BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780971|ref|YP_003065384.1| phosphoribosylformylglycinamidine synthase subunit I [Candidatus Liberibacter asiaticus str. psy62] (219 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780971|ref|YP_003065384.1| phosphoribosylformylglycinamidine synthase subunit I [Candidatus Liberibacter asiaticus str. psy62] Length = 219 Score = 450 bits (1157), Expect = e-128, Method: Compositional matrix adjust. Identities = 219/219 (100%), Positives = 219/219 (100%) Query: 1 MKTAIVQIPGLNRDNDMIKAITKIIGQSPILVWQSDTDIPDVDLIVIPGGFSYGDYLRCG 60 MKTAIVQIPGLNRDNDMIKAITKIIGQSPILVWQSDTDIPDVDLIVIPGGFSYGDYLRCG Sbjct: 1 MKTAIVQIPGLNRDNDMIKAITKIIGQSPILVWQSDTDIPDVDLIVIPGGFSYGDYLRCG 60 Query: 61 AIAARTPVMQAIKKKAQQGIKVMGICNGFQILVELNLLPGILMRNCSLKFVCKQVLLEVV 120 AIAARTPVMQAIKKKAQQGIKVMGICNGFQILVELNLLPGILMRNCSLKFVCKQVLLEVV Sbjct: 61 AIAARTPVMQAIKKKAQQGIKVMGICNGFQILVELNLLPGILMRNCSLKFVCKQVLLEVV 120 Query: 121 NSNTAFTKSYKMNQIIKCPVAHHDGNYFIDAKGLAEIEKNNQIVFRYASGTNPNGSLHDI 180 NSNTAFTKSYKMNQIIKCPVAHHDGNYFIDAKGLAEIEKNNQIVFRYASGTNPNGSLHDI Sbjct: 121 NSNTAFTKSYKMNQIIKCPVAHHDGNYFIDAKGLAEIEKNNQIVFRYASGTNPNGSLHDI 180 Query: 181 AGVINRRGNVLGMMPHPENIIEKFHGGIDGRGLFASLLT 219 AGVINRRGNVLGMMPHPENIIEKFHGGIDGRGLFASLLT Sbjct: 181 AGVINRRGNVLGMMPHPENIIEKFHGGIDGRGLFASLLT 219 >gi|254780195|ref|YP_003064608.1| CTP synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 544 Score = 25.8 bits (55), Expect = 0.64, Method: Compositional matrix adjust. Identities = 19/49 (38%), Positives = 24/49 (48%), Gaps = 9/49 (18%) Query: 45 IVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQILV 93 I++PGGF G G IAA IK + I +GIC G Q+ V Sbjct: 350 ILVPGGF--GKRGSEGKIAA-------IKFARENKIPFLGICFGMQMAV 389 >gi|254780241|ref|YP_003064654.1| preprotein translocase subunit SecY [Candidatus Liberibacter asiaticus str. psy62] Length = 444 Score = 24.3 bits (51), Expect = 1.6, Method: Compositional matrix adjust. Identities = 10/22 (45%), Positives = 16/22 (72%) Query: 62 IAARTPVMQAIKKKAQQGIKVM 83 IAA P ++ +KK+ +QG KV+ Sbjct: 99 IAATVPSLENLKKEGEQGRKVI 120 >537021.9.peg.472_1 Length = 369 Score = 23.9 bits (50), Expect = 2.1, Method: Compositional matrix adjust. Identities = 9/16 (56%), Positives = 12/16 (75%) Query: 166 RYASGTNPNGSLHDIA 181 +Y SG NP+ LHD+A Sbjct: 258 QYDSGVNPSVILHDLA 273 >gi|254780775|ref|YP_003065188.1| undecaprenyl diphosphate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 243 Score = 23.1 bits (48), Expect = 4.4, Method: Compositional matrix adjust. Identities = 10/26 (38%), Positives = 15/26 (57%) Query: 25 IGQSPILVWQSDTDIPDVDLIVIPGG 50 + S I + +D+PD DLI+ GG Sbjct: 165 VDSSLIAKYLDTSDVPDPDLIIRTGG 190 >gi|254780623|ref|YP_003065036.1| 2-polyprenylphenol 6-hydroxylase [Candidatus Liberibacter asiaticus str. psy62] Length = 517 Score = 21.9 bits (45), Expect = 9.3, Method: Compositional matrix adjust. Identities = 7/11 (63%), Positives = 9/11 (81%) Query: 143 HDGNYFIDAKG 153 H GN F+D+KG Sbjct: 289 HPGNLFVDSKG 299 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.323 0.141 0.421 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 144,410 Number of Sequences: 1233 Number of extensions: 6136 Number of successful extensions: 14 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 8 length of query: 219 length of database: 328,796 effective HSP length: 71 effective length of query: 148 effective length of database: 241,253 effective search space: 35705444 effective search space used: 35705444 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 36 (18.5 bits)