RPSBLAST alignment of GI: 254780969 and MMDB domain: 1v9j_A_

>1v9j_A (A:) BOLA-like protein riken cDNA 1110025L05; stationary phase morphogene, stress-induced morphogene, structural genomics; NMR {Mus musculus}Length = 113
 Score = 75.3 bits (185), Expect = 2e-15
 Identities = 17/79 (21%), Positives = 40/79 (50%), Gaps = 3/79 (3%)

Query: 1   MSMNPHEIEKMIKKGIPQSIVTIHD--LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSL 58
           M ++   + + +++ +    V + D  L      +   ++S +F GK  +Q+H++V + L
Sbjct: 28  MELSADYLREKLRQDLEAEHVEVEDTTLNRCATSFRVLVVSAKFEGKPLLQRHRLVNECL 87

Query: 59  GNKMGNALHALSIKTSVPD 77
             ++ + +HA   KT  P+
Sbjct: 88  AEELPH-IHAFEQKTLTPE 105