BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780969|ref|YP_003065382.1| hypothetical protein CLIBASIA_04350 [Candidatus Liberibacter asiaticus str. psy62] (79 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780969|ref|YP_003065382.1| hypothetical protein CLIBASIA_04350 [Candidatus Liberibacter asiaticus str. psy62] Length = 79 Score = 164 bits (415), Expect = 3e-43, Method: Compositional matrix adjust. Identities = 79/79 (100%), Positives = 79/79 (100%) Query: 1 MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60 MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN Sbjct: 1 MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60 Query: 61 KMGNALHALSIKTSVPDSQ 79 KMGNALHALSIKTSVPDSQ Sbjct: 61 KMGNALHALSIKTSVPDSQ 79 >gi|254780586|ref|YP_003064999.1| BolA family protein [Candidatus Liberibacter asiaticus str. psy62] Length = 101 Score = 37.0 bits (84), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 17/49 (34%), Positives = 28/49 (57%) Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79 H +I+S F G ++ +H+ +YD L ++ LHALSI+ PD + Sbjct: 47 THIRIKIVSPTFTGISKTFRHRKIYDLLHKEIKEELHALSIEAFSPDEK 95 >gi|254780512|ref|YP_003064925.1| flagellar biosynthesis protein FlhA [Candidatus Liberibacter asiaticus str. psy62] Length = 692 Score = 22.3 bits (46), Expect = 1.4, Method: Composition-based stats. Identities = 9/21 (42%), Positives = 15/21 (71%) Query: 6 HEIEKMIKKGIPQSIVTIHDL 26 + I + I KGIP +IVT+ ++ Sbjct: 636 NSIRQYIDKGIPLTIVTLPEI 656 >gi|254780648|ref|YP_003065061.1| GTPase ObgE [Candidatus Liberibacter asiaticus str. psy62] Length = 335 Score = 21.9 bits (45), Expect = 2.0, Method: Compositional matrix adjust. Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 5 PHEIEKMIKKGIPQSIVTIHD 25 P E + GIPQ + +HD Sbjct: 304 PFEFSSITGHGIPQILECLHD 324 >gi|254780413|ref|YP_003064826.1| PAS/PAC sensor signal transduction histidine kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Score = 21.2 bits (43), Expect = 3.2, Method: Compositional matrix adjust. Identities = 10/38 (26%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Query: 6 HEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFR 43 + +E +++K P ++ + NHY EI+S + R Sbjct: 487 YPVEDILRK--PFTVFLEQNTPSVMNHYLTEILSLDLR 522 >gi|254780384|ref|YP_003064797.1| serralysin [Candidatus Liberibacter asiaticus str. psy62] Length = 665 Score = 20.0 bits (40), Expect = 7.2, Method: Composition-based stats. Identities = 7/15 (46%), Positives = 11/15 (73%) Query: 25 DLAGDGNHYAAEIIS 39 D GDGN+Y +++ S Sbjct: 642 DYFGDGNYYDSDLYS 656 >gi|254780158|ref|YP_003064571.1| phosphoribosylaminoimidazole carboxylase ATPase subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 354 Score = 20.0 bits (40), Expect = 8.2, Method: Compositional matrix adjust. Identities = 7/21 (33%), Positives = 13/21 (61%) Query: 42 FRGKNRIQQHQMVYDSLGNKM 62 F+GK ++ ++ YD G K+ Sbjct: 135 FKGKGILKTRRLGYDGKGQKV 155 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.314 0.130 0.364 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,980 Number of Sequences: 1233 Number of extensions: 1743 Number of successful extensions: 9 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of query: 79 length of database: 328,796 effective HSP length: 49 effective length of query: 30 effective length of database: 268,379 effective search space: 8051370 effective search space used: 8051370 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.6 bits) S2: 31 (16.5 bits)