RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780972|ref|YP_003065385.1| phosphoribosylformylglycinamidine synthase, PurS protein [Candidatus Liberibacter asiaticus str. psy62] (84 letters) >2yx5_A UPF0062 protein MJ1593; anti parallel beta sheet, NPPSFA, national project on protein structural and functional analyses; 2.30A {Methanocaldococcus jannaschii} (A:) Length = 83 Score = 100 bits (250), Expect = 1e-22 Identities = 38/81 (46%), Positives = 61/81 (75%) Query: 1 MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELE 60 M KA V++KLKK VL+P+G+ ++ AL+ +GF+N+ +++ K+ DI M+ + +EE+E Sbjct: 1 MYKATVIIKLKKGVLNPEGRTIQRALNFLGFNNVKEVQTYKMIDIIMEGENEEKVKEEVE 60 Query: 61 SICQNLLANPVIEDYDIKVQK 81 +C+ LLANPVI DY+IKV+K Sbjct: 61 EMCKKLLANPVIHDYEIKVEK 81 >1vq3_A Phosphoribosylformylglycinamidine synthase, PURS subunit; TM1244, PURS subunit (EC 6.3.5.3), structural genomics; 1.90A {Thermotoga maritima MSB8} (A:) Length = 94 Score = 99.3 bits (248), Expect = 2e-22 Identities = 21/79 (26%), Positives = 45/79 (56%) Query: 1 MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELE 60 + K + V+ + +V DP+G+ ++ L + ++R GK +E++ + A E ++ Sbjct: 15 LFKFAIDVQYRSNVRDPRGETIERVLREEKGLPVKKLRLGKSIHLEVEAENKEKAYEIVK 74 Query: 61 SICQNLLANPVIEDYDIKV 79 C+ LL NPV+E+Y+++ Sbjct: 75 KACEELLVNPVVEEYEVRE 93 >2zw2_A Putative uncharacterized protein STS178; purine metabolism, ligase; 1.55A {Sulfolobus tokodaii} (A:) Length = 92 Score = 98.1 bits (245), Expect = 3e-22 Identities = 15/82 (18%), Positives = 40/82 (48%), Gaps = 1/82 (1%) Query: 1 MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELE 60 + + +++ K+ V DP+G+ ++ + + I + R GK ++ + A E ++ Sbjct: 5 LYRVELIITNKEGVRDPEGETIQRYVVSRFSDKIIETRAGKYLVFRVNSSSQQEATELVK 64 Query: 61 SICQNL-LANPVIEDYDIKVQK 81 + + L NP++ +I+ + Sbjct: 65 KLADEMRLYNPIVHKIEIRANR 86 >1gtd_A MTH169; synthetase, FGAM synthetase, purine synthesis pathway, PSI, protein structure initiative, NESG; 2.56A {Methanobacterium thermoautotrophicum} (A:) Length = 85 Score = 95.0 bits (237), Expect = 3e-21 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 1/81 (1%) Query: 4 ANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESIC 63 V ++LKK L+P+ ++ AL+ +G+ + + DE + E E+E C Sbjct: 5 VEVRIRLKKGXLNPEAATIERALALLGY-EVEDTDTTDVITFTXDEDSLEAVEREVEDXC 63 Query: 64 QNLLANPVIEDYDIKVQKSSS 84 Q LL NPVI DYD+ + + SS Sbjct: 64 QRLLCNPVIHDYDVSINEXSS 84 >1t4a_A PURS; tetramer, complex formyl glycinamide synthetase, FGAR, FGAM, structural protein; 2.00A {Bacillus subtilis} (A:) Length = 84 Score = 93.5 bits (233), Expect = 1e-20 Identities = 28/79 (35%), Positives = 49/79 (62%), Gaps = 1/79 (1%) Query: 3 KANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESI 62 K V V LK+ VLDPQG A++ AL + ++ + +R GK ++ ++++ + ++ Sbjct: 3 KVKVYVSLKESVLDPQGSAVQHALHSXTYNEVQDVRIGKYXELTIEKS-DRDLDVLVKEX 61 Query: 63 CQNLLANPVIEDYDIKVQK 81 C+ LLAN VIEDY +V++ Sbjct: 62 CEKLLANTVIEDYRYEVEE 80 >2dgb_A Hypothetical protein PURS; purine, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.10A {Thermus thermophilus} PDB: 2cuw_A (A:) Length = 84 Score = 86.9 bits (216), Expect = 9e-19 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 2/79 (2%) Query: 3 KANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESI 62 +A ++++LKK +LDPQG+A++ L ++G + ++R GK+ +I A EE Sbjct: 5 QATLLIELKKGILDPQGRAVEGVLKDLGH-PVEEVRVGKVLEIVFPAENLLEA-EEKAKA 62 Query: 63 CQNLLANPVIEDYDIKVQK 81 LLANPV E Y ++ K Sbjct: 63 XGALLANPVXEVYALEALK 81 >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} (A:) Length = 66 Score = 26.5 bits (58), Expect = 1.3 Identities = 3/25 (12%), Positives = 9/25 (36%) Query: 48 DETLSDIAEEELESICQNLLANPVI 72 + + ++ C +L +P Sbjct: 6 SGFVKTVEDKYKCEKCHLVLCSPKQ 30 >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} (A:) Length = 79 Score = 25.8 bits (56), Expect = 2.0 Identities = 7/25 (28%), Positives = 11/25 (44%) Query: 48 DETLSDIAEEELESICQNLLANPVI 72 + ++ EE IC LL P+ Sbjct: 3 SGSSGNVQEEVTCPICLELLTEPLS 27 >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} (A:) Length = 63 Score = 25.8 bits (56), Expect = 2.0 Identities = 7/27 (25%), Positives = 14/27 (51%) Query: 46 EMDETLSDIAEEELESICQNLLANPVI 72 + ++ + EE + IC ++L PV Sbjct: 9 ASGQFVNKLQEEVICPICLDILQKPVT 35 >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} (A:) Length = 58 Score = 25.8 bits (56), Expect = 2.2 Identities = 8/24 (33%), Positives = 11/24 (45%) Query: 49 ETLSDIAEEELESICQNLLANPVI 72 L ++ E S+C L PVI Sbjct: 7 GALENLQVEASCSVCLEYLKEPVI 30 >3l0i_A DRRA, SIDM; GEF/GDF-RAB complex, GTP-binding, guanine-nucleotide exchange factor, GDI-displacement factor; 2.85A {Legionella pneumophila} (A:205-363) Length = 159 Score = 25.5 bits (55), Expect = 2.3 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 8/56 (14%) Query: 7 VVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESI 62 + + KDV DP K I HN + KI I+ E +++ +E LES+ Sbjct: 80 IXQFIKDVADPTSK--------IWXHNTKALXNHKIAAIQKLERSNNVNDETLESV 127 >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} (A:) Length = 85 Score = 25.4 bits (55), Expect = 2.8 Identities = 10/25 (40%), Positives = 10/25 (40%) Query: 48 DETLSDIAEEELESICQNLLANPVI 72 L I EE IC LL PV Sbjct: 10 SSVLEMIKEEVTCPICLELLKEPVS 34 >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A (A:) Length = 118 Score = 25.2 bits (54), Expect = 3.2 Identities = 7/28 (25%), Positives = 8/28 (28%), Gaps = 1/28 (3%) Query: 46 EMDETLSDIAEEELE-SICQNLLANPVI 72 D E + E IC L V Sbjct: 6 GYDVEFDPPLESKYECPICLMALREAVQ 33 >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} (A:) Length = 72 Score = 25.4 bits (55), Expect = 3.2 Identities = 7/25 (28%), Positives = 11/25 (44%) Query: 48 DETLSDIAEEELESICQNLLANPVI 72 LS++ L SIC+ L + Sbjct: 6 SGNLSELTPYILCSICKGYLIDATT 30 >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} (A:) Length = 85 Score = 25.0 bits (54), Expect = 3.2 Identities = 8/25 (32%), Positives = 11/25 (44%) Query: 48 DETLSDIAEEELESICQNLLANPVI 72 L ++ EE IC LL P+ Sbjct: 10 SGILVNVKEEVTCPICLELLTQPLS 34 >3l0m_A DRRA, SIDM; GEF/GDF of RAB1, A NEW novel phosphatidylinositol 4- phosphate-binding domain; 3.45A {Legionella pneumophila} (A:1-231) Length = 231 Score = 25.1 bits (54), Expect = 3.4 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 8/56 (14%) Query: 7 VVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESI 62 + + KDV DP K I HN + KI I+ E +++ +E LES+ Sbjct: 160 IXQFIKDVADPTSK--------IWXHNTKALXNHKIAAIQKLERSNNVNDETLESV 207 >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} (A:) Length = 85 Score = 25.0 bits (54), Expect = 3.6 Identities = 6/25 (24%), Positives = 12/25 (48%) Query: 48 DETLSDIAEEELESICQNLLANPVI 72 + SD +E + + L+ +PV Sbjct: 5 EIDYSDAPDEFRDPLMDTLMTDPVR 29 >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} (A:) Length = 81 Score = 25.0 bits (54), Expect = 3.7 Identities = 5/26 (19%), Positives = 8/26 (30%) Query: 47 MDETLSDIAEEELESICQNLLANPVI 72 + IC+ NPV+ Sbjct: 5 SSGGSEEEEIPFRCFICRQAFQNPVV 30 >3fho_A ATP-dependent RNA helicase DBP5; mRNA export, ATPase, translation termination, ATP-binding, cytoplasm, hydrolase, membrane; 2.80A {Schizosaccharomyces pombe} (A:1-326) Length = 326 Score = 24.7 bits (53), Expect = 4.1 Identities = 5/32 (15%), Positives = 11/32 (34%), Gaps = 8/32 (25%) Query: 50 TLSDIAEEELESICQNLLANPVIEDYDIKVQK 81 T S+ +E + N I+++ Sbjct: 300 TFSE----RVEKYAERFAPNANE----IRLKT 323 >1t0h_B Voltage-gated calcium channel subunit BETA2A; SH3 domain, nucleotide kinase like domain, signaling protein; 1.97A {Rattus norvegicus} (B:) Length = 224 Score = 25.0 bits (54), Expect = 4.1 Identities = 14/56 (25%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Query: 6 VVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELES 61 V+ +L K Q K L + + + Q + FD+ +DE + A E L Sbjct: 147 VLQRLIKSRGKSQAKHLN--VQXVAADKLAQCPPQESFDVILDENQLEDACEHLAD 200 >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} (A:) Length = 73 Score = 25.0 bits (54), Expect = 4.2 Identities = 7/27 (25%), Positives = 14/27 (51%) Query: 46 EMDETLSDIAEEELESICQNLLANPVI 72 + ++ + EE + IC ++L PV Sbjct: 9 ASGQFVNKLQEEVICPICLDILQKPVT 35 >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain elongation factor, alternative splicing, cytoplasm; NMR {Homo sapiens} (A:) Length = 100 Score = 24.7 bits (53), Expect = 4.4 Identities = 6/39 (15%), Positives = 16/39 (41%) Query: 34 INQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVI 72 ++ + + + SD +E + + L+ +PV Sbjct: 6 AEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVR 44 >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} (A:) Length = 94 Score = 24.7 bits (53), Expect = 4.7 Identities = 4/21 (19%), Positives = 7/21 (33%) Query: 52 SDIAEEELESICQNLLANPVI 72 S + I + + PV Sbjct: 2 SSGSSGFTCPITKEEMKKPVK 22 >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} (A:1-52) Length = 52 Score = 24.5 bits (53), Expect = 4.7 Identities = 6/21 (28%), Positives = 9/21 (42%) Query: 52 SDIAEEELESICQNLLANPVI 72 + E I L+ +PVI Sbjct: 3 PEFPEYFRCPISLELMKDPVI 23 >2wwx_B DRRA, SIDM; golgi apparatus, protein transport, ER-golgi transport, endoplasmic reticulum, prenylation, lipoprotein, GTP-binding; 1.50A {Legionella pneumophila} (B:) Length = 217 Score = 24.7 bits (53), Expect = 4.7 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 8/56 (14%) Query: 7 VVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESI 62 +++ KDV DP K I HN + KI I+ E +++ +E LES+ Sbjct: 155 IMQFIKDVADPTSK--------IWMHNTKALMNHKIAAIQKLERSNNVNDETLESV 202 >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} (A:) Length = 98 Score = 24.7 bits (53), Expect = 5.2 Identities = 9/25 (36%), Positives = 16/25 (64%) Query: 48 DETLSDIAEEELESICQNLLANPVI 72 +ET +D +E L+ I L+ +PV+ Sbjct: 13 EETYADACDEFLDPIMSTLMCDPVV 37 >2ckl_A Polycomb group ring finger protein 4; BMI1, zinc, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 2h0d_A (A:1-84) Length = 84 Score = 24.6 bits (53), Expect = 5.5 Identities = 1/27 (3%), Positives = 8/27 (29%) Query: 46 EMDETLSDIAEEELESICQNLLANPVI 72 ++++ + +C + Sbjct: 4 TTRIKITELNPHLMCVLCGGYFIDATT 30 >2j5v_A Glutamate 5-kinase; proline biosynthesis, gamma glutamyl kinase, amino-acid biosynthesis, transferase, feedback regulation, PUA domain; HET: RGP; 2.5A {Escherichia coli} PDB: 2j5t_A* (A:267-367) Length = 101 Score = 24.4 bits (53), Expect = 6.1 Identities = 5/46 (10%), Positives = 15/46 (32%), Gaps = 2/46 (4%) Query: 14 VLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEEL 59 + + +G+ + +S + +I +I+ L Sbjct: 49 ICNLEGRDIAHGVSRYNSDALRRIAGHHSQEID--AILGYEYGPVA 92 >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} (A:) Length = 74 Score = 24.2 bits (52), Expect = 6.5 Identities = 6/25 (24%), Positives = 13/25 (52%) Query: 48 DETLSDIAEEELESICQNLLANPVI 72 I +E L IC++++ + V+ Sbjct: 6 SGEDDPIPDELLCLICKDIMTDAVV 30 >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} (A:1-79) Length = 79 Score = 24.2 bits (52), Expect = 7.2 Identities = 5/25 (20%), Positives = 7/25 (28%) Query: 48 DETLSDIAEEELESICQNLLANPVI 72 E + + IC L V Sbjct: 9 VEFDPPLESKYECPICLMALREAVQ 33 >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} (B:) Length = 117 Score = 24.0 bits (51), Expect = 7.4 Identities = 7/24 (29%), Positives = 10/24 (41%) Query: 49 ETLSDIAEEELESICQNLLANPVI 72 L + + S C N+L PV Sbjct: 14 AALDRLEKLLRCSRCTNILREPVC 37 >3eb5_A Baculoviral IAP repeat-containing protein 3; ring domain, apoptosis, chromosomal rearrangement, cytoplasm, metal-binding, polymorphism, zinc; 2.00A {Homo sapiens} PDB: 3eb6_A (A:) Length = 74 Score = 23.9 bits (51), Expect = 8.4 Identities = 7/29 (24%), Positives = 14/29 (48%) Query: 44 DIEMDETLSDIAEEELESICQNLLANPVI 72 D+ ++E L + EE +C + + V Sbjct: 11 DLPVEEQLRRLQEERTCKVCMDKEVSIVF 39 >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} (A:1-103) Length = 103 Score = 23.6 bits (50), Expect = 9.9 Identities = 6/29 (20%), Positives = 11/29 (37%) Query: 44 DIEMDETLSDIAEEELESICQNLLANPVI 72 + + + L S C+N+L P Sbjct: 18 GFSKTLLGTKLEAKYLCSACRNVLRRPFQ 46 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.313 0.132 0.349 Gapped Lambda K H 0.267 0.0509 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 612,835 Number of extensions: 22877 Number of successful extensions: 127 Number of sequences better than 10.0: 1 Number of HSP's gapped: 122 Number of HSP's successfully gapped: 42 Length of query: 84 Length of database: 4,956,049 Length adjustment: 47 Effective length of query: 37 Effective length of database: 3,367,214 Effective search space: 124586918 Effective search space used: 124586918 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.6 bits)