RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780972|ref|YP_003065385.1| phosphoribosylformylglycinamidine synthase, PurS protein [Candidatus Liberibacter asiaticus str. psy62] (84 letters) >gnl|CDD|180332 PRK05974, PRK05974, phosphoribosylformylglycinamidine synthase subunit PurS; Reviewed. Length = 80 Score = 105 bits (265), Expect = 2e-24 Identities = 37/80 (46%), Positives = 58/80 (72%) Query: 2 IKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELES 61 K V V LK+ VLDPQG+A+K AL ++G+ + +RQGK F++E++ + AE +L+ Sbjct: 1 YKVKVTVTLKEGVLDPQGQAIKGALGSLGYDGVEDVRQGKYFELELEGESEEKAEADLKE 60 Query: 62 ICQNLLANPVIEDYDIKVQK 81 +C+ LLANPVIEDY I++++ Sbjct: 61 MCEKLLANPVIEDYRIEIEE 80 >gnl|CDD|129402 TIGR00302, TIGR00302, phosphoribosylformylglycinamidine synthase, purS protein. In species such as Bacillus subtilis in which FGAM synthetase is split into two ORFs purL and purQ, this small protein, previously called yexA, is required for FGAM synthetase activity. Although the article does not make it clear whether this is a subunit or an accessory protein, it is encoded as part of the operon, which suggests stochiometric amounts, = subunit. Length = 80 Score = 83.6 bits (207), Expect = 1e-17 Identities = 32/79 (40%), Positives = 56/79 (70%) Query: 3 KANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESI 62 K V ++LKK VLDP+G A++ AL+ +G++ + +R GK+ ++ ++ + E E+E + Sbjct: 2 KVEVYIRLKKGVLDPEGAAIQRALALLGYNEVKDVRTGKVIELTIEADSEEAVEREVEEM 61 Query: 63 CQNLLANPVIEDYDIKVQK 81 C+ LLANPVI DYDI++++ Sbjct: 62 CEKLLANPVIHDYDIEIEE 80 >gnl|CDD|102368 PRK06423, PRK06423, phosphoribosylformylglycinamidine synthase; Provisional. Length = 73 Score = 42.2 bits (99), Expect = 3e-05 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 6/76 (7%) Query: 2 IKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELES 61 +K V V K V DP+ + L+ +G++ I + K++ + D E++ Sbjct: 1 MKFKVEVTYKPGVEDPEALTILKNLNILGYNGIKGVSISKVYYFDADS------YNEVDE 54 Query: 62 ICQNLLANPVIEDYDI 77 I +L NPVI Y I Sbjct: 55 IAGKILTNPVIHSYKI 70 >gnl|CDD|151809 pfam11369, DUF3160, Protein of unknown function (DUF3160). This family of proteins has no known function. Length = 637 Score = 27.8 bits (62), Expect = 0.64 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 5/39 (12%) Query: 42 IFDIEMDETLSDIAEEE----LESICQNLLANPVIEDYD 76 ++ I+ DETL + EEE L + + LL N IEDY+ Sbjct: 53 LYHIQFDETLRQLEEEEFYPALWKLDKALL-NASIEDYN 90 >gnl|CDD|162633 TIGR01973, NuoG, NADH-quinone oxidoreductase, chain G. This model represents the G subunit (one of 14: A->N) of the NADH-quinone oxidoreductase complex I which generally couples NADH and ubiquinone oxidation/reduction in bacteria and mammalian mitochondria while translocating protons, but may act on NADPH and/or plastoquinone in cyanobacteria and plant chloroplasts. This model excludes related subunits from formate dehydrogenase complexes. Length = 603 Score = 26.9 bits (60), Expect = 1.3 Identities = 17/68 (25%), Positives = 23/68 (33%), Gaps = 7/68 (10%) Query: 9 KLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDI--EMDETLSDIAEEELESICQNL 66 +L+K V K AL I N+ + + L DIA I L Sbjct: 383 RLRKAVK---KGGAKVALIGIEKWNLTYPANTNLVFHPGLSPKKLDDIASGAHSDIAAAL 439 Query: 67 LA--NPVI 72 A P+I Sbjct: 440 KAAKKPLI 447 >gnl|CDD|181739 PRK09266, PRK09266, hypothetical protein; Provisional. Length = 266 Score = 26.1 bits (58), Expect = 2.1 Identities = 9/22 (40%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Query: 13 DVL--DPQGKALKTALSNIGFH 32 D L DP G+ + A N+GF Sbjct: 155 DALFVDPDGRVSEGATWNLGFW 176 >gnl|CDD|131395 TIGR02342, chap_CCT_delta, T-complex protein 1, delta subunit. Members of this family, all eukaryotic, are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC. The archaeal equivalent group II chaperonin is often called the thermosome. Both are somewhat related to the group I chaperonin of bacterial, GroEL/GroES. This family consists exclusively of the CCT delta chain (part of a paralogous family) from animals, plants, fungi, and other eukaryotes. Length = 517 Score = 25.1 bits (55), Expect = 4.3 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 12/71 (16%) Query: 4 ANVVVKLKK---DVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELE 60 N+V K+KK +VL Q L+ A++++ H + ++ KI ++ DI EE+E Sbjct: 263 LNIVKKIKKTGCNVLLIQKSILRDAVNDLALHFLAKM---KIMVVK------DIEREEVE 313 Query: 61 SICQNLLANPV 71 IC+ + P+ Sbjct: 314 FICKTIGCKPI 324 >gnl|CDD|149696 pfam08718, GLTP, Glycolipid transfer protein (GLTP). GLTP is a cytosolic protein that catalyses the intermembrane transfer of glycolipids. Length = 148 Score = 24.5 bits (54), Expect = 6.5 Identities = 16/62 (25%), Positives = 25/62 (40%), Gaps = 9/62 (14%) Query: 14 VLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELE--------SICQN 65 + D G A +I NI ++ + D E +TL D+ +E E S + Sbjct: 18 LFDKLGTAFSFVKKDIV-GNITKLEKRYESDPEKYKTLQDLVLKEKENGLAKKKNSGTRG 76 Query: 66 LL 67 LL Sbjct: 77 LL 78 >gnl|CDD|180486 PRK06246, PRK06246, fumarate hydratase; Provisional. Length = 280 Score = 24.4 bits (54), Expect = 6.9 Identities = 20/63 (31%), Positives = 27/63 (42%), Gaps = 13/63 (20%) Query: 2 IKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELES 61 I+AN L DV + KA + S IG + I +E E IA+EE Sbjct: 18 IEANYY--LPDDVKEALKKAYEKEESPIGKEILKAI-------LENAE----IAKEEQVP 64 Query: 62 ICQ 64 +CQ Sbjct: 65 LCQ 67 >gnl|CDD|129062 smart00829, PKS_ER, Enoylreductase. Enoylreductase in Polyketide synthases. Length = 288 Score = 24.3 bits (54), Expect = 8.0 Identities = 5/25 (20%), Positives = 12/25 (48%) Query: 11 KKDVLDPQGKALKTALSNIGFHNIN 35 K+D+ D + N+ +H ++ Sbjct: 206 KRDIRDNSQLGMAPFRRNVSYHAVD 230 >gnl|CDD|183643 PRK12642, flgF, flagellar basal body rod protein FlgF; Reviewed. Length = 241 Score = 23.9 bits (52), Expect = 9.4 Identities = 9/38 (23%), Positives = 15/38 (39%) Query: 14 VLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETL 51 L+P G + N Q+ +F+I+ D L Sbjct: 128 QLNPGGGEPTIGADGAIYQNGVQVGAIGLFEIDADAGL 165 >gnl|CDD|178591 PLN03017, PLN03017, trehalose-phosphatase. Length = 366 Score = 23.8 bits (51), Expect = 9.6 Identities = 13/32 (40%), Positives = 18/32 (56%) Query: 18 QGKALKTALSNIGFHNINQIRQGKIFDIEMDE 49 +GKAL+ L ++GF N N + I D DE Sbjct: 284 KGKALEFLLESLGFGNTNNVFPVYIGDDRTDE 315 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.313 0.132 0.349 Gapped Lambda K H 0.267 0.0761 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,324,363 Number of extensions: 71940 Number of successful extensions: 144 Number of sequences better than 10.0: 1 Number of HSP's gapped: 143 Number of HSP's successfully gapped: 30 Length of query: 84 Length of database: 5,994,473 Length adjustment: 53 Effective length of query: 31 Effective length of database: 4,849,249 Effective search space: 150326719 Effective search space used: 150326719 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.0 bits)