi|71019343|ref|XP_759902.1| hypothetical protein UM03755.1 [Ustilago maydis 521]
 gi|46099557|gb|EAK84790.1| hypothetical protein UM03755.1 [Ustilago maydis 521]
          Length = 260

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 43/73 (58%), Gaps = 3/73 (4%)

Query: 3  MNPHEIEKMIKKGIPQ-SIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          ++  E+E  I++ +   S + + D++G  G  Y   I+S+ F G N +++H+MV + L +
Sbjct: 2  VSSQELETAIRQKVQDVSTLVVSDVSGGCGQAYDVVIVSDAFSGLNTLKRHRMVNELLKD 61

Query: 61 KMGNALHALSIKT 73
          ++   LHA S KT
Sbjct: 62 EIAQ-LHAFSQKT 73


>gi|296113961|ref|YP_003627899.1| BolA familiy protein [Moraxella catarrhalis RH4]
 gi|295921655|gb|ADG62006.1| BolA familiy protein [Moraxella catarrhalis RH4]
 gi|326559321|gb|EGE09748.1| BolA familiy protein [Moraxella catarrhalis 7169]
 gi|326564303|gb|EGE14533.1| BolA familiy protein [Moraxella catarrhalis 103P14B1]
 gi|326564718|gb|EGE14933.1| BolA familiy protein [Moraxella catarrhalis 46P47B1]
 gi|326567237|gb|EGE17357.1| BolA familiy protein [Moraxella catarrhalis 12P80B1]
 gi|326568258|gb|EGE18340.1| BolA familiy protein [Moraxella catarrhalis BC8]
 gi|326569958|gb|EGE20005.1| BolA familiy protein [Moraxella catarrhalis BC1]
 gi|326572894|gb|EGE22879.1| BolA familiy protein [Moraxella catarrhalis CO72]
 gi|326573859|gb|EGE23812.1| BolA familiy protein [Moraxella catarrhalis O35E]
 gi|326574720|gb|EGE24656.1| BolA familiy protein [Moraxella catarrhalis 101P30B1]
          Length = 80

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 25 DLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-ALHALSIKTSVP 76
          D   +GN +   I+ + F GK  + + QMVY  +   + N A+HAL+I    P
Sbjct: 20 DAVNEGNKFELLIVDDAFEGKRLVARQQMVYTLVNQYIQNGAMHALTIHALTP 72


>gi|260581865|ref|ZP_05849661.1| NAD-dependent DNA ligase LigA [Haemophilus influenzae NT127]
 gi|319776665|ref|YP_004139153.1| DNA-binding transcriptional regulator [Haemophilus influenzae
          F3047]
 gi|329124183|ref|ZP_08252730.1| BolA superfamily transcriptional regulator [Haemophilus aegyptius
          ATCC 11116]
 gi|260095058|gb|EEW78950.1| NAD-dependent DNA ligase LigA [Haemophilus influenzae NT127]
 gi|317451256|emb|CBY87490.1| predicted DNA-binding transcriptional regulator [Haemophilus
          influenzae F3047]
 gi|327467608|gb|EGF13106.1| BolA superfamily transcriptional regulator [Haemophilus aegyptius
          ATCC 11116]
          Length = 85

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 4/72 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   +IEK++K  +  +IV ++   G+  H+   ++S+E    +R++Q Q +Y  L    
Sbjct: 1  MELQKIEKILKDTL--NIVEVYA-QGENAHFGVIVVSDEIAALSRVKQQQTIYAPLMPYF 57

Query: 63 GNA-LHALSIKT 73
              +HAL+IKT
Sbjct: 58 STGEIHALTIKT 69


>gi|121709355|ref|XP_001272395.1| BolA domain protein [Aspergillus clavatus NRRL 1]
 gi|119400544|gb|EAW10969.1| BolA domain protein [Aspergillus clavatus NRRL 1]
          Length = 134

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 26  LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN--ALHALSIKTSVPDSQ 79
           +A    H+   I S  F+ K +  +H+MVY  L  +M     +HAL +KT  P+ +
Sbjct: 66  VASKETHFHVTITSSTFQSKMQPARHRMVYGLLKEEMSREGGIHALQLKTKTPEEE 121


>gi|170728553|ref|YP_001762579.1| BolA family protein [Shewanella woodyi ATCC 51908]
 gi|169813900|gb|ACA88484.1| BolA family protein [Shewanella woodyi ATCC 51908]
          Length = 96

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA-LHALSIKTSVP 76
          G HY    + E F G  R++Q Q +Y  L +++ +  LHAL+I    P
Sbjct: 38 GTHYKIVAVGECFEGMGRVKQQQTIYGPLMDRITSGELHALTINAFTP 85


>gi|171695084|ref|XP_001912466.1| hypothetical protein [Podospora anserina S mat+]
 gi|170947784|emb|CAP59947.1| unnamed protein product [Podospora anserina S mat+]
          Length = 94

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN--ALHALSIKTSVPDSQ 79
           H+   I SE FR K +  +H++VY  L ++M     +HAL ++T  P+ +
Sbjct: 33 THFRVIITSEAFRSKMQPARHRLVYSLLKDEMAREGGIHALQLRTMTPEEE 83


>gi|332374484|gb|AEE62383.1| unknown [Dendroctonus ponderosae]
          Length = 128

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 29/50 (58%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           G   H+   +++E+F   + I++H+ + D L +++   +HALSI    PD
Sbjct: 60  GAETHFKVIVVTEKFNNLSLIKRHRKINDLLKDELQGGVHALSIVAKTPD 109


>gi|256016583|emb|CAR63587.1| putative BolA-like family protein [Angiostrongylus cantonensis]
          Length = 82

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 14 KGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIK 72
          K  P  +  + +  G G  +A  ++S+ F GK  ++ H++V D++ + M   +HA++IK
Sbjct: 14 KLTPSHLEVVDESDGCGAKFAITVVSDAFDGKRLVECHRLVQDAISDIMPQ-IHAVTIK 71


>gi|145494460|ref|XP_001433224.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124400341|emb|CAK65827.1| unnamed protein product [Paramecium tetraurelia]
          Length = 115

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 7/71 (9%)

Query: 8  IEKMIKKGIPQ--SIVTIHDL----AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN- 60
          ++K+     PQ  SI+   +L     G   H+   I+S EF  K+ IQ+H+ +Y S+ N 
Sbjct: 16 LQKLTSDFTPQHLSIINESNLHSVPKGSETHFKITIVSNEFENKSHIQRHRSIYQSIDNL 75

Query: 61 KMGNALHALSI 71
          K    +HA+ I
Sbjct: 76 KNDYKIHAIQI 86


>gi|157138062|ref|XP_001657219.1| BolA protein, putative [Aedes aegypti]
 gi|108880703|gb|EAT44928.1| BolA protein, putative [Aedes aegypti]
          Length = 140

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM-GNALHALSIKTSVP 76
           G   H+   ++S +F G   I++H++V + +  K+ GN +HALSI+   P
Sbjct: 70  GSETHFKVLVVSNQFDGLPLIKRHRLVNEIVKEKLAGNFVHALSIEAKTP 119


>gi|86137657|ref|ZP_01056234.1| BolA protein, truncation [Roseobacter sp. MED193]
 gi|85825992|gb|EAQ46190.1| BolA protein, truncation [Roseobacter sp. MED193]
          Length = 85

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 33/48 (68%), Gaps = 2/48 (4%)

Query: 24 HDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSI 71
          HD +G+ +H+   I S  F G+NR+QQH+ V+ +LG+ +   +HAL++
Sbjct: 35 HDGSGE-SHFNVRIRSVAFEGQNRVQQHRAVHRALGDIVPR-IHALAL 80


>gi|293611177|ref|ZP_06693475.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826428|gb|EFF84795.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 102

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 11/86 (12%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDG-------NHYAAEIISEEFRGKNRIQQHQM 53
          MS+    IE++ +   P  +  I++ AG G       +H+   I+S EF G   +Q+HQ 
Sbjct: 1  MSLEQQLIERL-QTLAPSHLEVINESAGHGGYFPGKESHFKVIIVSNEFNGLRLVQRHQK 59

Query: 54 VYDSLGNKMGNA--LHALSIKTSVPD 77
          VY +L + + N   +HAL+I   +P 
Sbjct: 60 VY-ALASDLMNPGQIHALAIHAYLPS 84


>gi|90420217|ref|ZP_01228125.1| BolA family protein [Aurantimonas manganoxydans SI85-9A1]
 gi|90335551|gb|EAS49301.1| BolA family protein [Aurantimonas manganoxydans SI85-9A1]
          Length = 100

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 28/46 (60%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+   ++S  F G++R+ +H+ +   L +++   +HAL+I+ S P
Sbjct: 49 THFRVRLVSAAFAGQSRVARHRAINRVLQDELDAGVHALAIEVSAP 94


>gi|260943428|ref|XP_002616012.1| hypothetical protein CLUG_03253 [Clavispora lusitaniae ATCC 42720]
 gi|238849661|gb|EEQ39125.1| hypothetical protein CLUG_03253 [Clavispora lusitaniae ATCC 42720]
          Length = 151

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 28/44 (63%), Gaps = 1/44 (2%)

Query: 31  NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGN-ALHALSIKT 73
           +H+  EI+S+ F GKN   +H+++Y  L ++     LHAL +KT
Sbjct: 96  SHFRLEIVSDSFVGKNMPARHRIIYQLLDDEFKTKGLHALQMKT 139


>gi|213403256|ref|XP_002172400.1| BolA-like protein [Schizosaccharomyces japonicus yFS275]
 gi|212000447|gb|EEB06107.1| BolA-like protein [Schizosaccharomyces japonicus yFS275]
          Length = 100

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 2/67 (2%)

Query: 8  IEKMIKKGIPQSIVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNAL 66
          I + +K     + + + D++G  G+ Y   I SE FRGK  ++QH+MV + L   + N +
Sbjct: 32 IAEKLKNAFQPTQLQVEDISGGCGSMYQINITSEAFRGKPLVKQHRMVNEVLQEDIKN-M 90

Query: 67 HALSIKT 73
          H L + T
Sbjct: 91 HGLQLVT 97


>gi|209694515|ref|YP_002262443.1| BolA protein [Aliivibrio salmonicida LFI1238]
 gi|208008466|emb|CAQ78633.1| BolA protein [Aliivibrio salmonicida LFI1238]
          Length = 104

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 29/46 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   ++S++F  K  + +H+M+   L +++ N +HAL+I T
Sbjct: 33 GSESHFKVIVVSDQFNDKRLLARHRMINAILADELANHIHALAIHT 78


>gi|153001951|ref|YP_001367632.1| BolA family protein [Shewanella baltica OS185]
 gi|151366569|gb|ABS09569.1| BolA family protein [Shewanella baltica OS185]
          Length = 106

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 26/42 (61%)

Query: 32 HYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          H+   ++SE+F G   + +H++V   L  ++ N +HALSI T
Sbjct: 45 HFKVVLVSEQFDGLRLLARHRLVNTHLAYELANGVHALSIHT 86


>gi|150397760|ref|YP_001328227.1| BolA family protein [Sinorhizobium medicae WSM419]
 gi|150029275|gb|ABR61392.1| BolA family protein [Sinorhizobium medicae WSM419]
          Length = 93

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 44/87 (50%), Gaps = 11/87 (12%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTI---HDLAG-----DG---NHYAAEIISEEFRGKNRIQ 49
          MS+  H  +K+ +   P+ ++ I   H  AG     DG    H    I++  F G +R+ 
Sbjct: 1  MSLRRHIEDKLTEAFHPERLMVINESHQHAGHQPGFDGGGETHMRIRIVASAFAGMSRVA 60

Query: 50 QHQMVYDSLGNKMGNALHALSIKTSVP 76
          +H+ + D L  ++   LHAL+++ + P
Sbjct: 61 RHRAINDLLKPELDAGLHALAVEPAAP 87


>gi|157870343|ref|XP_001683722.1| hypothetical protein [Leishmania major strain Friedlin]
 gi|68126788|emb|CAJ05334.1| conserved hypothetical protein [Leishmania major strain Friedlin]
          Length = 88

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 34/56 (60%), Gaps = 1/56 (1%)

Query: 18 QSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          QS+  +   AG G+ +  +I+S  F+GK+ IQQH++V   L  ++ + +H  ++ T
Sbjct: 31 QSVRVVDVSAGCGSFFNIDIVSPVFQGKSLIQQHRLVNSVLEEEI-STIHGFTLNT 85


>gi|225714592|gb|ACO13142.1| BolA-like protein 3 [Lepeophtheirus salmonis]
          Length = 92

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 45/77 (58%), Gaps = 3/77 (3%)

Query: 3  MNPHEIEKMIKKGIPQSI-VTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          +N   ++ +++   P++  + + D++ G G  +   I + +F G  RI+QH++V  +L  
Sbjct: 14 LNESHVKGVLQGSFPKATDIVVRDISHGCGAMFEIYIEAPDFAGLRRIKQHKLVTHALEK 73

Query: 61 KMGNALHALSIKTSVPD 77
          ++ + +H L I T+VP+
Sbjct: 74 EIKD-MHGLRISTAVPE 89


>gi|15966427|ref|NP_386780.1| putative transcription regulator protein [Sinorhizobium meliloti
          1021]
 gi|307300535|ref|ZP_07580315.1| BolA family protein [Sinorhizobium meliloti BL225C]
 gi|307318400|ref|ZP_07597835.1| BolA family protein [Sinorhizobium meliloti AK83]
 gi|15075698|emb|CAC47253.1| Transcription regulator, BolA/YrbA family [Sinorhizobium meliloti
          1021]
 gi|306896082|gb|EFN26833.1| BolA family protein [Sinorhizobium meliloti AK83]
 gi|306904701|gb|EFN35285.1| BolA family protein [Sinorhizobium meliloti BL225C]
          Length = 93

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 27/49 (55%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          G   H    I+S  F G +R+ +H+ + D L  ++   LHAL+++ + P
Sbjct: 39 GGETHMRVRIVSSAFTGMSRVARHRAINDLLKPELDAGLHALAVEPAAP 87


>gi|242023286|ref|XP_002432066.1| conserved hypothetical protein [Pediculus humanus corporis]
 gi|212517428|gb|EEB19328.1| conserved hypothetical protein [Pediculus humanus corporis]
          Length = 106

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 28/50 (56%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   H+   ++S++F     +Q+H++V  +L  ++ N +HALSI    P 
Sbjct: 37 GSETHFKIVLVSDKFENMTLLQRHRLVNSTLEYELQNGVHALSIVAKTPS 86


>gi|50290243|ref|XP_447553.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49526863|emb|CAG60490.1| unnamed protein product [Candida glabrata]
          Length = 84

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 4/75 (5%)

Query: 1  MSMNPHEIEKMIKKGIPQSI-VTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSL 58
          M    H  EK+ K  IP    V + DL+ G G  +   ++S  F GKN+IQ+ ++V  +L
Sbjct: 1  MITEEHLREKL-KTSIPDVYHVIVTDLSYGCGQSFDVVVVSNTFVGKNKIQRSRLVNGAL 59

Query: 59 GNKMGNALHALSIKT 73
            ++ + +HA S K 
Sbjct: 60 KEELAD-IHAFSCKC 73


>gi|294648836|ref|ZP_06726292.1| regulator of penicillin binding proteins and beta lactamase
          transcription [Acinetobacter haemolyticus ATCC 19194]
 gi|292825227|gb|EFF83974.1| regulator of penicillin binding proteins and beta lactamase
          transcription [Acinetobacter haemolyticus ATCC 19194]
          Length = 103

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 9/85 (10%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDG-------NHYAAEIISEEFRGKNRIQQHQM 53
          M++    IE++ +   P  +  I++ AG G       +H+   ++SE F+G   +Q+HQ 
Sbjct: 2  MNLEQQLIERL-QSFAPSHLEVINESAGHGGYFPGKESHFKVIVVSEAFQGLRLVQRHQK 60

Query: 54 VYDSLGNKMG-NALHALSIKTSVPD 77
          +Y      M    +HAL+I   VP 
Sbjct: 61 IYAVAAELMSPGKIHALAIHAYVPS 85


>gi|290997011|ref|XP_002681075.1| predicted protein [Naegleria gruberi]
 gi|284094698|gb|EFC48331.1| predicted protein [Naegleria gruberi]
          Length = 90

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 20 IVTIHDLAGD-GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          I+ ++D++G  G  +   ++S +F G++ ++QH+MV + L   +  ++H L+I T  P
Sbjct: 24 IIRVNDISGGCGAMFDILVVSNKFEGQSLVKQHKMVMEILKKDI-QSMHGLTINTKTP 80


>gi|47214503|emb|CAG00927.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 112

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 29/46 (63%)

Query: 28  GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
           G  +H+   ++S +F G   I+ H++V ++L  ++ + +HAL+I+ 
Sbjct: 64  GSESHFRVLVVSSQFEGLPLIKCHRLVNEALKEELSSCVHALAIQA 109


>gi|33519527|ref|NP_878359.1| hypothetical protein Bfl045 [Candidatus Blochmannia floridanus]
 gi|33517190|emb|CAD83572.1| BolA-like protein; transcription regulator activity [Candidatus
          Blochmannia floridanus]
          Length = 84

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 44/75 (58%), Gaps = 4/75 (5%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          M   EI+K++ K +  S+  I+ +  D +HY   ++ + F  K++++QH+MVY  +   +
Sbjct: 1  MYADEIKKILSKNL--SLQEIY-VFVDQDHYKIIVVDQIFVDKSKLEQHKMVYAPITKYI 57

Query: 63 -GNALHALSIKTSVP 76
            N +H++SI +  P
Sbjct: 58 VDNKIHSISIYSFNP 72


>gi|322834048|ref|YP_004214075.1| BolA family protein [Rahnella sp. Y9602]
 gi|321169249|gb|ADW74948.1| BolA family protein [Rahnella sp. Y9602]
          Length = 104

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 30/47 (63%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          AG  +H+   ++S++F G+  + +H+ +Y  L  ++  ++HAL++ T
Sbjct: 32 AGSESHFKVVMVSDKFIGERFLARHRAIYGRLTEELAGSVHALALHT 78


>gi|255292067|dbj|BAH90547.1| putative cell division protein BolA [uncultured bacterium]
          Length = 123

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 28/46 (60%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G   H+   ++S+ F G+  I +H+ V ++L +++   +HALS+ T
Sbjct: 51 GSETHFKVVLVSDAFDGQRLIARHRAVNEALADELAGGVHALSLHT 96


>gi|46105320|ref|XP_380464.1| hypothetical protein FG00288.1 [Gibberella zeae PH-1]
          Length = 120

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 3/58 (5%)

Query: 24 HDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG--NALHALSIKTSVPDSQ 79
          H  +G+  H+   I S+ F  K +  +H+MVY  L ++M   N +HAL ++T  P+ +
Sbjct: 42 HTTSGE-THFRVVITSDAFNSKMQPARHRMVYALLRDEMAQENGIHALQLRTMTPEEE 98


>gi|260799728|ref|XP_002594836.1| hypothetical protein BRAFLDRAFT_114943 [Branchiostoma floridae]
 gi|229280073|gb|EEN50847.1| hypothetical protein BRAFLDRAFT_114943 [Branchiostoma floridae]
          Length = 85

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 45/79 (56%), Gaps = 3/79 (3%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGD--GNHYAAEIISEEFRGKNRIQQHQMVYDSL 58
          MS+    I++ +++ +  + + + D + +  G+ +   I+S +F GK  +Q+H++V   L
Sbjct: 1  MSITAEYIKEKLQRELEATHIDVEDTSPNHCGSAFNVTIVSAKFEGKPLLQRHRLVNACL 60

Query: 59 GNKMGNALHALSIKTSVPD 77
            ++ + +HA S KT  P+
Sbjct: 61 EEELKD-IHAFSQKTLTPE 78


>gi|189241522|ref|XP_001809489.1| PREDICTED: similar to BolA protein, putative [Tribolium
          castaneum]
          Length = 109

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
          G   H+   ++SE+F     I++H++V D L  ++ + +HALSI    P 
Sbjct: 39 GAETHFKVVVVSEKFSDLPLIKRHRLVNDILKEELQSGVHALSIVAKTPS 88


>gi|91223430|ref|ZP_01258695.1| cell division protein BolA [Vibrio alginolyticus 12G01]
 gi|262393479|ref|YP_003285333.1| cell division protein BolA [Vibrio sp. Ex25]
 gi|269966213|ref|ZP_06180302.1| BolA protein [Vibrio alginolyticus 40B]
 gi|3023402|sp|Q56585|BOLA_VIBAL RecName: Full=Protein BolA homolog
 gi|663269|emb|CAA85475.1| BolA [Vibrio alginolyticus]
 gi|91191516|gb|EAS77780.1| cell division protein BolA [Vibrio alginolyticus 12G01]
 gi|262337073|gb|ACY50868.1| cell division protein BolA [Vibrio sp. Ex25]
 gi|269829128|gb|EEZ83373.1| BolA protein [Vibrio alginolyticus 40B]
 gi|1092975|prf||2102277A bolA gene
          Length = 102

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 29/46 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   ++S+ F G+  I +H+ V+  L +++ N +HAL+I T
Sbjct: 33 GSESHFKVIVVSDSFAGQRLIGRHRQVHQILADELDNHIHALAIHT 78


>gi|307546430|ref|YP_003898909.1| BolA protein [Halomonas elongata DSM 2581]
 gi|307218454|emb|CBV43724.1| K05527 BolA protein [Halomonas elongata DSM 2581]
          Length = 103

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/47 (25%), Positives = 26/47 (55%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPD 77
           H+   ++S  F G   +++HQ +Y  L +++   +HAL++    P+
Sbjct: 36 THFKVTLVSSRFEGMMPVKRHQQIYALLADELAGPVHALALHPYTPE 82


>gi|260772191|ref|ZP_05881107.1| cell division protein BolA [Vibrio metschnikovii CIP 69.14]
 gi|260611330|gb|EEX36533.1| cell division protein BolA [Vibrio metschnikovii CIP 69.14]
          Length = 106

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 30/50 (60%)

Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          AG  +H+   I+S+ F  +  I +H+ V   L +++ +++HAL+I T  P
Sbjct: 32 AGSESHFKVIIVSDTFVEQRLITRHRQVNQVLKDELAHSIHALAIHTYTP 81


>gi|308485850|ref|XP_003105123.1| hypothetical protein CRE_20733 [Caenorhabditis remanei]
 gi|308257068|gb|EFP01021.1| hypothetical protein CRE_20733 [Caenorhabditis remanei]
          Length = 106

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 45/75 (60%), Gaps = 3/75 (4%)

Query: 1   MSMNPHEIEKMIKKGIP-QSIVTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSL 58
           MS    ++ K++ + I   S V +HD++ G G+ +   + +  F+GK+++ QH++V   L
Sbjct: 30  MSEAEQKMSKLLTEKIEGCSRVEVHDVSNGCGSMFDVVVEASSFQGKSKVAQHKIVTSIL 89

Query: 59  GNKMGNALHALSIKT 73
             ++  ++H L+IKT
Sbjct: 90  KEQI-KSMHGLTIKT 103


>gi|313667750|ref|YP_004048034.1| hypothetical protein NLA_4050 [Neisseria lactamica ST-640]
 gi|313005212|emb|CBN86645.1| conserved hypothetical protein [Neisseria lactamica 020-06]
          Length = 92

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA-LHALSIKTSVPD 77
          G HYA  ++S  F G +R+ + + V   L +   +  +HAL I+ + PD
Sbjct: 37 GGHYAVLVVSRHFEGASRLNRQKTVKSLLKDLFSDGIIHALGIRAAAPD 85


>gi|222087376|ref|YP_002545913.1| BolA-like protein [Agrobacterium radiobacter K84]
 gi|221724824|gb|ACM27980.1| BolA-like protein [Agrobacterium radiobacter K84]
          Length = 95

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 25 DLAGDG-NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          D+ G G  H    I+S +F G  R+ +H+ + + L  ++   LHAL+++ + P
Sbjct: 37 DMTGTGETHIRVRIVSAKFAGMPRLARHRAINELLKPELDAGLHALAVEPAAP 89


>gi|226952224|ref|ZP_03822688.1| morphogenic pathway activator (BolA) [Acinetobacter sp. ATCC
          27244]
 gi|226837062|gb|EEH69445.1| morphogenic pathway activator (BolA) [Acinetobacter sp. ATCC
          27244]
          Length = 102

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 8/69 (11%)

Query: 17 PQSIVTIHDLAGDG-------NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMG-NALHA 68
          P  +  I++ AG G       +H+   ++SE F+G   +Q+HQ +Y      M    +HA
Sbjct: 16 PSHLEVINESAGHGGYFPGKESHFKVIVVSEAFQGLRLVQRHQKIYAVAAELMSPGKIHA 75

Query: 69 LSIKTSVPD 77
          L+I   VP 
Sbjct: 76 LAIHAYVPS 84


>gi|323448481|gb|EGB04379.1| hypothetical protein AURANDRAFT_9414 [Aureococcus
          anophagefferens]
          Length = 75

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 21 VTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
          V + DL+ G G      I+S +F G   ++QH++V D+  +++ +A+HA ++KT  P
Sbjct: 17 VAVEDLSDGCGAKLKITIVSAKFEGLPLLKQHRLVNDAAKDEL-SAVHAFNLKTFTP 72


>gi|309378644|emb|CBX22715.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 92

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA-LHALSIKTSVPD 77
          G HYA  ++S  F G +R+ + + V   L +   +  +HAL I+ + PD
Sbjct: 37 GGHYAVLVVSRHFEGASRLNRQKTVKSLLKDLFSDGIIHALGIRAAAPD 85


>gi|332800309|ref|YP_004461808.1| hypothetical protein TepRe1_2399 [Tepidanaerobacter sp. Re1]
 gi|332698044|gb|AEE92501.1| hypothetical protein TepRe1_2399 [Tepidanaerobacter sp. Re1]
          Length = 622

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 11/73 (15%)

Query: 8   IEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQH---------QMVYDSL 58
           ++K +  GI  + VT HD  GDGN  + +I +E + G N +  +          +V D+ 
Sbjct: 342 VQKTLTSGIVAAAVTSHDKDGDGNDESVKINTENYDGSNSVMPNGKYTITLPANLVADAA 401

Query: 59  GNKMGNALHALSI 71
           GN   NAL  +++
Sbjct: 402 GNT--NALTTINV 412


>gi|269960528|ref|ZP_06174900.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269834605|gb|EEZ88692.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 102

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 29/46 (63%)

Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
          G  +H+   ++S+ F G+  I +H+ V+  L +++ N +HAL+I T
Sbjct: 33 GSESHFKVIVVSDAFAGQRLIGRHRQVHTVLADELDNHIHALAIHT 78


>gi|261401821|ref|ZP_05987946.1| BolA family protein [Neisseria lactamica ATCC 23970]
 gi|269208028|gb|EEZ74483.1| BolA family protein [Neisseria lactamica ATCC 23970]
          Length = 92

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 30 GNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA-LHALSIKTSVPD 77
          G HYA  ++S  F G +R+ + + V   L +   +  +HAL I+ + PD
Sbjct: 37 GGHYAVLVVSRHFEGASRLNRQKTVKSLLKDLFSDGIIHALGIRAAAPD 85


>gi|119476397|ref|ZP_01616748.1| BolA-like protein [marine gamma proteobacterium HTCC2143]
 gi|119450261|gb|EAW31496.1| BolA-like protein [marine gamma proteobacterium HTCC2143]
          Length = 107

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 25/43 (58%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73
           H+   +++  F GK  + +HQM+Y  L  ++   +HAL++ T
Sbjct: 41 THFNVVVVAAIFDGKRSVARHQMIYKLLAEEIAGPVHALALHT 83


>gi|157376565|ref|YP_001475165.1| BolA family protein [Shewanella sediminis HAW-EB3]
 gi|157318939|gb|ABV38037.1| BolA family protein [Shewanella sediminis HAW-EB3]
          Length = 99

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 24/46 (52%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVP 76
           H+   I    F GK  + +H+ V ++L  +  N LHALS+ T  P
Sbjct: 37 THFKVIITCGSFEGKRLLARHRAVNEALVTEFANGLHALSMHTFTP 82


>gi|170038839|ref|XP_001847255.1| bolA [Culex quinquefasciatus]
 gi|167862446|gb|EDS25