RPSBLAST alignment for GI: 254780971 and conserved domain: cd03134
>gnl|CDD|153228 cd03134, GATase1_PfpI_like, A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus. A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus. This group includes proteins similar to PfpI from P. furiosus. and PH1704 from Pyrococcus horikoshii. These enzymes are ATP-independent intracellular proteases and may hydrolyze small peptides to provide a nutritional source. Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. For PH1704, it is believed that this Cys together with a different His in one monomer and Glu (from an adjacent monomer) forms a different catalytic triad from the typical GATase1domain. PfpI is homooligomeric. Protease activity is only found for oligomeric forms of PH1704. Length = 165
Score = 42.9 bits (102), Expect = 7e-05
Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 8/67 (11%)
Query: 35 SDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKK-AQQGIKVMGICNGFQILV 93
+D D D D +VIPGG + D LR R P A + A+ G V IC+G +L+
Sbjct: 56 ADVDADDYDALVIPGGTN-PDKLR------RDPDAVAFVRAFAEAGKPVAAICHGPWVLI 108
Query: 94 ELNLLPG 100
++ G
Sbjct: 109 SAGVVRG 115