RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780969|ref|YP_003065382.1| hypothetical protein CLIBASIA_04350 [Candidatus Liberibacter asiaticus str. psy62] (79 letters) >1xs3_A Hypothetical protein XC975; BOLA-like, structural genomics, AN integrated structural and functional genomic project, unknown function; NMR {Synthetic} (A:) Length = 80 Score = 81.7 bits (202), Expect = 3e-17 Identities = 30/77 (38%), Positives = 47/77 (61%), Gaps = 2/77 (2%) Query: 1 MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60 ++ I K+I+ G+P++ V + DG H+ A ++S F GK + +H+MVY +LG Sbjct: 4 RPLDAETIRKLIESGLPEARVDVQG--EDGVHFEATVVSPAFVGKAPLARHRMVYATLGE 61 Query: 61 KMGNALHALSIKTSVPD 77 MG A+HAL +KT PD Sbjct: 62 LMGGAIHALQLKTLTPD 78 >1v60_A BOLA1, riken cDNA 1810037G04; stationary phase morphogene, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} (A:) Length = 123 Score = 78.8 bits (194), Expect = 3e-16 Identities = 16/84 (19%), Positives = 40/84 (47%), Gaps = 7/84 (8%) Query: 1 MSMNPHEIEKMIKKGIPQSIVTIHDL-------AGDGNHYAAEIISEEFRGKNRIQQHQM 53 I +++ + ++ + + AG H+ ++S F G + +Q+H++ Sbjct: 24 AGPVEAAIRAKLEQALSPEVLELRNESGGHAVPAGSETHFRVAVVSSRFEGMSPLQRHRL 83 Query: 54 VYDSLGNKMGNALHALSIKTSVPD 77 V+++L ++ +HAL+I+ P Sbjct: 84 VHEALSEELAGPVHALAIQAKTPA 107 >2dhm_A Protein BOLA; stationary-phase, stress-induced, morphogene, structural genomics, NPPSFA; NMR {Escherichia coli str} (A:) Length = 107 Score = 78.7 bits (194), Expect = 3e-16 Identities = 18/82 (21%), Positives = 39/82 (47%), Gaps = 7/82 (8%) Query: 3 MNPHEIEKMIKKGIPQSIVTIHD-------LAGDGNHYAAEIISEEFRGKNRIQQHQMVY 55 M IE+ ++ + + D AG +H+ ++S+ F G+ + +H+M+Y Sbjct: 9 MIRERIEEKLRAAFQPVFLEVVDESYRHNVPAGSESHFKVVLVSDRFTGERFLNRHRMIY 68 Query: 56 DSLGNKMGNALHALSIKTSVPD 77 +L ++ +HAL++ T Sbjct: 69 STLAEELSTTVHALALHTYTIK 90 >2kdn_A Putative uncharacterized protein PFE0790C; solution structure, ssgcid, seattle structural genomics center for infectious disease; NMR {Plasmodium falciparum} (A:) Length = 108 Score = 76.8 bits (189), Expect = 9e-16 Identities = 19/78 (24%), Positives = 34/78 (43%), Gaps = 2/78 (2%) Query: 1 MSMNPHEIEKMIKKGIPQSIVTIHDL-AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLG 59 IE + + + + + D G G + A I+S F K + +H++V L Sbjct: 22 HMCIQKVIEDKLSSALKPTFLELVDKSCGCGTSFDAVIVSNNFEDKKLLDRHRLVNTILK 81 Query: 60 NKMGNALHALSIKTSVPD 77 ++ N +HA S+K P Sbjct: 82 EELQN-IHAFSMKCHTPL 98 >1ny8_A Protein YRBA; structure, autoassign, autostructure, NESG, structural genomics, PSI, protein structure initiative; NMR {Escherichia coli} (A:) Length = 97 Score = 76.0 bits (187), Expect = 2e-15 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 4/78 (5%) Query: 1 MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60 M +EI+ ++ + V + GDG+H+ + E F G +R+++ Q VY L Sbjct: 4 DPMENNEIQSVLMNALSLQEVHVS---GDGSHFQVIAVGELFDGMSRVKKQQTVYGPLME 60 Query: 61 KMG-NALHALSIKTSVPD 77 + N +HA+SIK P Sbjct: 61 YIADNRIHAVSIKAYTPA 78 >1v9j_A BOLA-like protein riken cDNA 1110025L05; stationary phase morphogene, stress-induced morphogene, structural genomics; NMR {Mus musculus} (A:) Length = 113 Score = 75.3 bits (185), Expect = 2e-15 Identities = 17/79 (21%), Positives = 40/79 (50%), Gaps = 3/79 (3%) Query: 1 MSMNPHEIEKMIKKGIPQSIVTIHD--LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSL 58 M ++ + + +++ + V + D L + ++S +F GK +Q+H++V + L Sbjct: 28 MELSADYLREKLRQDLEAEHVEVEDTTLNRCATSFRVLVVSAKFEGKPLLQRHRLVNECL 87 Query: 59 GNKMGNALHALSIKTSVPD 77 ++ + +HA KT P+ Sbjct: 88 AEELPH-IHAFEQKTLTPE 105 >1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} (A:230-311) Length = 82 Score = 24.3 bits (53), Expect = 6.5 Identities = 7/41 (17%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Query: 1 MSMNPHEIEKMI---KKGIPQSIVTIHDLAGDGNHYAAEII 38 ++ EI+ +I K+ +++ G+ A +I+ Sbjct: 6 YGVDREEIKILINNLKRDYTIKEFLVNEFQSIGDTTADKIL 46 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.314 0.130 0.364 Gapped Lambda K H 0.267 0.0634 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 580,725 Number of extensions: 21765 Number of successful extensions: 80 Number of sequences better than 10.0: 1 Number of HSP's gapped: 73 Number of HSP's successfully gapped: 15 Length of query: 79 Length of database: 4,956,049 Length adjustment: 44 Effective length of query: 35 Effective length of database: 3,468,629 Effective search space: 121402015 Effective search space used: 121402015 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.2 bits)