Query gi|254780972|ref|YP_003065385.1| phosphoribosylformylglycinamidine synthase, PurS protein [Candidatus Liberibacter asiaticus str. psy62] Match_columns 84 No_of_seqs 101 out of 950 Neff 5.4 Searched_HMMs 39220 Date Mon May 30 02:17:48 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780972.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 TIGR00302 TIGR00302 phosphorib 100.0 1E-32 2.5E-37 211.4 9.7 80 2-81 1-80 (80) 2 COG1828 PurS Phosphoribosylfor 100.0 4E-31 1E-35 202.1 11.4 83 1-83 1-83 (83) 3 pfam02700 PurS Phosphoribosylf 100.0 9.7E-31 2.5E-35 199.9 11.1 80 2-81 1-80 (80) 4 PRK05974 phosphoribosylformylg 100.0 1.2E-30 3E-35 199.4 11.0 79 2-81 1-79 (79) 5 PRK06423 phosphoribosylformylg 100.0 1.4E-28 3.5E-33 187.4 9.1 72 2-79 1-72 (73) 6 PRK05783 hypothetical protein; 99.9 2.5E-26 6.3E-31 174.4 10.9 82 1-82 2-84 (84) 7 pfam02505 MCR_D Methyl-coenzym 86.5 1.3 3.3E-05 25.5 4.4 38 35-81 70-107 (153) 8 TIGR03260 met_CoM_red_D methyl 73.7 7.1 0.00018 21.2 4.6 37 35-81 69-105 (150) 9 pfam07876 Dabb Stress responsi 67.0 8.8 0.00022 20.7 3.9 40 4-43 3-44 (96) 10 COG4055 McrD Methyl coenzyme M 66.8 9.3 0.00024 20.6 3.9 31 35-68 78-108 (165) 11 cd07890 CYTH-like_AC_IV-like A 62.5 16 0.00042 19.1 6.7 53 18-70 86-158 (169) 12 PRK10850 phosphohistidinoprote 54.8 22 0.00057 18.3 7.3 66 1-66 1-84 (85) 13 PRK13782 phosphocarrier protei 52.5 24 0.00062 18.1 6.8 63 1-63 1-81 (85) 14 PRK05297 phosphoribosylformylg 52.3 25 0.00063 18.1 5.8 67 4-75 72-138 (1294) 15 TIGR01003 PTS_HPr_family phosp 47.0 22 0.00056 18.4 3.1 62 1-62 1-81 (83) 16 cd00367 PTS-HPr_like Histidine 43.0 31 0.00078 17.6 3.3 27 36-62 50-76 (77) 17 pfam00381 PTS-HPr PTS HPr comp 38.0 42 0.0011 16.8 3.5 28 36-63 53-80 (83) 18 PRK09213 purine operon repress 35.5 46 0.0012 16.5 4.7 44 20-66 45-91 (274) 19 COG1437 CyaB Adenylate cyclase 33.9 49 0.0012 16.4 7.4 62 6-67 62-160 (178) 20 TIGR01890 N-Ac-Glu-synth amino 31.3 19 0.00049 18.7 0.8 28 5-32 197-232 (439) 21 PRK01146 DNA-directed RNA poly 30.7 48 0.0012 16.4 2.7 23 5-30 62-84 (111) 22 cd04446 DEP_DEPDC4 DEP (Dishev 30.0 31 0.0008 17.5 1.7 26 53-78 51-76 (95) 23 TIGR02303 HpaG-C-term 4-hydrox 29.6 30 0.00077 17.6 1.6 29 31-73 220-248 (249) 24 cd04447 DEP_BRCC3 DEP (Disheve 28.9 38 0.00096 17.0 1.9 24 53-76 52-75 (92) 25 TIGR03241 arg_catab_astB succi 27.8 22 0.00055 18.4 0.6 24 9-32 54-77 (443) 26 KOG1907 consensus 27.2 64 0.0016 15.7 4.8 66 5-70 85-155 (1320) 27 pfam01883 DUF59 Domain of unkn 26.8 65 0.0017 15.7 3.0 63 12-79 10-76 (76) 28 pfam04996 AstB Succinylarginin 26.3 24 0.00062 18.1 0.6 25 9-33 55-79 (439) 29 PRK13281 succinylarginine dihy 25.3 26 0.00066 18.0 0.6 25 9-33 56-80 (443) 30 pfam11731 Cdd1 Pathogenicity l 25.1 30 0.00077 17.6 0.9 21 18-38 20-40 (92) 31 cd00273 Chemokine_CXC Chemokin 25.0 48 0.0012 16.4 1.9 27 3-29 33-62 (64) 32 COG1030 NfeD Membrane-bound se 22.6 30 0.00077 17.6 0.5 60 10-72 177-236 (436) 33 pfam07540 NOC3p Nucleolar comp 22.5 55 0.0014 16.1 1.8 17 54-70 3-19 (95) 34 KOG0817 consensus 22.5 55 0.0014 16.1 1.8 25 9-33 45-69 (142) 35 cd02978 KaiB_like KaiB-like fa 22.4 79 0.002 15.2 4.7 36 43-82 4-41 (72) 36 pfam00403 HMA Heavy-metal-asso 21.4 83 0.0021 15.0 3.8 31 19-51 13-46 (62) 37 pfam09467 Yopt Hypothetical pr 21.2 84 0.0021 15.0 3.7 44 34-77 4-56 (71) 38 TIGR01857 FGAM-synthase phosph 20.6 86 0.0022 15.0 5.1 70 5-79 2-72 (1279) 39 pfam11812 DUF3333 Domain of un 20.5 40 0.001 16.9 0.8 77 3-79 49-133 (155) 40 PRK12893 allantoate amidohydro 20.2 66 0.0017 15.6 1.8 38 13-50 155-195 (408) No 1 >TIGR00302 TIGR00302 phosphoribosylformylglycinamidine synthase, purS protein; InterPro: IPR003850 Phosphoribosylformylglycinamidine(FGAM) synthetase, 6.3.5.3 from EC, catalyses the fourth step in the de novo purine biosynthetic pathway .5-phosphoribosylformylglycinamide (FGAR) + glutamine + ATP = FGAM + glutamate + ADP + Pi In eukaryotes and many bacterial systems (including Escherichia coli and Salmonella typhimurium), the FGAM synthetase is encoded by the large form of PurL (lgPurL), which contains an N-terminal ATPase domain and a C-terminal glutamine-binding domain. In archaeal and other bacterial systems, however, FGAM synthetase is encoded by separate genes, making it a multisubunit (rather than multidomain) enzyme. The protein is composed of the small form of PurL (smPurL), which is homologus to the ATPase domain of lgPurL, PurQ which is homologous to the glutamine-binding domain of of lgPurL, and PurS, whose function is not known. This entry represents the PurS subunit of the multisubunit FGAM synthetase. Recent studies showed that disruption of the purS gene in B. subtilis resulted in a purine auxotrophic phenotype, due to defective FGAM synthetase activity. Therefore, the PurS protein appears to be required for the function of the PurL and PurQ subunits of the FGAM synthetase, but the molecular mechanism for the functional role of PurS is currently not known. For additional information please see , . ; GO: 0016879 ligase activity forming carbon-nitrogen bonds. Probab=99.98 E-value=1e-32 Score=211.38 Aligned_cols=80 Identities=43% Similarity=0.830 Sum_probs=78.6 Q ss_pred EEEEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCEEEEEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEEEE Q ss_conf 59999999588666877899999986288642000023018999973899899999999999984797612479999997 Q gi|254780972|r 2 IKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVIEDYDIKVQK 81 (84) Q Consensus 2 ~k~~V~V~lK~gVlDPqG~aV~~aL~~lG~~~v~~vr~GK~iei~i~~~~~~~a~~~v~~~c~~lLaNpvIE~y~i~i~e 81 (84) |+++|+|+||+|||||||.||++||+.|||++|++||+||+|+|+++++|++.+..++++||+|||||||||+|+|+|++ T Consensus 1 y~~~Vyi~LK~gVLdPeG~a~~~AL~~LGy~~V~~V~t~K~i~~~~E~~~~e~~~~ev~eMC~kLLANpVI~dY~~~~~~ 80 (80) T TIGR00302 1 YKVEVYIKLKKGVLDPEGEAVQRALRLLGYNEVKDVRTGKVIELTIEAEDREEVEREVEEMCEKLLANPVIEDYEIEVEE 80 (80) T ss_pred CEEEEEEEECCCCCCCCHHHHHHHHHHCCCCCCCEEEEEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEECCEEEEEC T ss_conf 96789986467636811488999986337787303468888899727877788999999887762479852054578839 No 2 >COG1828 PurS Phosphoribosylformylglycinamidine (FGAM) synthase, PurS component [Nucleotide transport and metabolism] Probab=99.97 E-value=4e-31 Score=202.09 Aligned_cols=83 Identities=42% Similarity=0.834 Sum_probs=80.8 Q ss_pred CEEEEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCEEEEEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEEE Q ss_conf 95999999958866687789999998628864200002301899997389989999999999998479761247999999 Q gi|254780972|r 1 MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVIEDYDIKVQ 80 (84) Q Consensus 1 m~k~~V~V~lK~gVlDPqG~aV~~aL~~lG~~~v~~vr~GK~iei~i~~~~~~~a~~~v~~~c~~lLaNpvIE~y~i~i~ 80 (84) ||+++|+|+||+|||||||+||++||++|||.+|++||+||+|+|+++++|++.|.+++++||++||||||||+|+|+++ T Consensus 1 ~~~v~V~V~lK~~VlDPqG~ti~~aL~~lg~~~V~~vR~gK~~el~ld~~~~e~a~~~v~~mcekLLaNpVIe~y~v~~~ 80 (83) T COG1828 1 MYKVRVYVTLKPGVLDPEGETIEKALHRLGYNEVSDVRVGKVIELELDAESEEKAEEEVKEMCEKLLANPVIEDYEVEVE 80 (83) T ss_pred CEEEEEEEEECCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEEEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEEEEEE T ss_conf 96999999967856282058999999870876621345236999996576366799999999999847985368999987 Q ss_pred ECC Q ss_conf 717 Q gi|254780972|r 81 KSS 83 (84) Q Consensus 81 e~~ 83 (84) +.+ T Consensus 81 ~~~ 83 (83) T COG1828 81 EVE 83 (83) T ss_pred ECC T ss_conf 449 No 3 >pfam02700 PurS Phosphoribosylformylglycinamidine (FGAM) synthase. This family forms a component of the de novo purine biosynthesis pathway. Probab=99.97 E-value=9.7e-31 Score=199.87 Aligned_cols=80 Identities=45% Similarity=0.809 Sum_probs=78.6 Q ss_pred EEEEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCEEEEEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEEEE Q ss_conf 59999999588666877899999986288642000023018999973899899999999999984797612479999997 Q gi|254780972|r 2 IKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVIEDYDIKVQK 81 (84) Q Consensus 2 ~k~~V~V~lK~gVlDPqG~aV~~aL~~lG~~~v~~vr~GK~iei~i~~~~~~~a~~~v~~~c~~lLaNpvIE~y~i~i~e 81 (84) |+++|+|+||+|||||||+||+++|++|||+++++||+||+|+|+++++|++.|++++++||++||||||||+|+|++++ T Consensus 1 ~kv~V~V~lK~gVlDPqG~aI~~aL~~lG~~~v~~vr~GK~iel~i~~~~~e~a~~~v~~~c~~lLaNpVIE~y~i~i~e 80 (80) T pfam02700 1 YKAKVYVTLKPGVLDPQGEAIKKALHRLGYEGVEDVRIGKYIELTLEAEDEEEAEEQVEEMCDKLLANPVIEDYRIELEE 80 (80) T ss_pred CEEEEEEEECCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEEEC T ss_conf 97999999799873817999999998648644222774129999986899899999999999986388754669999979 No 4 >PRK05974 phosphoribosylformylglycinamidine synthase subunit PurS; Reviewed Probab=99.97 E-value=1.2e-30 Score=199.37 Aligned_cols=79 Identities=47% Similarity=0.830 Sum_probs=76.6 Q ss_pred EEEEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCEEEEEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEEEE Q ss_conf 59999999588666877899999986288642000023018999973899899999999999984797612479999997 Q gi|254780972|r 2 IKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVIEDYDIKVQK 81 (84) Q Consensus 2 ~k~~V~V~lK~gVlDPqG~aV~~aL~~lG~~~v~~vr~GK~iei~i~~~~~~~a~~~v~~~c~~lLaNpvIE~y~i~i~e 81 (84) |+++|+|+||+|||||||+||+++|++|||.++++||+||+|+|++++ +++.|.+++++||++||||||||+|+|+|+| T Consensus 1 yk~~V~V~lK~gVlDPqG~aV~~aL~~lG~~~v~~vr~GK~iel~le~-~~e~a~~~v~~~c~~lLaNpVIE~y~i~i~e 79 (79) T PRK05974 1 YKVRVYVTLKEGVLDPQGQAIKGALGSLGYDGVEDVRQGKYFELELEG-DEAKAEADLKEMCEKLLANTVIEDYRIEVEE 79 (79) T ss_pred CEEEEEEEECCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEEEEEEECC-CHHHHHHHHHHHHHHHCCCCCEEEEEEEEEC T ss_conf 979999997896728279999999986596566715876699999829-9899999999999986397654558999979 No 5 >PRK06423 phosphoribosylformylglycinamidine synthase; Provisional Probab=99.95 E-value=1.4e-28 Score=187.44 Aligned_cols=72 Identities=29% Similarity=0.535 Sum_probs=67.0 Q ss_pred EEEEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCEEEEEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEE Q ss_conf 599999995886668778999999862886420000230189999738998999999999999847976124799999 Q gi|254780972|r 2 IKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVIEDYDIKV 79 (84) Q Consensus 2 ~k~~V~V~lK~gVlDPqG~aV~~aL~~lG~~~v~~vr~GK~iei~i~~~~~~~a~~~v~~~c~~lLaNpvIE~y~i~i 79 (84) ||++|+|+||||||||||+||++||+.|||++|++||+||+|+|+.++ ++++++||++||||||||+|+|+. T Consensus 1 MKa~V~V~lK~gVlDPqG~aI~~aL~~LGf~gV~~Vr~gK~ield~~~------~~ev~emc~kLLaNpVIE~Y~iE~ 72 (73) T PRK06423 1 MKFKVEVTYKPGVEDPEALTILKNLNILGYNGIKGVSISKVYYFDADS------YNEVDEIAGKILTNPVIHSYKIER 72 (73) T ss_pred CEEEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCEEEEEEEEEECCH------HHHHHHHHHHHHCCCCEEEEEEEC T ss_conf 937999996798838328999999985494554305777799997763------899999999872686412578741 No 6 >PRK05783 hypothetical protein; Provisional Probab=99.94 E-value=2.5e-26 Score=174.36 Aligned_cols=82 Identities=16% Similarity=0.374 Sum_probs=79.9 Q ss_pred CEEEEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCEEEEEEEEEEEECCCCHHHHHHHHHHHHHHH-CCCCCEEEEEEEE Q ss_conf 959999999588666877899999986288642000023018999973899899999999999984-7976124799999 Q gi|254780972|r 1 MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESICQNL-LANPVIEDYDIKV 79 (84) Q Consensus 1 m~k~~V~V~lK~gVlDPqG~aV~~aL~~lG~~~v~~vr~GK~iei~i~~~~~~~a~~~v~~~c~~l-LaNpvIE~y~i~i 79 (84) +|++.|.|++||||+||||+||+++|..+|++++.+||+||++.|+++++|+++|.+.+++||++| |+||+||+|.+++ T Consensus 2 ~y~v~v~I~~K~gi~DPeG~TI~~~L~~~g~~~v~~vR~GK~l~~~iea~s~eeA~~~v~~ic~~lrL~NPvI~~~~i~v 81 (84) T PRK05783 2 RYAVELIITYKDGIRDPEGETIQRYVLERMLGYSIEVRAGKCLVFRIEASSPEEAQELALKLAKEMRLGNPIVHKIVVRV 81 (84) T ss_pred EEEEEEEEEECCCCCCCCHHHHHHHHHHHCCCCEEEEEEEEEEEEEEECCCHHHHHHHHHHHHHHHHCCCCCEEEEEEEE T ss_conf 59999999858977596337999999985589648987104999999479989999999999986203498528999999 Q ss_pred EEC Q ss_conf 971 Q gi|254780972|r 80 QKS 82 (84) Q Consensus 80 ~e~ 82 (84) +++ T Consensus 82 ~~~ 84 (84) T PRK05783 82 ERA 84 (84) T ss_pred ECC T ss_conf 629 No 7 >pfam02505 MCR_D Methyl-coenzyme M reductase operon protein D. Methyl coenzyme M reductase (MCR) catalyses the final step in methanogenesis. MCR is composed of three subunits, alpha (pfam02249), beta (pfam02241) and gamma (pfam02240). Genes encoding the beta (mcrB) and gamma (mcrG) subunits are separated by two open reading frames coding for two proteins C and D. The function of proteins C and D (this family) is unknown. Probab=86.47 E-value=1.3 Score=25.53 Aligned_cols=38 Identities=29% Similarity=0.650 Sum_probs=27.7 Q ss_pred CEEEEEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEEEE Q ss_conf 00023018999973899899999999999984797612479999997 Q gi|254780972|r 35 NQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVIEDYDIKVQK 81 (84) Q Consensus 35 ~~vr~GK~iei~i~~~~~~~a~~~v~~~c~~lLaNpvIE~y~i~i~e 81 (84) -.|.+|+.+ +++ +|.++..++++++|+++| | |.|++.+ T Consensus 70 L~V~VGrI~-vel--ed~~~~i~~I~eiC~e~~--p----f~y~i~~ 107 (153) T pfam02505 70 LKVKVGRII-VEL--EDDEEEIEKIEEICKELL--P----FGYEVRV 107 (153) T ss_pred EEEEEEEEE-EEE--CCHHHHHHHHHHHHHHHC--C----CCEEEEC T ss_conf 999982899-997--266888999999999757--9----8557420 No 8 >TIGR03260 met_CoM_red_D methyl-coenzyme M reductase operon protein D. Members of this protein family are protein D, a non-structural protein, of the operon for methyl coenzyme M reductase, also called coenzyme-B sulfoethylthiotransferase (EC 2.8.4.1). That enzyme, with alpha, beta, and gamma subunits, catalyzes the last step in methanogenesis; it has several modified sites, so accessory proteins are expected. Several methanogens have encode two such enzymes, designated I and II; this model does not separate the isozymes. Proteins in this family are expressed at much lower levels than the methyl-coenzyme M reductase itself and associate and have been shown to form at least transient associations. The precise function is unknown. Probab=73.72 E-value=7.1 Score=21.24 Aligned_cols=37 Identities=27% Similarity=0.588 Sum_probs=25.4 Q ss_pred CEEEEEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEEEE Q ss_conf 00023018999973899899999999999984797612479999997 Q gi|254780972|r 35 NQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVIEDYDIKVQK 81 (84) Q Consensus 35 ~~vr~GK~iei~i~~~~~~~a~~~v~~~c~~lLaNpvIE~y~i~i~e 81 (84) -.|.+|+.+ ++++ |+ +..++++++|+++|. |.|++.+ T Consensus 69 L~V~VGrI~-vele--d~-~~i~~I~eiC~e~~p------f~y~i~~ 105 (150) T TIGR03260 69 LRVQVGRII-LELE--DE-DIVEEIEEICKEMLP------FGYEVRV 105 (150) T ss_pred EEEEEEEEE-EEEC--CH-HHHHHHHHHHHHHCC------CCEEEEC T ss_conf 999983899-9972--76-689999999997579------8556321 No 9 >pfam07876 Dabb Stress responsive A/B Barrel Domain. The function of this family is unknown, but it is upregulated in response to salt stress in Populus balsamifera. It is also found at the C-terminus of an fructose 1,6-bisphosphate aldolase from Hydrogenophilus thermoluteolus. A member from Arthrobacter nicotinovorans is found in the pA01 plasmid, which encodes genes for molybdopterin uptake and degradation of plant alkaloid nicotine. The structure of one has been solved and the domain forms an a/b barrel dimer. Although there is a clear duplication within the domain it is not obviously detectable in the sequence. Probab=67.01 E-value=8.8 Score=20.68 Aligned_cols=40 Identities=23% Similarity=0.302 Sum_probs=34.3 Q ss_pred EEEEEEECCCCCCHHHHHHHHHHHHCC--CCCCCEEEEEEEE Q ss_conf 999999588666877899999986288--6420000230189 Q gi|254780972|r 4 ANVVVKLKKDVLDPQGKALKTALSNIG--FHNINQIRQGKIF 43 (84) Q Consensus 4 ~~V~V~lK~gVlDPqG~aV~~aL~~lG--~~~v~~vr~GK~i 43 (84) =.|..++|+++.+-|-+.+..+|..|. ..++..++.|+-+ T Consensus 3 HiVl~k~k~~~~~~~~~~~~~~l~~l~~~ip~i~~~~~G~~~ 44 (96) T pfam07876 3 HIVLFKFKDDVSEEEIAEVLEGLEALKGEIPGIKSIEVGRNV 44 (96) T ss_pred EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCC T ss_conf 999999899999999999999999864319971899997367 No 10 >COG4055 McrD Methyl coenzyme M reductase, subunit D [Coenzyme metabolism] Probab=66.75 E-value=9.3 Score=20.56 Aligned_cols=31 Identities=26% Similarity=0.635 Sum_probs=22.3 Q ss_pred CEEEEEEEEEEEECCCCHHHHHHHHHHHHHHHCC Q ss_conf 0002301899997389989999999999998479 Q gi|254780972|r 35 NQIRQGKIFDIEMDETLSDIAEEELESICQNLLA 68 (84) Q Consensus 35 ~~vr~GK~iei~i~~~~~~~a~~~v~~~c~~lLa 68 (84) -.|.+|+.+ ++++.++ +..+.++++|+++|- T Consensus 78 L~VkvGri~-~eie~e~--~~~e~ie~ic~e~lP 108 (165) T COG4055 78 LKVKVGRII-LEIEDED--ETMEKIEEICDEMLP 108 (165) T ss_pred EEEEEEEEE-EEECCCH--HHHHHHHHHHHHHCC T ss_conf 999860799-9964717--679999999997589 No 11 >cd07890 CYTH-like_AC_IV-like Adenylyl cyclase (AC) class IV-like, a subgroup of the CYTH-like superfamily. This subgroup contains class IV ACs and similar proteins. AC catalyzes the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. cAMP is a key signaling molecule which conveys a variety of signals in different cell types. In prokaryotes, cAMP is a catabolite derepression signal which triggers the expression of metabolic pathways including the lactose operon. Six non-homologous classes of ACs have been identified (I-VI). Class IV ACs are found in this group. In bacteria, the gene encoding Class IV AC has been designated cyaB and the protein as AC2. AC-IV occurs in addition to AC-I in bacterial pathogens such as Yersinia pestis (plague disease). The role of AC-IV is unknown but it has been speculated that it may be a factor in pathogenesis, perhaps providing cAMP for a secondary internal signaling function, or for secretion and uptake into host cells, where it may disrupt normal cel Probab=62.51 E-value=16 Score=19.11 Aligned_cols=53 Identities=25% Similarity=0.312 Sum_probs=41.4 Q ss_pred HHHHHHHHHHHCCCCCC-------------------CEEE-EEEEEEEEECCCCHHHHHHHHHHHHHHHCCCC Q ss_conf 78999999862886420-------------------0002-30189999738998999999999999847976 Q gi|254780972|r 18 QGKALKTALSNIGFHNI-------------------NQIR-QGKIFDIEMDETLSDIAEEELESICQNLLANP 70 (84) Q Consensus 18 qG~aV~~aL~~lG~~~v-------------------~~vr-~GK~iei~i~~~~~~~a~~~v~~~c~~lLaNp 70 (84) -+.+..+.|..|||..+ +.|- .|-++||++..++.+.+.+.+..+.+.+-... T Consensus 86 d~~~~~~iL~~lGf~~~~~v~K~R~~y~~~~~~i~lD~v~~lG~F~EiE~~~~~~~~~~~~l~~~~~~~~~~~ 158 (169) T cd07890 86 DPEAMKEILERLGFGPVGRVKKEREIYLLGQTRVHLDRVEGLGDFVEIEVVLEDIEEAEEGLGEAAELLGLLE 158 (169) T ss_pred CHHHHHHHHHHCCCEEEEEEEEEEEEEEECCEEEEEECCCCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCC T ss_conf 9899999998669817799999999999789999996668878889999983786899999999999828985 No 12 >PRK10850 phosphohistidinoprotein-hexose phosphotransferase component of PTS system (Hpr); Provisional Probab=54.81 E-value=22 Score=18.33 Aligned_cols=66 Identities=18% Similarity=0.228 Sum_probs=45.9 Q ss_pred CEEEEEEEEECCCCCC-HHHHHHHHHHHHCCCCCC-----------------CEEEEEEEEEEEECCCCHHHHHHHHHHH Q ss_conf 9599999995886668-778999999862886420-----------------0002301899997389989999999999 Q gi|254780972|r 1 MIKANVVVKLKKDVLD-PQGKALKTALSNIGFHNI-----------------NQIRQGKIFDIEMDETLSDIAEEELESI 62 (84) Q Consensus 1 m~k~~V~V~lK~gVlD-PqG~aV~~aL~~lG~~~v-----------------~~vr~GK~iei~i~~~~~~~a~~~v~~~ 62 (84) |++-+|.|..+.|..= |.+.-++.+-.--+--.+ -+++.|..+++..+++|+++|.+.+.++ T Consensus 1 M~~~~vtV~n~~GLHARPAa~~v~~a~~f~s~I~l~~~~~~anakSi~~im~Lg~~~G~~i~i~a~G~De~~Al~~l~~l 80 (85) T PRK10850 1 MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKL 80 (85) T ss_pred CCEEEEEECCCCCCCHHHHHHHHHHHHHCCCEEEEEECCEEECHHHHHHHHHCCCCCCCEEEEEEECCCHHHHHHHHHHH T ss_conf 95589998289865352899999999628986999989999845849999974989989999999788999999999999 Q ss_pred HHHH Q ss_conf 9984 Q gi|254780972|r 63 CQNL 66 (84) Q Consensus 63 c~~l 66 (84) -.++ T Consensus 81 l~e~ 84 (85) T PRK10850 81 MAEL 84 (85) T ss_pred HHHC T ss_conf 9842 No 13 >PRK13782 phosphocarrier protein Chr; Provisional Probab=52.51 E-value=24 Score=18.11 Aligned_cols=63 Identities=21% Similarity=0.214 Sum_probs=44.7 Q ss_pred CEEEEEEEEECCCCCC-HHHHHHHHHHHHCCC-------CCC----------CEEEEEEEEEEEECCCCHHHHHHHHHHH Q ss_conf 9599999995886668-778999999862886-------420----------0002301899997389989999999999 Q gi|254780972|r 1 MIKANVVVKLKKDVLD-PQGKALKTALSNIGF-------HNI----------NQIRQGKIFDIEMDETLSDIAEEELESI 62 (84) Q Consensus 1 m~k~~V~V~lK~gVlD-PqG~aV~~aL~~lG~-------~~v----------~~vr~GK~iei~i~~~~~~~a~~~v~~~ 62 (84) |+.-+|.|+.+.|..- |.+.-++.+-.--.- ..+ -.++.|..+++..+++|+++|.+.+..+ T Consensus 1 M~~~~v~I~n~~GLHARPAa~lv~~a~~f~s~I~l~~~~~~~naKSil~lm~Lg~~~G~~i~i~a~G~De~~Al~~l~~l 80 (85) T PRK13782 1 MVQKRVEVSLKTGLQARPAALFVQEANRFHADIFIEKDGKKVNAKSIMGLMSLAIGTGSMITIITEGSDEEEALEALAAY 80 (85) T ss_pred CCEEEEEECCCCCCCHHHHHHHHHHHHCCCCEEEEEECCEEECHHHHHHHHHCCCCCCCEEEEEEECCCHHHHHHHHHHH T ss_conf 96689998689976560899999999728986999989999835829999851778989999999788999999999999 Q ss_pred H Q ss_conf 9 Q gi|254780972|r 63 C 63 (84) Q Consensus 63 c 63 (84) - T Consensus 81 i 81 (85) T PRK13782 81 V 81 (85) T ss_pred H T ss_conf 8 No 14 >PRK05297 phosphoribosylformylglycinamidine synthase; Provisional Probab=52.29 E-value=25 Score=18.09 Aligned_cols=67 Identities=15% Similarity=0.242 Sum_probs=49.1 Q ss_pred EEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCEEEEEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEE Q ss_conf 999999588666877899999986288642000023018999973899899999999999984797612479 Q gi|254780972|r 4 ANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVIEDY 75 (84) Q Consensus 4 ~~V~V~lK~gVlDPqG~aV~~aL~~lG~~~v~~vr~GK~iei~i~~~~~~~a~~~v~~~c~~lLaNpvIE~y 75 (84) ..++|.|+.|..-|=..-...-.++.|+..|..+.-|..|.+.-...+.++. .....+|..+..|.. T Consensus 72 ~~~~v~pr~~~~spwss~a~~i~~~~gl~~v~rier~~~~~~~~~~~~~~~~-----~~~~~~~~Drmte~~ 138 (1294) T PRK05297 72 RLFLVTPRLGTISPWSSKATDIAHNCGLQGIRRIERGIAYYVGAKALTAEQL-----AAVAALLHDRMTESV 138 (1294) T ss_pred CEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEEEEEEEEECCCCCHHHH-----HHHHHHCCCCCCCEE T ss_conf 5799979999878345569999997698553478525799983688777899-----987875158666144 No 15 >TIGR01003 PTS_HPr_family phosphocarrier, HPr family; InterPro: IPR005698 Phosphocarrier HPr protein, a small cytoplasmic protein, is a component of the phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) major carbohydrate transport system in bacteria , . The phosphoryl group from phosphoenolpyruvate (PEP) is transferred to HPr, the phosphoryl carrier protein, by enzyme I. Phospho-HPr then transfers it to the permease. In some bacteria HPr is a domain in a larger protein that includes a EIII(Fru) (IIA) domain and in some cases also a EI domain. The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) is a major carbohydrate transport system in bacteria. The PTS catalyses the phosphorylation of sugar substrates during their translocation across the cell membrane. The mechanism involves the transfer of a phosphoryl group from phosphoenolpyruvate (PEP) via enzyme I (EI) to enzyme II (EII) of the PTS system, which in turn transfers it to a phosphocarrier protein (HPr) , . There is a conserved histidine in the N-terminus of HPr, which serves as an acceptor for the phosphoryl group of EI. In the central part of HPr there is a conserved serine which, in Gram-positive bacteria only, is phosphorylated by an ATP-dependent protein kinase; a process which probably play a regulatory role in sugar transport.; GO: 0005351 sugar:hydrogen ion symporter activity, 0009401 phosphoenolpyruvate-dependent sugar phosphotransferase system. Probab=47.01 E-value=22 Score=18.37 Aligned_cols=62 Identities=24% Similarity=0.288 Sum_probs=40.2 Q ss_pred CEEEEEEEEECCCCCC-HHHHHHHHH--------HHHCCCCCC----------CEEEEEEEEEEEECCCCHHHHHHHHHH Q ss_conf 9599999995886668-778999999--------862886420----------000230189999738998999999999 Q gi|254780972|r 1 MIKANVVVKLKKDVLD-PQGKALKTA--------LSNIGFHNI----------NQIRQGKIFDIEMDETLSDIAEEELES 61 (84) Q Consensus 1 m~k~~V~V~lK~gVlD-PqG~aV~~a--------L~~lG~~~v----------~~vr~GK~iei~i~~~~~~~a~~~v~~ 61 (84) |.+.++.|.-+-|+.= |.+.=|+.+ |...|=..| =.+..|-.+.+.++++|+++|.+.+.+ T Consensus 1 M~~~~~~I~n~~GLHARPAa~lv~~a~~F~s~~~l~~~GG~~vNAKSim~~M~LaA~~G~~v~~~~~G~De~eA~~~l~~ 80 (83) T TIGR01003 1 MLSKEVTIKNKVGLHARPAAKLVKLASGFDSEITLTKNGGKEVNAKSIMGIMMLAAGQGTEVTVTAEGEDEEEALEALAK 80 (83) T ss_pred CCEEEEEEECCCCCCCCHHHHHHHHHCCCCCCEEEEECCCCEECHHHHHHHHHHCCCCCCEEEEEEECCHHHHHHHHHHH T ss_conf 95258897439876303588999986078871799856992452633666898435889879999818168999999999 Q ss_pred H Q ss_conf 9 Q gi|254780972|r 62 I 62 (84) Q Consensus 62 ~ 62 (84) + T Consensus 81 l 81 (83) T TIGR01003 81 L 81 (83) T ss_pred H T ss_conf 8 No 16 >cd00367 PTS-HPr_like Histidine-containing phosphocarrier protein (HPr)-like proteins. HPr is a central component of the bacterial phosphoenolpyruvate sugar phosphotransferase system (PTS). The PTS catalyses the phosphorylation of sugar substrates during their translocation across the cell membrane. The phosphoryl group from phosphoenolpyruvate is transferred to HPr by enzyme I (EI). Phospho-HPr then transfers the phosphoryl group to one of several sugar-specific phosphoprotein intermediates. The conserved histidine in the N-terminus of HPr serves as an acceptor for the phosphoryl group of EI. In addition to the phosphotransferase proteins HPr and E1, this family also includes the closely related Carbon Catabolite Repressor (CCR) proteins which use the same phosphorylation mechanism and interact with transcriptional regulators to control expression of genes coding for utilization of less favored carbon sources. Probab=43.00 E-value=31 Score=17.55 Aligned_cols=27 Identities=19% Similarity=0.254 Sum_probs=22.6 Q ss_pred EEEEEEEEEEEECCCCHHHHHHHHHHH Q ss_conf 002301899997389989999999999 Q gi|254780972|r 36 QIRQGKIFDIEMDETLSDIAEEELESI 62 (84) Q Consensus 36 ~vr~GK~iei~i~~~~~~~a~~~v~~~ 62 (84) +++.|..+++..+++|+++|.+.+.++ T Consensus 50 ~~~~G~~i~i~~~G~De~~Al~~l~~l 76 (77) T cd00367 50 GAKQGDEITLSAEGEDAEEALEALAEL 76 (77) T ss_pred CCCCCCEEEEEEECCCHHHHHHHHHHH T ss_conf 779999999999786899999999975 No 17 >pfam00381 PTS-HPr PTS HPr component phosphorylation site. Probab=37.96 E-value=42 Score=16.77 Aligned_cols=28 Identities=21% Similarity=0.241 Sum_probs=23.3 Q ss_pred EEEEEEEEEEEECCCCHHHHHHHHHHHH Q ss_conf 0023018999973899899999999999 Q gi|254780972|r 36 QIRQGKIFDIEMDETLSDIAEEELESIC 63 (84) Q Consensus 36 ~vr~GK~iei~i~~~~~~~a~~~v~~~c 63 (84) +++.|-.+++..+++|+++|.+.+.++- T Consensus 53 ~~~~G~~v~v~~~G~de~~Al~~l~~~~ 80 (83) T pfam00381 53 GAKQGDEITISAEGEDAEEALEALAELL 80 (83) T ss_pred CCCCCCEEEEEEECCCHHHHHHHHHHHH T ss_conf 8789999999997888999999999999 No 18 >PRK09213 purine operon repressor; Provisional Probab=35.54 E-value=46 Score=16.54 Aligned_cols=44 Identities=20% Similarity=0.384 Sum_probs=30.7 Q ss_pred HHHHHHHHHCCCCCCCEEE---EEEEEEEEECCCCHHHHHHHHHHHHHHH Q ss_conf 9999998628864200002---3018999973899899999999999984 Q gi|254780972|r 20 KALKTALSNIGFHNINQIR---QGKIFDIEMDETLSDIAEEELESICQNL 66 (84) Q Consensus 20 ~aV~~aL~~lG~~~v~~vr---~GK~iei~i~~~~~~~a~~~v~~~c~~l 66 (84) .-|++++...|...+.-+. =|=+| +..-.+++|++-++++|++| T Consensus 45 ~iik~~f~~~g~G~leTv~GaaGGv~y---iP~~~~~~~~~fl~~l~~~L 91 (274) T PRK09213 45 VIIKETFEKQGIGTLETIPGAAGGVKY---IPYISEEEAREFVEELCERL 91 (274) T ss_pred HHHHHHHHHCCCCEEEEECCCCCCEEE---EECCCHHHHHHHHHHHHHHH T ss_conf 999999987398549980587787499---70679899999999999984 No 19 >COG1437 CyaB Adenylate cyclase, class 2 (thermophilic) [Nucleotide transport and metabolism] Probab=33.85 E-value=49 Score=16.38 Aligned_cols=62 Identities=27% Similarity=0.454 Sum_probs=40.7 Q ss_pred EEEEECCCCCCHHH-------------HHHHHHHHHCCCCCCCEEE--------------------EEEEEEEEECCCCH Q ss_conf 99995886668778-------------9999998628864200002--------------------30189999738998 Q gi|254780972|r 6 VVVKLKKDVLDPQG-------------KALKTALSNIGFHNINQIR--------------------QGKIFDIEMDETLS 52 (84) Q Consensus 6 V~V~lK~gVlDPqG-------------~aV~~aL~~lG~~~v~~vr--------------------~GK~iei~i~~~~~ 52 (84) +++++|.-.+|-.. ....+-|.+|||..+..|+ .|.+++|++..+++ T Consensus 62 ~~lTYKgp~ld~~~k~r~E~E~~v~D~~~~~~il~~LGF~~~~~VkK~R~iY~~~~~~i~lD~VegLG~F~EIE~~~~d~ 141 (178) T COG1437 62 VFLTYKGPKLDRESKTREEIEIEVSDVEKALEILKRLGFKEVAVVKKTREIYKVGNVTIELDAVEGLGDFLEIEVMVDDE 141 (178) T ss_pred EEEEEECCCCCCCCCCEEEEEEEECCHHHHHHHHHHCCCCEEEEEEEEEEEEEECCEEEEEECCCCCCCCEEEEEECCCC T ss_conf 89998566556654310047998679899999999839854258999999886187899985236776628999962880 Q ss_pred HH---HHHHHHHHHHHH-C Q ss_conf 99---999999999984-7 Q gi|254780972|r 53 DI---AEEELESICQNL-L 67 (84) Q Consensus 53 ~~---a~~~v~~~c~~l-L 67 (84) .+ +.+.+..+.++| | T Consensus 142 ~e~~~~~~~~~~i~~~lGl 160 (178) T COG1437 142 NEIDGAKEEIEEIARQLGL 160 (178) T ss_pred HHHHHHHHHHHHHHHHHCC T ss_conf 3567789999999998299 No 20 >TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase; InterPro: IPR010167 This entry represents a clade of amino-acid N-acetyltransferases, or N-acetylglutamate synthase, which is the product of the argA gene and the first enzyme in arginine biosynthesis. This enzyme displays more diversity between bacteria, fungi and mammals than other enzymes in arginine metabolism, and N-acetylglutamate itself can have different roles in different taxonomic groups: in prokaryotes, lower eukaryotes and plants it is the first intermediate in arginine biosynthesis, while in vertebrates it is an allosteric cofactor for the first enzyme in the urea cycle . In bacteria, arginine can regulate ornithine biosynthesis via a feedback inhibition mechanism . This enzyme may also act on aspartate.; GO: 0004042 amino-acid N-acetyltransferase activity, 0006526 arginine biosynthetic process, 0005737 cytoplasm. Probab=31.28 E-value=19 Score=18.71 Aligned_cols=28 Identities=18% Similarity=0.342 Sum_probs=20.2 Q ss_pred EEEEEECCCCCCHHHHHHH--------HHHHHCCCC Q ss_conf 9999958866687789999--------998628864 Q gi|254780972|r 5 NVVVKLKKDVLDPQGKALK--------TALSNIGFH 32 (84) Q Consensus 5 ~V~V~lK~gVlDPqG~aV~--------~aL~~lG~~ 32 (84) -|++++.||++||.|+.+. ..+.++|-+ T Consensus 197 L~~~t~~~Gi~d~~G~l~~eL~pq~~~~~~~~l~~~ 232 (439) T TIGR01890 197 LIYFTEEPGILDADGKLVAELSPQEVESLVERLGEE 232 (439) T ss_pred EEEECCCCCCCCCCCHHHHHCCHHHHHHHHHHHCCC T ss_conf 454058887246565242324878999999985057 No 21 >PRK01146 DNA-directed RNA polymerase subunit L; Provisional Probab=30.71 E-value=48 Score=16.42 Aligned_cols=23 Identities=30% Similarity=0.599 Sum_probs=14.5 Q ss_pred EEEEEECCCCCCHHHHHHHHHHHHCC Q ss_conf 99999588666877899999986288 Q gi|254780972|r 5 NVVVKLKKDVLDPQGKALKTALSNIG 30 (84) Q Consensus 5 ~V~V~lK~gVlDPqG~aV~~aL~~lG 30 (84) .++|+.|.| +|| .||++|..+|. T Consensus 62 ~lyVRvKsG--~P~-~AIk~A~~rl~ 84 (111) T PRK01146 62 QIYVKVKSG--KPQ-SAIKRSIRKLS 84 (111) T ss_pred EEEEEECCC--CCH-HHHHHHHHHHH T ss_conf 699993489--907-99999999999 No 22 >cd04446 DEP_DEPDC4 DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in DEPDC4-like proteins. DEPDC4 is a DEP domain containing protein of unknown function. Probab=30.05 E-value=31 Score=17.49 Aligned_cols=26 Identities=27% Similarity=0.465 Sum_probs=20.7 Q ss_pred HHHHHHHHHHHHHHCCCCCEEEEEEE Q ss_conf 99999999999984797612479999 Q gi|254780972|r 53 DIAEEELESICQNLLANPVIEDYDIK 78 (84) Q Consensus 53 ~~a~~~v~~~c~~lLaNpvIE~y~i~ 78 (84) +-.+.++-.+|.+||-|-|||+..-+ T Consensus 51 dVtR~q~v~Lcq~fl~~~VfE~v~~k 76 (95) T cd04446 51 DVPRAKAVRLCQALMDCRVFEAVGTK 76 (95) T ss_pred CCCHHHHHHHHHHHHHCCCEECCCCC T ss_conf 87899999999999976920011331 No 23 >TIGR02303 HpaG-C-term 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase, C-terminal subunit; InterPro: IPR012684 This entry represents one of two subunits/domains of the bifunctional isomerase/decarboxylase involved in 4-hydroxyphenylacetate degradation . In Escherichia coli and some other species, this enzyme is encoded by a single polypeptide containing both this domain and the closely related N-terminal domain (IPR012686 from INTERPRO). In other species such as Pasteurella multocida, these domains are found as two separate proteins (usually as tandem genes). Together, these domains carry out the decarboxylation of 5-oxopent-3-ene-1,2,5-tricarboxylic acid (OPET) to 2-hydroxy-2,4-diene-1,7-dioate (HHDD) and the subsequent isomerization to 2-oxohept-3-ene-1,7-dioate (OHED).; GO: 0008704 5-carboxymethyl-2-hydroxymuconate delta-isomerase activity, 0018800 5-oxopent-3-ene-125-tricarboxylate decarboxylase activity. Probab=29.63 E-value=30 Score=17.58 Aligned_cols=29 Identities=17% Similarity=0.526 Sum_probs=22.5 Q ss_pred CCCCCEEEEEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEE Q ss_conf 6420000230189999738998999999999999847976124 Q gi|254780972|r 31 FHNINQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVIE 73 (84) Q Consensus 31 ~~~v~~vr~GK~iei~i~~~~~~~a~~~v~~~c~~lLaNpvIE 73 (84) -+++++||.|..+.++|++--+ |.|||.+ T Consensus 220 PKG~~dv~pGD~v~~eiEGvG~--------------L~N~i~~ 248 (249) T TIGR02303 220 PKGLSDVKPGDVVRLEIEGVGK--------------LENPIVS 248 (249) T ss_pred CCCCCCCCCCCEEEEEECCCCC--------------EECCCCC T ss_conf 8875223558789997700262--------------1031105 No 24 >cd04447 DEP_BRCC3 DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in BBRC3-like proteins. BBRC3, also known as DEPDC1B, is a DEP containing protein of unknown function. Probab=28.94 E-value=38 Score=17.04 Aligned_cols=24 Identities=25% Similarity=0.481 Sum_probs=20.3 Q ss_pred HHHHHHHHHHHHHHCCCCCEEEEE Q ss_conf 999999999999847976124799 Q gi|254780972|r 53 DIAEEELESICQNLLANPVIEDYD 76 (84) Q Consensus 53 ~~a~~~v~~~c~~lLaNpvIE~y~ 76 (84) +-.+.++-.+|.+||-|-|||+.. T Consensus 52 ~vtR~q~v~L~q~fl~~~vfE~V~ 75 (92) T cd04447 52 EVTRQQTVQLLKKFLKNHVIEDIK 75 (92) T ss_pred CCCHHHHHHHHHHHHHCCCEEECC T ss_conf 645999999999999779345466 No 25 >TIGR03241 arg_catab_astB succinylarginine dihydrolase. Members of this family are succinylarginine dihydrolase (EC 3.5.3.23), the second of five enzymes in the arginine succinyltransferase (AST) pathway. Probab=27.79 E-value=22 Score=18.41 Aligned_cols=24 Identities=33% Similarity=0.546 Sum_probs=11.8 Q ss_pred EECCCCCCHHHHHHHHHHHHCCCC Q ss_conf 958866687789999998628864 Q gi|254780972|r 9 KLKKDVLDPQGKALKTALSNIGFH 32 (84) Q Consensus 9 ~lK~gVlDPqG~aV~~aL~~lG~~ 32 (84) .++.||+-||-+--...|++|||. T Consensus 54 Gl~QGvlpPqeRP~~~~Lr~lGF~ 77 (443) T TIGR03241 54 GFKQGVLPPQERPDIPVLRRLGFS 77 (443) T ss_pred CCCCCCCCCCCCCCHHHHHHHCCC T ss_conf 886503699889880789982889 No 26 >KOG1907 consensus Probab=27.22 E-value=64 Score=15.71 Aligned_cols=66 Identities=18% Similarity=0.375 Sum_probs=49.4 Q ss_pred EEEEEECCCCCCHHHHHHHHHHHHCCCCCCCEEEEEEEEEEEECCC-CHHHHHHHH----HHHHHHHCCCC Q ss_conf 9999958866687789999998628864200002301899997389-989999999----99999847976 Q gi|254780972|r 5 NVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDET-LSDIAEEEL----ESICQNLLANP 70 (84) Q Consensus 5 ~V~V~lK~gVlDPqG~aV~~aL~~lG~~~v~~vr~GK~iei~i~~~-~~~~a~~~v----~~~c~~lLaNp 70 (84) .|+|.|+.|+.-|-.....+-.+..|++.|..+.-|..|.+..... ++..+++-+ ++|.+.|..|. T Consensus 85 ~ievgPR~~~~tpwstna~nI~~~cG~~dV~RiErg~rylv~~~e~~~e~~~~~f~~~~~DRMTe~ly~~~ 155 (1320) T KOG1907 85 NIEVGPRTGTITPWSTNATNIFEVCGYKDVERIERGIRYLVKFKEPLLENDVKEFLEILYDRMTEALYTNE 155 (1320) T ss_pred EEEEECCCCCCCCCCCCHHHHHHHCCHHHHHHHHHCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCC T ss_conf 37970567766602010158988607278888863104788725851158899999998988888874169 No 27 >pfam01883 DUF59 Domain of unknown function DUF59. This family includes prokaryotic proteins of unknown function. The family also includes PhaH from Pseudomonas putida. PhaH forms a complex with PhaF, PhaG, and PhaI, which hydroxylates phenylacetic acid to 2-hydroxyphenylacetic acid. So members of this family may all be components of ring hydroxylating complexes. Probab=26.79 E-value=65 Score=15.67 Aligned_cols=63 Identities=17% Similarity=0.383 Sum_probs=42.8 Q ss_pred CCCCCHHHHHHHHHHHHCCCCCCCEEEEE---EE-EEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEE Q ss_conf 86668778999999862886420000230---18-9999738998999999999999847976124799999 Q gi|254780972|r 12 KDVLDPQGKALKTALSNIGFHNINQIRQG---KI-FDIEMDETLSDIAEEELESICQNLLANPVIEDYDIKV 79 (84) Q Consensus 12 ~gVlDPqG~aV~~aL~~lG~~~v~~vr~G---K~-iei~i~~~~~~~a~~~v~~~c~~lLaNpvIE~y~i~i 79 (84) .+|.||+= ..++.+||+ +.++++. +. +.+++....-..+....+.+-+.+.+-|=+++-++++ T Consensus 10 ~~V~DPEl---~~~Iv~LGl--I~~i~v~~~g~v~I~~~lT~~~CP~~~~i~~~i~~~l~~v~gv~~V~V~l 76 (76) T pfam01883 10 KTVIDPEL---PVDIVDLGL--VYEVDIDDDGNVKVKMTLTTPGCPLADLIALDVREALLELPGVEDVEVEL 76 (76) T ss_pred HCCCCCCC---CCCCCCCCE--EEEEEECCCCEEEEEEEECCCCCCCHHHHHHHHHHHHHCCCCCEEEEEEC T ss_conf 27789999---978002453--68999857984999999589999837899999999998399940789979 No 28 >pfam04996 AstB Succinylarginine dihydrolase. This enzyme transforms N(2)-succinylglutamate into succinate and glutamate. This is the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway. Probab=26.28 E-value=24 Score=18.14 Aligned_cols=25 Identities=28% Similarity=0.546 Sum_probs=13.6 Q ss_pred EECCCCCCHHHHHHHHHHHHCCCCC Q ss_conf 9588666877899999986288642 Q gi|254780972|r 9 KLKKDVLDPQGKALKTALSNIGFHN 33 (84) Q Consensus 9 ~lK~gVlDPqG~aV~~aL~~lG~~~ 33 (84) .++.||+-||-+--...|++|||.+ T Consensus 55 G~~QgvlpPqeRP~~~~Lr~lGF~G 79 (439) T pfam04996 55 GLPQGVLPPHERPAAHVLRQLGFSG 79 (439) T ss_pred CCCCCCCCCCCCCCHHHHHHHCCCC T ss_conf 8865036998898827899838898 No 29 >PRK13281 succinylarginine dihydrolase; Provisional Probab=25.27 E-value=26 Score=17.98 Aligned_cols=25 Identities=32% Similarity=0.510 Sum_probs=13.6 Q ss_pred EECCCCCCHHHHHHHHHHHHCCCCC Q ss_conf 9588666877899999986288642 Q gi|254780972|r 9 KLKKDVLDPQGKALKTALSNIGFHN 33 (84) Q Consensus 9 ~lK~gVlDPqG~aV~~aL~~lG~~~ 33 (84) .++.||+-||-+--...|++|||.+ T Consensus 56 Gl~QgvlpPqeRP~~~~Lr~lGF~G 80 (443) T PRK13281 56 GFPQGVLPPQERPDLPALRRLGFSG 80 (443) T ss_pred CCCCCCCCCCCCCCHHHHHHHCCCC T ss_conf 8865016998898746899838898 No 30 >pfam11731 Cdd1 Pathogenicity locus. Cdd1 is expressed as part of the pathogenicity locus operon in several different orders of bacteria. Many members of the family are annotated as being putative mitomycin resistance proteins but this could not be confirmed. Probab=25.07 E-value=30 Score=17.60 Aligned_cols=21 Identities=29% Similarity=0.377 Sum_probs=18.6 Q ss_pred HHHHHHHHHHHCCCCCCCEEE Q ss_conf 789999998628864200002 Q gi|254780972|r 18 QGKALKTALSNIGFHNINQIR 38 (84) Q Consensus 18 qG~aV~~aL~~lG~~~v~~vr 38 (84) -|.++.+.|..||+.++.+++ T Consensus 20 IG~a~a~DL~~LGi~~~~~L~ 40 (92) T pfam11731 20 IGKATAKDLRLLGINSPAQLA 40 (92) T ss_pred CCHHHHHHHHHHCCCCHHHHH T ss_conf 469999999991899899991 No 31 >cd00273 Chemokine_CXC Chemokine_CXC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal cysteine residues; includes a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity; many members contain an RCxC motif which may be a general requirement for binding to CXC chemokine receptors; those with the ELR motif are chemotatic for neutrophils and have been shown to be angiogenic, while those without the motif act on T and B cells, and are typically angiostatic; exist as monomers and dimers, but are believed to be functional as monomers; found only in vertebrates and a few viruses. See CDs: Chemokine (cd00169) for the general alignment of chemokines, or Chemokine_CC (cd00272), Chemokine_C (cd00271), and Chemokine_CX3C (cd00274) for the additional chemokine subgroups. Probab=25.03 E-value=48 Score=16.42 Aligned_cols=27 Identities=15% Similarity=0.466 Sum_probs=22.1 Q ss_pred EEEEEEEECCC---CCCHHHHHHHHHHHHC Q ss_conf 99999995886---6687789999998628 Q gi|254780972|r 3 KANVVVKLKKD---VLDPQGKALKTALSNI 29 (84) Q Consensus 3 k~~V~V~lK~g---VlDPqG~aV~~aL~~l 29 (84) +.+|.+++|.| =|||++.-++.-+.++ T Consensus 33 ~~EIIatLK~g~~vCLnP~a~~vkkli~k~ 62 (64) T cd00273 33 NTEIIATLKNGRKVCLNPEAPWVQKIIKKL 62 (64) T ss_pred CCEEEEEECCCCEEEECCCCHHHHHHHHHH T ss_conf 818999971699898289977999999998 No 32 >COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Probab=22.61 E-value=30 Score=17.58 Aligned_cols=60 Identities=17% Similarity=0.294 Sum_probs=29.3 Q ss_pred ECCCCCCHHHHHHHHHHHHCCCCCCCEEEEEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCE Q ss_conf 588666877899999986288642000023018999973899899999999999984797612 Q gi|254780972|r 10 LKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVI 72 (84) Q Consensus 10 lK~gVlDPqG~aV~~aL~~lG~~~v~~vr~GK~iei~i~~~~~~~a~~~v~~~c~~lLaNpvI 72 (84) +|.||.|.....+-..|..+.-.. -.-||..++..+.-..+.++.-..+=--..|.||++ T Consensus 177 ~~~~vid~iA~~~~ell~~~~g~~---~~~~~~~~L~~~~~~~~~~~ps~~~~ll~~ItdP~v 236 (436) T COG1030 177 LRQGVIDLIARDLNELLKKLDGRS---RVAGKLVTLQTTNAPVETLEPSWRERLLNWITDPSV 236 (436) T ss_pred HHCCCCCCCCCCHHHHHHHCCCCC---CCCCCEEEEEECCCEEEECCCCHHHHHHHHHCCCHH T ss_conf 855940035587899998704775---556642798765714576486499999999617289 No 33 >pfam07540 NOC3p Nucleolar complex-associated protein. Nucleolar complex-associated protein (Noc3p) is conserved in eukaryotes and has essential roles in replication and rRNA processing in Saccharomyces cerevisiae. Probab=22.50 E-value=55 Score=16.06 Aligned_cols=17 Identities=35% Similarity=0.651 Sum_probs=10.3 Q ss_pred HHHHHHHHHHHHHCCCC Q ss_conf 99999999999847976 Q gi|254780972|r 54 IAEEELESICQNLLANP 70 (84) Q Consensus 54 ~a~~~v~~~c~~lLaNp 70 (84) ++++++..+|..++.|| T Consensus 3 ~~K~~IA~la~~I~edP 19 (95) T pfam07540 3 EAKEEIAELASKLLEDP 19 (95) T ss_pred HHHHHHHHHHHHHHHCH T ss_conf 78999999999998597 No 34 >KOG0817 consensus Probab=22.46 E-value=55 Score=16.07 Aligned_cols=25 Identities=28% Similarity=0.300 Sum_probs=21.3 Q ss_pred EECCCCCCHHHHHHHHHHHHCCCCC Q ss_conf 9588666877899999986288642 Q gi|254780972|r 9 KLKKDVLDPQGKALKTALSNIGFHN 33 (84) Q Consensus 9 ~lK~gVlDPqG~aV~~aL~~lG~~~ 33 (84) ..|||++|++|++==+|=+.+|--+ T Consensus 45 ~~kPg~~d~~~k~Kw~AW~~l~~~s 69 (142) T KOG0817 45 TPKPGFFDEEGKAKWQAWNSLGGMS 69 (142) T ss_pred CCCCCHHHHHHHHHHHHHHHCCCCC T ss_conf 9998612199999899998628999 No 35 >cd02978 KaiB_like KaiB-like family; composed of the circadian clock proteins, KaiB and the N-terminal KaiB-like sensory domain of SasA. KaiB is an essential protein in maintaining circadian rhythm. It was originally discovered from the cyanobacterium Synechococcus as part of the circadian clock gene cluster, kaiABC. KaiB attenuates KaiA-enhanced KaiC autokinase activity by interacting with KaiA-KaiC complexes in a circadian fashion. KaiB is membrane-associated as well as cytosolic. The amount of membrane-associated protein peaks in the evening (at circadian time (CT) 12-16) while the cytosolic form peaks later (at CT 20). The rhythmic localization of KaiB may function in regulating the formation of Kai complexes. SasA is a sensory histidine kinase which associates with KaiC. Although it is not an essential oscillator component, it is important in enhancing kaiABC expression and is important in metabolic growth control under day/night cycle conditions. SasA contains an N-terminal sensor Probab=22.37 E-value=79 Score=15.17 Aligned_cols=36 Identities=22% Similarity=0.358 Sum_probs=25.9 Q ss_pred EEEEECCC--CHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEC Q ss_conf 99997389--98999999999999847976124799999971 Q gi|254780972|r 43 FDIEMDET--LSDIAEEELESICQNLLANPVIEDYDIKVQKS 82 (84) Q Consensus 43 iei~i~~~--~~~~a~~~v~~~c~~lLaNpvIE~y~i~i~e~ 82 (84) +.+.+.+. ....|.+.++.+|++.|.. .|+++|.+. T Consensus 4 L~LyVaG~tp~S~~ai~nl~~i~e~~l~~----~y~LeVIDv 41 (72) T cd02978 4 LRLYVAGRTPKSERALQNLKRILEELLGG----PYELEVIDV 41 (72) T ss_pred EEEEECCCCHHHHHHHHHHHHHHHHHCCC----CEEEEEEEC T ss_conf 99998599978999999999999974799----668999883 No 36 >pfam00403 HMA Heavy-metal-associated domain. Probab=21.35 E-value=83 Score=15.04 Aligned_cols=31 Identities=16% Similarity=0.237 Sum_probs=16.0 Q ss_pred HHHHHHHHHHCCCCCCCEEEEE---EEEEEEECCCC Q ss_conf 8999999862886420000230---18999973899 Q gi|254780972|r 19 GKALKTALSNIGFHNINQIRQG---KIFDIEMDETL 51 (84) Q Consensus 19 G~aV~~aL~~lG~~~v~~vr~G---K~iei~i~~~~ 51 (84) ...|+++|.++ ++|.++++. +...+..+.+. T Consensus 13 ~~~Ie~~l~~~--~GV~~v~v~~~~~~~~V~~d~~~ 46 (62) T pfam00403 13 AKKVEKALSKL--PGVSSVSVDLETGKVTVTGDPDP 46 (62) T ss_pred HHHHHHHHHCC--CCCEEEEEECCCCEEEEEECCCC T ss_conf 99999998559--99549999878999999988998 No 37 >pfam09467 Yopt Hypothetical protein Yopt. This hypothetical protein is expressed in bacteria, particularly Bacillus subtilis. It forms homo-dimers, with each monomer consisting of one alpha helix and three beta strands. Probab=21.21 E-value=84 Score=15.03 Aligned_cols=44 Identities=20% Similarity=0.452 Sum_probs=30.3 Q ss_pred CCEEEEEEEEEEEECCCCHHHHHHHHHHHHHHHC-C--------CCCEEEEEE Q ss_conf 0000230189999738998999999999999847-9--------761247999 Q gi|254780972|r 34 INQIRQGKIFDIEMDETLSDIAEEELESICQNLL-A--------NPVIEDYDI 77 (84) Q Consensus 34 v~~vr~GK~iei~i~~~~~~~a~~~v~~~c~~lL-a--------NpvIE~y~i 77 (84) +.++-..--|.+.-.+++.+-.+..+..+|+.|| + .--+|+|+. T Consensus 4 lnnialnleivlknkadspevsetlvtricenlllskevsflkadgsvenfkl 56 (71) T pfam09467 4 LNNIALNLEIVLKNKADSPEVSETLVTRICENLLLSKEVSFLKADGSVENFKL 56 (71) T ss_pred HHCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHEECCCCEECEEE T ss_conf 10000202434514789803779999999998876634320123786212130 No 38 >TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase; InterPro: IPR010141 This entry represents a single-molecule form of phosphoribosylformylglycinamidine synthase, also called FGAM synthase, an enzyme of purine de novo biosynthesis, which represent a second clade of the enzymes found in Clostridia, Bifidobacteria and Streptococcus species. This enzyme performs the fourth step in IMP biosynthesis (the precursor of all purines) from PRPP.. Probab=20.65 E-value=86 Score=14.96 Aligned_cols=70 Identities=21% Similarity=0.375 Sum_probs=46.2 Q ss_pred EEEEEECCCCCCHHHHHHHHHH-HHCCCCCCCEEEEEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEE Q ss_conf 9999958866687789999998-62886420000230189999738998999999999999847976124799999 Q gi|254780972|r 5 NVVVKLKKDVLDPQGKALKTAL-SNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVIEDYDIKV 79 (84) Q Consensus 5 ~V~V~lK~gVlDPqG~aV~~aL-~~lG~~~v~~vr~GK~iei~i~~~~~~~a~~~v~~~c~~lLaNpvIE~y~i~i 79 (84) +|+|.=|+| .|=+++...+-| ++||..++++||+=-+|.+. |=++-++....+-.-.|+-|++-+-..++ T Consensus 2 rvFVEKK~g-F~v~a~~L~~~l~~~LG~~~l~~~Rivn~Ydv~----~l~~nke~f~~~~~~ilSE~~~D~v~~e~ 72 (1279) T TIGR01857 2 RVFVEKKAG-FDVEAQSLVKELRENLGLEALKDLRIVNKYDVF----DLEENKELFEKTVKTILSEPVVDRVLEEL 72 (1279) T ss_pred CEEEEECCC-CCHHHHHHHHHHHHHHCHHHHHHEEEEEEEEEC----CCHHHHHHHHHHCCCEECCCCCCCEEECC T ss_conf 068861789-885689999998875052420022034531106----70201466775206070585637200033 No 39 >pfam11812 DUF3333 Domain of unknown function (DUF3333). This family of proteins are functionally uncharacterized. This family is only found in bacteria. This presumed domain is typically between 116 to 159 amino acids in length. Probab=20.47 E-value=40 Score=16.87 Aligned_cols=77 Identities=18% Similarity=0.205 Sum_probs=38.6 Q ss_pred EEEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCEEEEEEEEEEEECCCCHH-HHHH-----HHHHHHHHHCCCCCE--EE Q ss_conf 999999958866687789999998628864200002301899997389989-9999-----999999984797612--47 Q gi|254780972|r 3 KANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSD-IAEE-----ELESICQNLLANPVI--ED 74 (84) Q Consensus 3 k~~V~V~lK~gVlDPqG~aV~~aL~~lG~~~v~~vr~GK~iei~i~~~~~~-~a~~-----~v~~~c~~lLaNpvI--E~ 74 (84) .+.+.|.+-+.++||.+..-.+.+..-+|..+-.=.+-+.|--.-+..+.. ++.+ ---++-+.+++||-+ .+ T Consensus 49 ~I~l~V~~d~~~id~~~~~~~~~l~~a~~~~~v~~al~~~fp~~~~~~~~~~~l~~liS~~a~~~lr~~v~~nP~lig~t 128 (155) T pfam11812 49 EITLEVTLDEEVLDPDGNRDPKKLSTANYRPLIKDALEELLPEVGDRSDLRSDLYSLISEGAAAQLRDFVLANPELIGTT 128 (155) T ss_pred EEEEEEEECHHHCCCCCCCCHHHHHHCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHCHHHCCCE T ss_conf 88888882899919889999999985659999999999867653323688999999815538999999999598973985 Q ss_pred EEEEE Q ss_conf 99999 Q gi|254780972|r 75 YDIKV 79 (84) Q Consensus 75 y~i~i 79 (84) .++.+ T Consensus 129 ~~~~~ 133 (155) T pfam11812 129 VTFWL 133 (155) T ss_pred EEEEE T ss_conf 99998 No 40 >PRK12893 allantoate amidohydrolase; Reviewed Probab=20.19 E-value=66 Score=15.61 Aligned_cols=38 Identities=21% Similarity=0.471 Sum_probs=22.3 Q ss_pred CCCCHHHHHHHHHHHHCCCCCCCEEEE---EEEEEEEECCC Q ss_conf 666877899999986288642000023---01899997389 Q gi|254780972|r 13 DVLDPQGKALKTALSNIGFHNINQIRQ---GKIFDIEMDET 50 (84) Q Consensus 13 gVlDPqG~aV~~aL~~lG~~~v~~vr~---GK~iei~i~~~ 50 (84) ...|..|.++.++|.+.|+.+-...+. .=|+|+.|+-. T Consensus 155 ~~~D~~G~tl~~al~~~G~~~~~~~~~~~i~a~lElHIEQG 195 (408) T PRK12893 155 ARRDADGVTLGEALARIGYRGTARVGGRAVDAYFELHIEQG 195 (408) T ss_pred HHHCCCCCCHHHHHHHCCCCCCCCCCCCCCCEEEEEEECCC T ss_conf 40077887699999975887644577435306999985267 Done!