RPSBLAST alignment of GI: 254780969 and MMDB domain: 1xs3_A_

>1xs3_A (A:) Hypothetical protein XC975; BOLA-like, structural genomics, AN integrated structural and functional genomic project, unknown function; NMR {Synthetic}Length = 80
 Score = 81.7 bits (202), Expect = 3e-17
 Identities = 30/77 (38%), Positives = 47/77 (61%), Gaps = 2/77 (2%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
            ++   I K+I+ G+P++ V +     DG H+ A ++S  F GK  + +H+MVY +LG 
Sbjct: 4  RPLDAETIRKLIESGLPEARVDVQG--EDGVHFEATVVSPAFVGKAPLARHRMVYATLGE 61

Query: 61 KMGNALHALSIKTSVPD 77
           MG A+HAL +KT  PD
Sbjct: 62 LMGGAIHALQLKTLTPD 78