RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780969|ref|YP_003065382.1| hypothetical protein CLIBASIA_04350 [Candidatus Liberibacter asiaticus str. psy62] (79 letters) >gnl|CDD|145069 pfam01722, BolA, BolA-like protein. This family consist of the morphoprotein BolA from E. coli and its various homologues. In E. coli over expression of this protein causes round morphology and may be involved in switching the cell between elongation and septation systems during cell division. The expression of BolA is growth rate regulated and is induced during the transition into the the stationary phase. BolA is also induced by stress during early stages of growth and may have a general role in stress response. It has also been suggested that BolA can induce the transcription of penicillin binding proteins 6 and 5. Length = 72 Score = 78.0 bits (193), Expect = 6e-16 Identities = 22/70 (31%), Positives = 45/70 (64%), Gaps = 2/70 (2%) Query: 10 KMIKKGIPQSIVTIHDL--AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALH 67 K++ +P + + + D G G+H+ ++S+ F GK+ +++H++VY +L ++ + +H Sbjct: 1 KLLTAALPPAHLEVEDESHKGGGSHFKVVVVSDAFEGKSLVKRHRLVYAALKEELASGIH 60 Query: 68 ALSIKTSVPD 77 ALSIKT P+ Sbjct: 61 ALSIKTYTPE 70 >gnl|CDD|30620 COG0271, BolA, Stress-induced morphogen (activity unknown) [Signal transduction mechanisms]. Length = 90 Score = 73.1 bits (179), Expect = 2e-14 Identities = 27/85 (31%), Positives = 49/85 (57%), Gaps = 8/85 (9%) Query: 1 MSMNPHEIEKMIKKGIPQSIVTIHDLA--------GDGNHYAAEIISEEFRGKNRIQQHQ 52 MS+ IEK ++ P S + I D + G G+H+ I+SE F+GK+ + +H+ Sbjct: 1 MSIQRERIEKKLRAAFPPSFLEIIDESHRHHGHAGGGGSHFKVVIVSEAFQGKSLVARHR 60 Query: 53 MVYDSLGNKMGNALHALSIKTSVPD 77 +VY +L +++ +HAL++ T P+ Sbjct: 61 LVYSALKDELSGGIHALALHTYTPE 85 >gnl|CDD|34612 COG5007, COG5007, Predicted transcriptional regulator, BolA superfamily [Transcription]. Length = 80 Score = 71.5 bits (175), Expect = 5e-14 Identities = 29/76 (38%), Positives = 47/76 (61%), Gaps = 4/76 (5%) Query: 3 MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62 M+ EI+ +++ +P V ++ GDG+H+ +SEEF GK+R+++ Q+VY L + Sbjct: 1 MDNEEIKSLLENALPLEEV---EVEGDGSHFQVIAVSEEFAGKSRVKRQQLVYAPLMAYI 57 Query: 63 G-NALHALSIKTSVPD 77 N +HALSIKT P Sbjct: 58 ADNEIHALSIKTYTPA 73 >gnl|CDD|38558 KOG3348, KOG3348, KOG3348, BolA (bacterial stress-induced morphogen)-related protein [Signal transduction mechanisms]. Length = 85 Score = 52.3 bits (125), Expect = 3e-08 Identities = 21/78 (26%), Positives = 45/78 (57%), Gaps = 2/78 (2%) Query: 1 MSMNPHEIEKMIKKGIPQSIVTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59 M++ +E+++ + + V + D++ G G+ + I+S F GK+ + +H++V L Sbjct: 1 MTVTEERLEELLTEALEPEHVEVQDVSGGCGSMFDVVIVSAAFEGKSLLARHRLVNSILA 60 Query: 60 NKMGNALHALSIKTSVPD 77 ++ +HAL+IKT P+ Sbjct: 61 EEIKE-IHALTIKTYTPE 77 >gnl|CDD|37524 KOG2313, KOG2313, KOG2313, Stress-induced protein UVI31+ [Signal transduction mechanisms]. Length = 100 Score = 47.4 bits (112), Expect = 9e-07 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Query: 28 GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNA-LHALSIKTSVPD 77 G H+ E++S F G + +++H++VY +L ++ +HALSI P Sbjct: 48 GAETHFRVEVVSSAFEGLSLVKRHRLVYKALKEELAGTGVHALSIMAKTPS 98 >gnl|CDD|146985 pfam04607, RelA_SpoT, Region found in RelA / SpoT proteins. This region of unknown function is found in RelA and SpoT of Escherichia coli, and their homologues in plants and in other eubacteria. RelA is a guanosine 3',5'-bis-pyrophosphate (ppGpp) synthetase (EC:2.7.6.5) while SpoT is thought to be a bifunctional enzyme catalysing both ppGpp synthesis and degradation (ppGpp 3'-pyrophosphohydrolase, (EC:3.1.7.2)). This region is often found in association with HD (pfam01966), a metal-dependent phosphohydrolase, TGS (pfam02824) which is a possible nucleotide-binding region, and the ACT regulatory domain (pfam01842). Length = 111 Score = 26.0 bits (58), Expect = 2.4 Identities = 10/23 (43%), Positives = 11/23 (47%), Gaps = 2/23 (8%) Query: 6 HEIEKMIKKGIPQSIVTIHDLAG 28 EKM +KGI I DL G Sbjct: 8 SIYEKMRRKGIAFE--EITDLIG 28 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.314 0.130 0.364 Gapped Lambda K H 0.267 0.0790 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 904,100 Number of extensions: 37122 Number of successful extensions: 79 Number of sequences better than 10.0: 1 Number of HSP's gapped: 76 Number of HSP's successfully gapped: 11 Length of query: 79 Length of database: 6,263,737 Length adjustment: 49 Effective length of query: 30 Effective length of database: 5,204,896 Effective search space: 156146880 Effective search space used: 156146880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 51 (23.3 bits)