RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780971|ref|YP_003065384.1| phosphoribosylformylglycinamidine synthase subunit I [Candidatus Liberibacter asiaticus str. psy62] (219 letters) >gnl|CDD|30396 COG0047, PurL, Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism]. Length = 231 Score = 302 bits (775), Expect = 5e-83 Identities = 115/226 (50%), Positives = 143/226 (63%), Gaps = 9/226 (3%) Query: 1 MKTAIVQIPGLNRDNDMIKAITKIIGQSPILVWQSDTDIP-DVDLIVIPGGFSYGDYLRC 59 K A+++ PG N D DM A + G VW SD + D D +V+PGGFSYGDYLR Sbjct: 3 PKVAVLRFPGTNCDYDMAAAF-ERAGFEAEDVWHSDLLLGRDFDGVVLPGGFSYGDYLRA 61 Query: 60 GAIAARTPVMQAIKKKAQQGIKVMGICNGFQILVELNLLPGILMRNCSLKFVCKQVLLEV 119 GAIAA PVM +++ A++G V+GICNGFQIL E LLPG L RN SL+F C+ V L V Sbjct: 62 GAIAAIAPVMDEVREFAEKGKPVLGICNGFQILSEAGLLPGALTRNESLRFECRWVYLRV 121 Query: 120 VNSNTAFTKSYKMNQIIKCPVAHHDGNYFIDAKGLAEIEKNNQIVFRYASG-------TN 172 N+NT FT Y+ ++I PVAH +G Y+ D + LAE+E+N Q+VFRY N Sbjct: 122 ENNNTPFTSGYEGGEVIPIPVAHGEGRYYADDETLAELEENGQVVFRYVDNNGETEEYAN 181 Query: 173 PNGSLHDIAGVINRRGNVLGMMPHPENIIEKFHGGIDGRGLFASLL 218 PNGS++ IAG+ N GNVLGMMPHPE E GG DG LF S Sbjct: 182 PNGSVNGIAGITNEDGNVLGMMPHPERASESLLGGEDGLRLFRSAR 227 >gnl|CDD|153211 cd01740, GATase1_FGAR_AT, Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase. Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase (FGAR-AT). FGAR-AT catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to formylglycinamidine ribonucleotide (FGAM), ADP, Pi, and glutamate in the fourth step of the purine biosynthetic pathway. FGAR-AT is a glutamine amidotransferase. Glutamine amidotransferase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. FGAR-AT belongs to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site. Length = 238 Score = 264 bits (678), Expect = 1e-71 Identities = 110/239 (46%), Positives = 147/239 (61%), Gaps = 24/239 (10%) Query: 3 TAIVQIPGLNRDNDMIKAITKIIGQSPILVWQSDT-----DIPDVDLIVIPGGFSYGDYL 57 A+++ PG N D DM A G VW +D D+ D D +V+PGGFSYGDYL Sbjct: 1 VAVLRFPGSNCDRDMAYAFELA-GFEAEDVWHNDLLAGRKDLDDYDGVVLPGGFSYGDYL 59 Query: 58 RCGAIAARTP-VMQAIKKKAQQGIKVMGICNGFQILVELNLLPGILMRNCSLKFVCKQ-- 114 R GAIAA +P +M+ +K+ A++G V+GICNGFQILVEL LLPG L+RN LKF+C+ Sbjct: 60 RAGAIAAASPLLMEEVKEFAERGGLVLGICNGFQILVELGLLPGALIRNKGLKFICRWQN 119 Query: 115 --VLLEVVNSNTAFTKSYKMNQIIKCPVAHHDGNYFIDAKGLAEIEKNNQIV-FRYASGT 171 V L V N+++ FTK Y ++++ PVAH +G ++ D + LAE+E+N QI + G Sbjct: 120 RFVTLRVENNDSPFTKGYMEGEVLRIPVAHGEGRFYADDETLAELEENGQIAQYVDDDGN 179 Query: 172 -------NPNGSLHDIAGVINRRGNVLGMMPHPENIIE-----KFHGGIDGRGLFASLL 218 NPNGSL IAG+ N G VLGMMPHPE +E + GG DG LF + + Sbjct: 180 VTERYPANPNGSLDGIAGICNEDGRVLGMMPHPERAVEPWQWERLLGGSDGLKLFRNAV 238 >gnl|CDD|37118 KOG1907, KOG1907, KOG1907, Phosphoribosylformylglycinamidine synthase [Nucleotide transport and metabolism]. Length = 1320 Score = 92.3 bits (229), Expect = 9e-20 Identities = 60/226 (26%), Positives = 92/226 (40%), Gaps = 31/226 (13%) Query: 2 KTAIVQIPGLNRDNDMIKAITKIIGQSPILVWQSDTDIPDVDL-----IVIPGGFSYGDY 56 K AI++ G+N D +M A G + V +D L + GGFSY D Sbjct: 1060 KVAILREEGVNGDREMAAAFYAA-GFETVDVTMTDLLAGRHHLDDFRGLAFCGGFSYADV 1118 Query: 57 LRCGA-----IAARTPVMQAIKK-KAQQGIKVMGICNGFQILVELN-LLPGI-------L 102 L I V + +Q +GICNG Q++ L + P + L Sbjct: 1119 LGSAKGWAASILFNESVRSQFEAFFNRQDTFSLGICNGCQLMSRLGWIGPEVGKWPDVFL 1178 Query: 103 MRNCSLKFVCKQVLLEVVNSNTAFTKSYKMNQIIKCPVAHHDGN-YFIDAKGLAEIEKNN 161 N S +F C+ ++++ ++ + ++ VAH +G F + L ++K Sbjct: 1179 DHNESGRFECRFGMVKIESNVSIMLSGMA-GSVLGVWVAHGEGRATFRSEQNLEHLKKEG 1237 Query: 162 QIVFRYASGT---------NPNGSLHDIAGVINRRGNVLGMMPHPE 198 + RY NPNGS IAG+ + G L MMPHPE Sbjct: 1238 LVCIRYVDDYGNVTELYPFNPNGSPDGIAGICSPDGRHLAMMPHPE 1283 >gnl|CDD|153210 cd01653, GATase1, Type 1 glutamine amidotransferase (GATase1)-like domain. Type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to Class I glutamine amidotransferases, the intracellular PH1704 from Pyrococcus horikoshii, the C-terminal of the large catalase: Escherichia coli HP-II, Sinorhizobium meliloti Rm1021 ThuA. and, the A4 beta-galactosidase middle domain. The majority of proteins in this group have a reactive Cys found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. For Class I glutamine amidotransferases proteins which transfer ammonia from the amide side chain of glutamine to an acceptor substrate, this Cys forms a Cys-His-Glu catalytic triad in the active site. Glutamine amidotransferases activity can be found in a range of biosynthetic enzymes included in this cd: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase, anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. For Pyrococcus horikoshii PH1704, the Cys of the nucleophile elbow together with a different His and, a Glu from an adjacent monomer form a catalytic triad different from the typical GATase1 triad. The E. coli HP-II C-terminal domain, S. meliloti Rm1021 ThuA and the A4 beta-galactosidase middle domain lack the catalytic triad typical GATaseI domains. GATase1-like domains can occur either as single polypeptides, as in Class I glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase. Length = 115 Score = 52.6 bits (126), Expect = 8e-08 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 5/60 (8%) Query: 34 QSDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQILV 93 +SD D+ D D +++PGG D L ++ +++ A G ++GIC G Q+LV Sbjct: 39 ESDVDLDDYDGLILPGGPGTPDDLA-----RDEALLALLREAAAAGKPILGICLGAQLLV 93 >gnl|CDD|153222 cd03128, GAT_1, Type 1 glutamine amidotransferase (GATase1)-like domain. Type 1 glutamine amidotransferase (GATase1)-like domain. This group contains proteins similar to Class I glutamine amidotransferases, the intracellular PH1704 from Pyrococcus horikoshii, the C-terminal of the large catalase: Escherichia coli HP-II, Sinorhizobium meliloti Rm1021 ThuA, the A4 beta-galactosidase middle domain and peptidase E. The majority of proteins in this group have a reactive Cys found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. For Class I glutamine amidotransferases proteins which transfer ammonia from the amide side chain of glutamine to an acceptor substrate, this Cys forms a Cys-His-Glu catalytic triad in the active site. Glutamine amidotransferases activity can be found in a range of biosynthetic enzymes included in this cd: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase, anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase (CPSase), cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. For Pyrococcus horikoshii PH1704, the Cys of the nucleophile elbow together with a different His and, a Glu from an adjacent monomer form a catalytic triad different from the typical GATase1 triad. Peptidase E is believed to be a serine peptidase having a Ser-His-Glu catalytic triad which differs from the Cys-His-Glu catalytic triad of typical GATase1 domains, by having a Ser in place of the reactive Cys at the nucleophile elbow. The E. coli HP-II C-terminal domain, S. meliloti Rm1021 ThuA and the A4 beta-galactosidase middle domain lack the catalytic triad typical GATaseI domains. GATase1-like domains can occur either as single polypeptides, as in Class I glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase. Peptidase E has a circular permutation in the common core of a typical GTAse1 domain. Length = 92 Score = 50.7 bits (121), Expect = 3e-07 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 5/59 (8%) Query: 34 QSDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQIL 92 +SD D+ D D +++PGG D L ++ +++ A G V+GIC G Q+L Sbjct: 39 ESDVDLDDYDGLILPGGPGTPDDLA-----WDEALLALLREAAAAGKPVLGICLGAQLL 92 >gnl|CDD|153224 cd03130, GATase1_CobB, Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase. Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase. CobB plays a role in cobalamin biosythesis catalyzing the conversion of cobyrinic acid to cobyrinic acid a,c-diamide. CobB belongs to the triad family of amidotransferases. Two of the three residues of the catalytic triad that are involved in glutamine binding, hydrolysis and transfer of the resulting ammonia to the acceptor substrate in other triad aminodotransferases are conserved in CobB. Length = 198 Score = 47.2 bits (113), Expect = 4e-06 Identities = 17/67 (25%), Positives = 31/67 (46%), Gaps = 7/67 (10%) Query: 28 SPILVWQSDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICN 87 SP+ D ++PD D + + GG+ L ++A + ++I+ A+ G + C Sbjct: 31 SPL----KDEELPDADGLYLGGGYP---ELFAEELSANQSMRESIRAFAESGGPIYAECG 83 Query: 88 GFQILVE 94 G L E Sbjct: 84 GLMYLGE 90 >gnl|CDD|153221 cd01750, GATase1_CobQ, Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ). Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ). CobQ plays a role in cobalamin biosythesis. CobQ catalyses amidations at positions B, D, E, and G on adenosylcobyrinic A,C-diamide in the biosynthesis of cobalamin. CobQ belongs to the triad family of amidotransferases. Two of the three residues of the catalytic triad that are involved in glutamine binding, hydrolysis and transfer of the resulting ammonia to the acceptor substrate in other triad aminodotransferases are conserved in CobQ. Length = 194 Score = 46.9 bits (112), Expect = 4e-06 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 9/58 (15%) Query: 38 DIPDVDLIVIPGGFSYG---DYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQIL 92 + D DLI++PG +LR +A +AIK A+ G V+GIC G+Q+L Sbjct: 34 GLGDADLIILPGSKDTIQDLAWLRKRGLA------EAIKNYARAGGPVLGICGGYQML 85 >gnl|CDD|153219 cd01748, GATase1_IGP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS). Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS). IGPS incorporates ammonia derived from glutamine into N1-[(5'-phosphoribulosyl)-formimino]-5-aminoimidazole-4- carboxamide ribonucleotide (PRFAR) to form 5'-(5-aminoimidazole-4-carboxamide) ribonucleotide (AICAR) and imidazole glycerol phosphate (IGP). The glutamine amidotransferase domain generates the ammonia nucleophile which is channeled from the glutaminase active site to the PRFAR active site. IGPS belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site. Length = 198 Score = 44.0 bits (105), Expect = 3e-05 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 15/96 (15%) Query: 19 KAITKIIGQSPILVWQSDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQ 78 A+ ++ G I+ +I D +++PG ++GD A +++A+K+ Sbjct: 16 NALERL-GAEVIIT-SDPEEILSADKLILPGVGAFGD---AMANLRERGLIEALKEAIAS 70 Query: 79 GIKVMGICNGFQILVE----------LNLLPGILMR 104 G +GIC G Q+L E L L+PG ++R Sbjct: 71 GKPFLGICLGMQLLFESSEEGGGTKGLGLIPGKVVR 106 >gnl|CDD|153228 cd03134, GATase1_PfpI_like, A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus. A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus. This group includes proteins similar to PfpI from P. furiosus. and PH1704 from Pyrococcus horikoshii. These enzymes are ATP-independent intracellular proteases and may hydrolyze small peptides to provide a nutritional source. Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. For PH1704, it is believed that this Cys together with a different His in one monomer and Glu (from an adjacent monomer) forms a different catalytic triad from the typical GATase1domain. PfpI is homooligomeric. Protease activity is only found for oligomeric forms of PH1704. Length = 165 Score = 42.9 bits (102), Expect = 7e-05 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 8/67 (11%) Query: 35 SDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKK-AQQGIKVMGICNGFQILV 93 +D D D D +VIPGG + D LR R P A + A+ G V IC+G +L+ Sbjct: 56 ADVDADDYDALVIPGGTN-PDKLR------RDPDAVAFVRAFAEAGKPVAAICHGPWVLI 108 Query: 94 ELNLLPG 100 ++ G Sbjct: 109 SAGVVRG 115 >gnl|CDD|31681 COG1492, CobQ, Cobyric acid synthase [Coenzyme metabolism]. Length = 486 Score = 42.5 bits (100), Expect = 1e-04 Identities = 20/61 (32%), Positives = 34/61 (55%), Gaps = 9/61 (14%) Query: 35 SDTDIPDVDLIVIPGGFS-YGD--YLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQI 91 +D+ D DL+++PG + D LR G + + I + A++G V+GIC G+Q+ Sbjct: 284 PGSDLRDADLVILPGSKNTIADLKILREGGMD------EKILEYARKGGDVIGICGGYQM 337 Query: 92 L 92 L Sbjct: 338 L 338 >gnl|CDD|30659 COG0311, PDX2, Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism]. Length = 194 Score = 42.1 bits (99), Expect = 1e-04 Identities = 44/208 (21%), Positives = 80/208 (38%), Gaps = 43/208 (20%) Query: 1 MKTAIVQIPGLNRDNDMIKAITKIIGQSPILVWQSDTDIPDVDLIVIPGGFSYGDYLRCG 60 MK ++ + G ++ ++A+ K G + V + + D+ VD ++IPGG S G Sbjct: 1 MKIGVLALQGAVEEH--LEALEKAGGAEVVEVKRPE-DLEGVDGLIIPGGES----TTIG 53 Query: 61 AIAARTPVMQAIKKKAQQGIKVMGICNGFQILVELNLLPGILMRNCSLKFVCKQVLLEV- 119 + R +++ +++ G+ V G C G IL+ +L G +Q LL + Sbjct: 54 RLLKRYGLLEPLREFIADGLPVFGTCAGL-ILLAKEILDGP-----------EQPLLGLL 101 Query: 120 ---VNSNT------AFTKSYKMNQIIKCPVAHHDGNYFIDAKGLAEIEKNNQIVFRYASG 170 V N +F + FI A + E+ +++ Sbjct: 102 DVTVRRNAFGRQVDSFETELDIEGFGLPFPFP---AVFIRAPVIEEVGDGVEVLATLD-- 156 Query: 171 TNPNGSLHDIAGVINRRGNVLGMMPHPE 198 I V ++GN+L HPE Sbjct: 157 -------GRIVAV--KQGNILATSFHPE 175 >gnl|CDD|30467 COG0118, HisH, Glutamine amidotransferase [Amino acid transport and metabolism]. Length = 204 Score = 41.3 bits (97), Expect = 2e-04 Identities = 23/90 (25%), Positives = 43/90 (47%), Gaps = 14/90 (15%) Query: 25 IGQSPILVWQSDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMG 84 +G ++ + +I D +++PG ++G A +++AIK+ + G +G Sbjct: 24 LGAEVVVSRDPE-EILKADKLILPGVGAFGA---AMANLRERGLIEAIKEAVESGKPFLG 79 Query: 85 ICNGFQILVE----------LNLLPGILMR 104 IC G Q+L E L L+PG ++R Sbjct: 80 ICLGMQLLFERSEEGGGVKGLGLIPGKVVR 109 >gnl|CDD|153230 cd03136, GATase1_AraC_ArgR_like, AraC transcriptional regulators having an N-terminal Type 1 glutamine amidotransferase (GATase1)-like domain. A subgroup of AraC transcriptional regulators having an N-terminal Type 1 glutamine amidotransferase (GATase1)-like domain. This group contains proteins similar to the Pseudomonas aeruginosa ArgR regulator. ArgR functions in the control of expression of certain genes of arginine biosynthesis and catabolism. AraC regulators are defined by a AraC-type helix-turn-helix DNA binding domain at their C-terminal. AraC family transcriptional regulators are widespread among bacteria and are involved in regulating diverse and important biological functions, including carbon metabolism, stress responses and virulence in different microorganisms. The catalytic triad typical of GATase1 domains is not conserved in this GATase1-like domain. However, in common with typical GATase1domains a reactive cys residue is found in some sequences in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. Length = 185 Score = 41.0 bits (97), Expect = 3e-04 Identities = 16/80 (20%), Positives = 33/80 (41%), Gaps = 10/80 (12%) Query: 29 PILVWQSDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNG 88 + + D P +D + + GG A ++ +++ A++G+ + GI G Sbjct: 52 RVAPDAALEDAPPLDYLFVVGGLG-------ARRAVTPALLAWLRRAARRGVALGGIDTG 104 Query: 89 FQILVELNLLPGILMRNCSL 108 +L LL G R ++ Sbjct: 105 AFLLARAGLLDG---RRATV 121 >gnl|CDD|31982 COG1797, CobB, Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism]. Length = 451 Score = 40.6 bits (95), Expect = 3e-04 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 8/68 (11%) Query: 28 SPILVWQSDTDIP-DVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGIC 86 SP+ +D ++P DVD + + GG+ L ++A + +AIK A G + C Sbjct: 278 SPL----ADEELPPDVDAVYLGGGYPE---LFAEELSANESMRRAIKAFAAAGKPIYAEC 330 Query: 87 NGFQILVE 94 G L E Sbjct: 331 GGLMYLGE 338 >gnl|CDD|145245 pfam01965, DJ-1_PfpI, DJ-1/PfpI family. The family includes the protease PfpI. This domain is also found in transcriptional regulators. Length = 141 Score = 40.0 bits (94), Expect = 5e-04 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 5/66 (7%) Query: 35 SDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQILVE 94 D + D D +VIPGG + + LR +++ +K+ + G + IC+G +L Sbjct: 28 DDVNADDYDALVIPGGHAAAEDLR-----DDEKLVKFVKEFYEAGKPIAAICHGPVLLAA 82 Query: 95 LNLLPG 100 LL G Sbjct: 83 AGLLKG 88 >gnl|CDD|143892 pfam00117, GATase, Glutamine amidotransferase class-I. Length = 187 Score = 39.6 bits (93), Expect = 6e-04 Identities = 17/75 (22%), Positives = 30/75 (40%), Gaps = 13/75 (17%) Query: 25 IGQSPILVWQSDTD-----IPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQG 79 +G +V + + D I+I G G+ ++AIK+ + Sbjct: 20 LGVEVEVVPNDTPAEEILELLNPDGIIISPGP--------GSPGDAGGAIEAIKELRENK 71 Query: 80 IKVMGICNGFQILVE 94 I ++GIC G Q+L Sbjct: 72 IPILGICLGHQLLAL 86 >gnl|CDD|35842 KOG0623, KOG0623, KOG0623, Glutamine amidotransferase/cyclase [Amino acid transport and metabolism]. Length = 541 Score = 38.5 bits (89), Expect = 0.001 Identities = 41/188 (21%), Positives = 76/188 (40%), Gaps = 32/188 (17%) Query: 34 QSDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQILV 93 Q+ DI + D ++ PG ++G + + RT + ++K + G MGIC G Q L Sbjct: 32 QTPGDILNADRLIFPGVGNFGPAMD---VLNRTGFAEPLRKYIESGKPFMGICVGLQALF 88 Query: 94 E----------LNLLPGILMRNCSLKFVCKQVLLEVVNSNTAFTKSYKMNQIIKCPVAHH 143 + L ++PGI+ R F ++ + N+ S ++ + Sbjct: 89 DGSVENPPSKGLGVIPGIVGR-----FDASAKIVPHIGWNSCQVGS--DSEFFG--DVPN 139 Query: 144 DGNYFIDAKGLAEIEKNNQIVFRYASGTNPNGSLHDIAGVINRRGNVLGMMPHPE----- 198 YF+ + E K+ + + T GS I+ + R+ NV HPE Sbjct: 140 RHVYFVHSYLNREKPKSLENK-DWKIATCKYGSESFISAI--RKNNVHATQFHPEKSGEA 196 Query: 199 --NIIEKF 204 +++ +F Sbjct: 197 GLSVLRRF 204 >gnl|CDD|153212 cd01741, GATase1_1, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. This group contains a subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. GATase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. Glutamine amidotransferases (GATase) includes the triad family of amidotransferases which have a conserved Cys-His-Glu catalytic triad in the glutaminase active site. In this subgroup this triad is conserved. GATase activity can be found in a range of biosynthetic enzymes, including: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase , anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. Glutamine amidotransferase (GATase) domains can occur either as single polypeptides, as in glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase. Length = 188 Score = 37.6 bits (88), Expect = 0.003 Identities = 17/61 (27%), Positives = 25/61 (40%), Gaps = 11/61 (18%) Query: 38 DIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQA----IKKKAQQGIKVMGICNGFQILV 93 D+ D D +VI GG P ++ I++ G V+GIC G Q+L Sbjct: 43 DLDDYDGLVILGGPM-------SVDEDDYPWLKKLKELIRQALAAGKPVLGICLGHQLLA 95 Query: 94 E 94 Sbjct: 96 R 96 >gnl|CDD|153231 cd03137, GATase1_AraC_1, AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain. A subgroup of AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain. AraC regulators are defined by a AraC-type helix-turn-helix DNA binding domain at their C-terminal. AraC family transcriptional regulators are widespread among bacteria and are involved in regulating diverse and important biological functions, including carbon metabolism, stress responses and virulence in different microorganisms. The catalytic triad typical of GATase1 domains is not conserved in this GATase1-like domain. However, in common with typical GATase1domains a reactive cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. Length = 187 Score = 37.1 bits (87), Expect = 0.004 Identities = 15/61 (24%), Positives = 27/61 (44%), Gaps = 6/61 (9%) Query: 40 PDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQILVELNLLP 99 D +++PGG ++ A+++ A +G +V +C G +L E LL Sbjct: 63 AAADTVIVPGGPDV------DGRPPPPALLAALRRAAARGARVASVCTGAFVLAEAGLLD 116 Query: 100 G 100 G Sbjct: 117 G 117 >gnl|CDD|153233 cd03139, GATase1_PfpI_2, Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. PfpI is an ATP-independent intracellular proteases which may hydrolyze small peptides to provide a nutritional source. Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. Length = 183 Score = 36.4 bits (85), Expect = 0.006 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Query: 35 SDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNG 88 S D PD+D++++PGG G A+ ++ I+++A + V +C G Sbjct: 56 SFADPPDLDVLLVPGG--GGTR----ALVNDPALLDFIRRQAARAKYVTSVCTG 103 >gnl|CDD|153229 cd03135, GATase1_DJ-1, Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1. Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1. DJ-1 is involved in multiple physiological processes including cancer, Parkinson's disease and male fertility. It is unclear how DJ-1 functions in these. DJ-1 has been shown to possess chaperone activity. DJ-1 is preferentially expressed in the testis and moderately in other tissues; it is induced together with genes involved in oxidative stress response. The Drosophila homologue (DJ-1A) plays an essential role in oxidative stress response and neuronal maintenance. Inhibition of DJ-1A function through RNAi, results in the cellular accumulation of reactive oxygen species, organismal hypersensitivity to oxidative stress, and dysfunction and degeneration of dopaminergic and photoreceptor neurons. DJ-1 has lacks enzymatic activity and the catalytic triad of typical GATase1 domains, however it does contain the highly conserved cysteine located at the nucelophile elbow region typical of these domains. This cysteine been proposed to be a site of regulation of DJ-1 activity by oxidation. DJ-1 is a dimeric enzyme. Length = 163 Score = 35.6 bits (83), Expect = 0.011 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 5/66 (7%) Query: 35 SDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQILVE 94 SD ++ D D IVIPGG L +++ +K+ +G + IC +L + Sbjct: 54 SDVNLDDYDAIVIPGGLPGAQNLA-----DNEKLIKLLKEFNAKGKLIAAICAAPAVLAK 108 Query: 95 LNLLPG 100 LL G Sbjct: 109 AGLLKG 114 >gnl|CDD|31037 COG0693, ThiJ, Putative intracellular protease/amidase [General function prediction only]. Length = 188 Score = 35.1 bits (80), Expect = 0.015 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 5/64 (7%) Query: 35 SDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQILVE 94 D D D D +VIPGG +YLR ++ ++ G V IC+G +L Sbjct: 60 DDADAADYDALVIPGGDHGPEYLR-----PDPDLLAFVRDFYANGKPVAAICHGPAVLAA 114 Query: 95 LNLL 98 LL Sbjct: 115 AGLL 118 >gnl|CDD|153220 cd01749, GATase1_PB, Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis. Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis. Glutamine amidotransferase (GATase) activity involves the removal of the ammonia group from a glutamate molecule and its subsequent transfer to a specific substrate, thus creating a new carbon-nitrogen group on the substrate. This group contains proteins like Bacillus subtilus YaaE and Plasmodium falciparum Pdx2 which are members of the triad glutamine aminotransferase family and function in a pathway for the biosynthesis of vitamin B6. Length = 183 Score = 34.4 bits (80), Expect = 0.025 Identities = 18/69 (26%), Positives = 31/69 (44%), Gaps = 11/69 (15%) Query: 23 KIIGQSPILVWQSDTDIPDVDLIVIPGGFSYGDYLRCGAI---AARTPVMQAIKKKAQQG 79 + +G I V + D+ +D ++IPGG S I RT ++ +++ + G Sbjct: 18 ERLGVEVIEVRTPE-DLEGIDGLIIPGGES-------TTIGKLLRRTGLLDPLREFIRAG 69 Query: 80 IKVMGICNG 88 V G C G Sbjct: 70 KPVFGTCAG 78 >gnl|CDD|30850 COG0504, PyrG, CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism]. Length = 533 Score = 34.3 bits (79), Expect = 0.028 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 9/54 (16%) Query: 40 PDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQILV 93 VD I++PGGF Y G IAA I+ + I +GIC G Q+ V Sbjct: 342 KLVDGILVPGGFGYRGVE--GKIAA-------IRYARENNIPFLGICLGMQLAV 386 >gnl|CDD|153243 cd03169, GATase1_PfpI_1, Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. PfpI is an ATP-independent intracellular proteases which may hydrolyze small peptides to provide a nutritional source. Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. Length = 180 Score = 33.4 bits (77), Expect = 0.051 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 9/79 (11%) Query: 35 SDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQILVE 94 + D D D +VIPGG + +YLR V+ ++ A+ V IC+G QIL Sbjct: 70 DEVDPDDYDALVIPGGRA-PEYLR-----LDEKVLAIVRHFAEANKPVAAICHGPQILAA 123 Query: 95 LNLLPGILMRNCSLKFVCK 113 +L G R C+ CK Sbjct: 124 AGVLKG---RRCTAYPACK 139 >gnl|CDD|153217 cd01746, GATase1_CTP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase. Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase (CTP). CTP is involved in pyrimidine ribonucleotide/ribonucleoside metabolism. CTPs produce CTP from UTP and glutamine and regulate intracellular CTP levels through interactions with four ribonucleotide triphosphates. The enzyme exists as a dimer of identical chains that aggregates as a tetramer. CTP is derived form UTP in three separate steps involving two active sites. In one active site, the UTP O4 oxygen is activated by Mg-ATP-dependent phosphorylation, followed by displacement of the resulting 4-phosphate moiety by ammonia. At a separate site, ammonia is generated via rate limiting glutamine hydrolysis (glutaminase) activity. A gated channel that spans between the glutamine hydrolysis and amidoligase active sites provides a path for ammonia diffusion. CTPs belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site. Length = 235 Score = 32.5 bits (75), Expect = 0.097 Identities = 19/76 (25%), Positives = 27/76 (35%), Gaps = 26/76 (34%) Query: 31 LVWQSDTDIP---------DVDLIVIPGGFSY----GDYLRCGAIAARTPVMQAIKKKAQ 77 + W D+ D I++PGGF G + AIK + Sbjct: 36 IKWIDSEDLEEENAEEALKGADGILVPGGFGIRGVEG-------------KILAIKYARE 82 Query: 78 QGIKVMGICNGFQILV 93 I +GIC G Q+ V Sbjct: 83 NNIPFLGICLGMQLAV 98 >gnl|CDD|153215 cd01744, GATase1_CPSase, Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II. This group of sequences represents the small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II. CPSase II catalyzes the production of carbomyl phosphate (CP) from bicarbonate, glutamine and two molecules of MgATP. The reaction is believed to proceed by a series of four biochemical reactions involving a minimum of three discrete highly reactive intermediates. The synthesis of CP is critical for the initiation of two separate biosynthetic pathways. In one CP is coupled to aspartate, its carbon and nitrogen nuclei ultimately incorporated into the aromatic moieties of pyrimidine nucleotides. In the second pathway CP is condensed with ornithine at the start of the urea cycle and is utilized for the detoxification of ammonia and biosynthesis of arginine. CPSases may be encoded by one or by several genes, depending on the species. The E.coli enzyme is a heterodimer consisting of two polypeptide chains referred to as the small and large subunit. Ammonia an intermediate during the biosynthesis of carbomyl phosphate produced by the hydrolysis of glutamine in the small subunit of the enzyme is delivered via a molecular tunnel between the remotely located carboxyphosphate active site in the large subunit. CPSase IIs belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site. This group also contains the sequence from the mammalian urea cycle form which has lost the active site Cys, resulting in an ammonia-dependent form, CPSase I. Length = 178 Score = 32.5 bits (75), Expect = 0.097 Identities = 13/63 (20%), Positives = 25/63 (39%), Gaps = 11/63 (17%) Query: 41 DVDLIVIPGGFSYGDYLRC-----------GAIAARTPVMQAIKKKAQQGIKVMGICNGF 89 ++ V+P + L+ G A ++ ++K + I + GIC G Sbjct: 20 GCEVTVVPYNTDAEEILKLDPDGIFLSNGPGDPALLDEAIKTVRKLLGKKIPIFGICLGH 79 Query: 90 QIL 92 Q+L Sbjct: 80 QLL 82 >gnl|CDD|153232 cd03138, GATase1_AraC_2, AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain. A subgroup of AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain. AraC regulators are defined by a AraC-type helix-turn-helix DNA binding domain at their C-terminal. AraC family transcriptional regulators are widespread among bacteria and are involved in regulating diverse and important biological functions, including carbon metabolism, stress responses and virulence in different microorganisms. The catalytic triad typical of GATase1 domains is not conserved in this GATase1-like domain. However, in common with typical GATase1domains a reactive cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. Length = 195 Score = 32.2 bits (74), Expect = 0.12 Identities = 19/82 (23%), Positives = 33/82 (40%), Gaps = 3/82 (3%) Query: 19 KAITKIIGQSPILVWQSDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQ 78 + G IL + D+P DL+++P G +A ++ ++++ Sbjct: 47 GGPVLLAGGILILPDATLADVPAPDLVIVP-GLGGDP--DELLLADNPALIAWLRRQHAN 103 Query: 79 GIKVMGICNGFQILVELNLLPG 100 G V C G +L E LL G Sbjct: 104 GATVAAACTGVFLLAEAGLLDG 125 >gnl|CDD|37598 KOG2387, KOG2387, KOG2387, CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism]. Length = 585 Score = 31.0 bits (70), Expect = 0.28 Identities = 21/61 (34%), Positives = 27/61 (44%), Gaps = 12/61 (19%) Query: 33 WQSDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQIL 92 WQ + D I++PGGF GD G I A K + I +GIC G Q+ Sbjct: 358 WQK---LKSADGILVPGGF--GDRGVEGKI-------LAAKWARENKIPFLGICLGMQLA 405 Query: 93 V 93 V Sbjct: 406 V 406 >gnl|CDD|32254 COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only]. Length = 243 Score = 30.3 bits (68), Expect = 0.47 Identities = 16/75 (21%), Positives = 31/75 (41%), Gaps = 11/75 (14%) Query: 29 PILVWQSDTD--IPDVDLIVIPGGFSYGDYLRCGAIAARTPV---------MQAIKKKAQ 77 P L D + +D +++ GG + L + + + I+ + Sbjct: 46 PALEDPEDARQYLDLIDGLILTGGSNVDPSLYGEEPSEKDGPYDPERDAFELALIRAALE 105 Query: 78 QGIKVMGICNGFQIL 92 +GI ++GIC G Q+L Sbjct: 106 RGIPILGICRGLQLL 120 >gnl|CDD|153234 cd03140, GATase1_PfpI_3, Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. PfpI is an ATP-independent intracellular proteases which may hydrolyze small peptides to provide a nutritional source. Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. Length = 170 Score = 29.9 bits (68), Expect = 0.55 Identities = 13/56 (23%), Positives = 23/56 (41%), Gaps = 11/56 (19%) Query: 35 SDTDIPDVDLIVIPGGFSY--GDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNG 88 D D DL+++PGG S+ + + +++ +QG V IC Sbjct: 54 DDLPPEDYDLLILPGGDSWDNPEA---------PDLAGLVRQALKQGKPVAAICGA 100 >gnl|CDD|133630 CHL00188, hisH, imidazole glycerol phosphate synthase subunit hisH; Provisional. Length = 210 Score = 29.1 bits (65), Expect = 1.1 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 7/77 (9%) Query: 19 KAITKIIGQSPILVWQSDTDIPDVDLIVIPGGFSYGDYL-RCGAIAARTPVMQAIKKKAQ 77 +AI + GQ P ++ S++++ V +V+PG S+ + + TP+ + I Sbjct: 19 RAIQQA-GQQPCII-NSESELAQVHALVLPGVGSFDLAMKKLEKKGLITPIKKWI----A 72 Query: 78 QGIKVMGICNGFQILVE 94 +G +GIC G +L E Sbjct: 73 EGNPFIGICLGLHLLFE 89 >gnl|CDD|33965 COG4242, CphB, Cyanophycinase and related exopeptidases [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism]. Length = 293 Score = 28.8 bits (64), Expect = 1.1 Identities = 15/42 (35%), Positives = 24/42 (57%) Query: 51 FSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQIL 92 F+ GD LR TP+M AI+++ ++GI V G G ++ Sbjct: 112 FTGGDQLRIIGSLKDTPLMAAIRQRVRRGIAVGGTSAGAAVM 153 >gnl|CDD|33246 COG3442, COG3442, Predicted glutamine amidotransferase [General function prediction only]. Length = 250 Score = 28.7 bits (64), Expect = 1.3 Identities = 13/58 (22%), Positives = 22/58 (37%), Gaps = 3/58 (5%) Query: 35 SDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQIL 92 DL + GG Y + + + +K + G V+ IC G+Q+L Sbjct: 46 DTFPDDSYDLYFLGGGQDYEQEIATRDLLTKKE---GLKDAIENGKPVLAICGGYQLL 100 >gnl|CDD|153216 cd01745, GATase1_2, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. This group contains a subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. GATase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. Glutamine amidotransferases (GATase) includes the triad family of amidotransferases which have a conserved Cys-His-Glu catalytic triad in the glutaminase active site. In this subgroup this triad is conserved. GATase activity can be found in a range of biosynthetic enzymes, including: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase , anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. Glutamine amidotransferase (GATase) domains can occur either as single polypeptides, as in glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase. Length = 189 Score = 28.3 bits (64), Expect = 1.7 Identities = 7/24 (29%), Positives = 15/24 (62%) Query: 69 MQAIKKKAQQGIKVMGICNGFQIL 92 + ++ ++G ++GIC G Q+L Sbjct: 90 LALLRAALERGKPILGICRGMQLL 113 >gnl|CDD|31362 COG1168, MalY, Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism]. Length = 388 Score = 27.9 bits (62), Expect = 2.2 Identities = 15/57 (26%), Positives = 24/57 (42%), Gaps = 3/57 (5%) Query: 126 FTKSYKMN--QIIKCPVAHHDGNYFIDAKGL-AEIEKNNQIVFRYASGTNPNGSLHD 179 F + K+N ++I+ P+ DG Y ID L +F + NP G + Sbjct: 120 FYNAIKLNGRKVIENPLVEDDGRYEIDFDALEKAFVDERVKLFILCNPHNPTGRVWT 176 >gnl|CDD|133128 cd06597, GH31_transferase_CtsY, CtsY (cyclic tetrasaccharide-synthesizing enzyme Y) is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ. CtsY and CtsZ both have a glycosyl hydrolase family 31 (GH31) catalytic domain. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. Length = 340 Score = 27.9 bits (62), Expect = 2.4 Identities = 16/51 (31%), Positives = 20/51 (39%), Gaps = 18/51 (35%) Query: 26 GQSPILVWQSDTDIPDVDLIVIPGGFSYGD------YLRCGAIAARTPVMQ 70 S I W D GF+ GD Y+R A+AA P+MQ Sbjct: 268 SASGIPYWGWDL-----------AGFT-GDVPTAELYVRSTAMAAFVPIMQ 306 >gnl|CDD|35722 KOG0501, KOG0501, KOG0501, K+-channel KCNQ [Inorganic ion transport and metabolism]. Length = 971 Score = 27.7 bits (61), Expect = 2.6 Identities = 11/37 (29%), Positives = 19/37 (51%) Query: 106 CSLKFVCKQVLLEVVNSNTAFTKSYKMNQIIKCPVAH 142 C L + + LL+V++ TAF S+ N + + H Sbjct: 641 CDLHMIKRDKLLKVLDFYTAFANSFARNLTLTYNLRH 677 >gnl|CDD|35591 KOG0370, KOG0370, KOG0370, Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only]. Length = 1435 Score = 27.6 bits (61), Expect = 2.6 Identities = 14/78 (17%), Positives = 31/78 (39%), Gaps = 8/78 (10%) Query: 15 NDMIKAITKIIGQSPILVWQSDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKK 74 + I+ + K + ++ W + D + + G G ++Q +++ Sbjct: 184 YNQIRCLVKRGAEVTVVPWDYPIAKEEYDGLFLSNG--------PGDPELCPLLVQNVRE 235 Query: 75 KAQQGIKVMGICNGFQIL 92 + + V GIC G Q+L Sbjct: 236 LLESNVPVFGICLGHQLL 253 >gnl|CDD|37975 KOG2764, KOG2764, KOG2764, Putative transcriptional regulator DJ-1 [General function prediction only, Defense mechanisms]. Length = 247 Score = 26.8 bits (59), Expect = 4.2 Identities = 13/54 (24%), Positives = 24/54 (44%), Gaps = 5/54 (9%) Query: 35 SDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNG 88 D D+I++PGG + L + V+ +K++A+ G + IC Sbjct: 61 FDVVDSKYDVIILPGGLPGAETL-----SECEKVVDLVKEQAESGKLIAAICAA 109 >gnl|CDD|30864 COG0518, GuaA, GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism]. Length = 198 Score = 27.1 bits (60), Expect = 4.3 Identities = 16/61 (26%), Positives = 23/61 (37%), Gaps = 12/61 (19%) Query: 38 DIPDVDLIVIPGG----FSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQILV 93 + D I+I GG + +L IK G V+GIC G Q+L Sbjct: 42 PLDSPDGIIISGGPMSVYDEDPWLP--------REKDLIKDAGVPGKPVLGICLGHQLLA 93 Query: 94 E 94 + Sbjct: 94 K 94 >gnl|CDD|39177 KOG3974, KOG3974, KOG3974, Predicted sugar kinase [Carbohydrate transport and metabolism]. Length = 306 Score = 26.8 bits (59), Expect = 4.7 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 6/40 (15%) Query: 3 TAIVQIPGLNRDNDMIKAITKIIGQSPILVWQSDTDIPDV 42 A+V PGL RD ++K I KI+ D+P V Sbjct: 103 HAVVIGPGLGRDPAILKEIAKILEYL------RGKDVPLV 136 >gnl|CDD|153214 cd01743, GATase1_Anthranilate_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase. Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase (ASase). This group contains proteins similar to para-aminobenzoate (PABA) synthase and ASase. These enzymes catalyze similar reactions and produce similar products, PABA and ortho-aminobenzoate (anthranilate). Each enzyme is composed of non-identical subunits: a glutamine amidotransferase subunit (component II) and a subunit that produces an aminobenzoate products (component I). ASase catalyses the synthesis of anthranilate from chorismate and glutamine and is a tetrameric protein comprising two copies each of components I and II. Component II of ASase belongs to the family of triad GTases which hydrolyze glutamine and transfer nascent ammonia between the active sites. In some bacteria, such as Escherichia coli, component II can be much larger than in other organisms, due to the presence of phosphoribosyl-anthranilate transferase (PRTase) activity. PRTase catalyses the second step in tryptophan biosynthesis and results in the addition of 5-phosphoribosyl-1-pyrophosphate to anthranilate to create N-5'-phosphoribosyl-anthranilate. In E.coli, the first step in the conversion of chorismate to PABA involves two proteins: PabA and PabB which co-operate to transfer the amide nitrogen of glutamine to chorismate forming 4-amino-4 deoxychorismate (ADC). PabA acts as a glutamine amidotransferase, supplying an amino group to PabB, which carries out the amination reaction. A third protein PabC then mediates elimination of pyruvate and aromatization to give PABA. Several organisms have bipartite proteins containing fused domains homologous to PabA and PabB commonly called PABA synthases. These hybrid PABA synthases may produce ADC and not PABA. Length = 184 Score = 26.7 bits (60), Expect = 4.8 Identities = 13/58 (22%), Positives = 23/58 (39%), Gaps = 11/58 (18%) Query: 38 DIPDVDLIVI-PGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQILVE 94 ++ + D IVI PG G + I + + ++G+C G Q + E Sbjct: 39 ELLNPDAIVISPG---PGH-------PEDAGISLEIIRALAGKVPILGVCLGHQAIAE 86 >gnl|CDD|31240 COG1038, PycA, Pyruvate carboxylase [Energy production and conversion]. Length = 1149 Score = 26.8 bits (59), Expect = 5.0 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 5/37 (13%) Query: 186 RRGNVLGMMPHPENIIEKF-----HGGIDGRGLFASL 217 R N +G +P+N+I +F GID +F SL Sbjct: 617 RGANGVGYKNYPDNVIREFVKQAAKSGIDVFRIFDSL 653 >gnl|CDD|30851 COG0505, CarA, Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism]. Length = 368 Score = 26.7 bits (59), Expect = 5.1 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 66 TPVMQAIKKKAQQGIKVMGICNGFQIL 92 ++ IK+ I + GIC G Q+L Sbjct: 237 DYAIETIKELLGTKIPIFGICLGHQLL 263 >gnl|CDD|153223 cd03129, GAT1_Peptidase_E_like, Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E_like proteins. Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E_like proteins. This group contains proteins similar to the aspartyl dipeptidases Salmonella typhimurium peptidase E and Xenopus laevis peptidase E and, extracellular cyanophycinases from Pseudomonas anguilliseptica BI (CphE) and Synechocystis sp. PCC 6803 CphB. In bacteria peptidase E is believed to play a role in degrading peptides generated by intracellular protein breakdown or imported into the cell as nutrient sources. Peptidase E uniquely hydrolyses only Asp-X dipeptides (where X is any amino acid), and one tripeptide Asp-Gly-Gly. Cyanophycinases are intracellular exopeptidases which hydrolyze the polymer cyanophycin (multi L-arginyl-poly-L-aspartic acid) to the dipeptide beta-Asp-Arg. Peptidase E and cyanophycinases are thought to have a Ser-His-Glu catalytic triad which differs from the Cys-His-Glu catalytic triad typical of GATase1 domains by having a Ser in place of the reactive Cys at the nucleophile elbow. Xenopus peptidase E is developmentally regulated in response to thyroid hormone and, it is thought to play a role in apoptosis during tail reabsorption. Length = 210 Score = 26.9 bits (60), Expect = 5.1 Identities = 19/81 (23%), Positives = 32/81 (39%), Gaps = 23/81 (28%) Query: 41 DVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGI--------------C 86 + D I + GG + LR ++ TP++ AI K+ +G+ + G Sbjct: 80 EADGIFVGGG----NQLRLLSVLRETPLLDAILKRVARGVVIGGTSAGAAVMGETGIGTT 135 Query: 87 NGFQILVE-----LNLLPGIL 102 + L LLPGI+ Sbjct: 136 PSEPEVTPPMAPGLGLLPGII 156 >gnl|CDD|164573 CHL00197, carA, carbamoyl-phosphate synthase arginine-specific small subunit; Provisional. Length = 382 Score = 26.7 bits (59), Expect = 5.4 Identities = 17/60 (28%), Positives = 25/60 (41%), Gaps = 11/60 (18%) Query: 44 LIVIPGGFSYGDYLRC-----------GAIAARTPVMQAIKKKAQQGIKVMGICNGFQIL 92 + V+P Y D L G +A ++ +KK + I + GIC G QIL Sbjct: 217 ITVVPATSPYQDILSYQPDGILLSNGPGDPSAIHYGIKTVKKLLKYNIPIFGICMGHQIL 276 >gnl|CDD|30858 COG0512, PabA, Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism]. Length = 191 Score = 26.7 bits (59), Expect = 5.8 Identities = 6/28 (21%), Positives = 14/28 (50%) Query: 67 PVMQAIKKKAQQGIKVMGICNGFQILVE 94 + + ++ I ++G+C G Q + E Sbjct: 62 GISLELIRRFAGRIPILGVCLGHQAIAE 89 >gnl|CDD|36835 KOG1622, KOG1622, KOG1622, GMP synthase [Nucleotide transport and metabolism]. Length = 552 Score = 26.4 bits (58), Expect = 6.9 Identities = 9/18 (50%), Positives = 14/18 (77%) Query: 79 GIKVMGICNGFQILVELN 96 G+ V+GIC G Q++ +LN Sbjct: 88 GVPVLGICYGMQLINKLN 105 >gnl|CDD|145578 pfam02514, CobN-Mg_chel, CobN/Magnesium Chelatase. This family contains a domain common to the cobN protein and to magnesium protoporphyrin chelatase. CobN is implicated in the conversion of hydrogenobyrinic acid a,c-diamide to cobyrinic acid. Magnesium protoporphyrin chelatase is involved in chlorophyll biosynthesis. Length = 1064 Score = 26.0 bits (58), Expect = 7.8 Identities = 19/81 (23%), Positives = 27/81 (33%), Gaps = 19/81 (23%) Query: 11 LNRDNDMIKAITKII---GQSPILVWQS------------DTDIPDVDLIVIPGGFSYGD 55 L D I A+ + + G + I V+ P VD I+ GFS Sbjct: 81 LAGDTAHIDALIRALEARGLNVIPVFSDLDSREAVRDFFFRDGEPKVDAIINLTGFSLVG 140 Query: 56 YLRCGAIAART----PVMQAI 72 + PV+QAI Sbjct: 141 GPAENGVELLKKLDVPVLQAI 161 >gnl|CDD|153239 cd03145, GAT1_cyanophycinase, Type 1 glutamine amidotransferase (GATase1)-like domain found in cyanophycinase. Type 1 glutamine amidotransferase (GATase1)-like domain found in cyanophycinase. This group contains proteins similar to the extracellular cyanophycinases from Pseudomonas anguilliseptica BI (CphE) and Synechocystis sp. PCC 6803 CphB. Cyanophycinases are intracellular exopeptidases which hydrolyze the polymer cyanophycin (multi L-arginyl-poly-L-aspartic acid) to the dipeptide beta-Asp-Arg. Cyanophycinase is believed to be a serine-type exopeptidase having a Ser-His-Glu catalytic triad which differs from the Cys-His-Glu catalytic triad typical of GATase1 domains by having a Ser in place of the reactive Cys at the nucleophile elbow. Length = 217 Score = 25.7 bits (57), Expect = 9.4 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 4/45 (8%) Query: 41 DVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGI 85 D D I GG D LR + TP++ A++K + G+ + G Sbjct: 83 DADGIFFTGG----DQLRITSALGGTPLLDALRKVYRGGVVIGGT 123 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.141 0.421 Gapped Lambda K H 0.267 0.0796 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,689,711 Number of extensions: 141884 Number of successful extensions: 408 Number of sequences better than 10.0: 1 Number of HSP's gapped: 381 Number of HSP's successfully gapped: 58 Length of query: 219 Length of database: 6,263,737 Length adjustment: 90 Effective length of query: 129 Effective length of database: 4,318,927 Effective search space: 557141583 Effective search space used: 557141583 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 55 (24.8 bits)