BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780972|ref|YP_003065385.1| phosphoribosylformylglycinamidine synthase, PurS protein [Candidatus Liberibacter asiaticus str. psy62] (84 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780972|ref|YP_003065385.1| phosphoribosylformylglycinamidine synthase, PurS protein [Candidatus Liberibacter asiaticus str. psy62] Length = 84 Score = 169 bits (427), Expect = 1e-44, Method: Compositional matrix adjust. Identities = 84/84 (100%), Positives = 84/84 (100%) Query: 1 MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELE 60 MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELE Sbjct: 1 MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELE 60 Query: 61 SICQNLLANPVIEDYDIKVQKSSS 84 SICQNLLANPVIEDYDIKVQKSSS Sbjct: 61 SICQNLLANPVIEDYDIKVQKSSS 84 >gi|254781033|ref|YP_003065446.1| HemY domain-containing protein [Candidatus Liberibacter asiaticus str. psy62] Length = 492 Score = 23.5 bits (49), Expect = 0.66, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 29/73 (39%), Gaps = 18/73 (24%) Query: 10 LKKDVLDPQGKALKTALSNIGFHNI-------NQIRQGKIFD-----------IEMDETL 51 L K D KAL T L +I HNI + + Q F I + E Sbjct: 76 LHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQ 135 Query: 52 SDIAEEELESICQ 64 +IA E+LE + Q Sbjct: 136 YNIAHEKLEMMLQ 148 >gi|254780439|ref|YP_003064852.1| carbamoyl phosphate synthase large subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 1162 Score = 21.9 bits (45), Expect = 2.1, Method: Compositional matrix adjust. Identities = 15/43 (34%), Positives = 18/43 (41%) Query: 35 NQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVIEDYDI 77 N+I QG FD + E E+I N V DYDI Sbjct: 629 NRIGQGIEFDYCCCHASFSLKEAGFETIMINCNPETVSTDYDI 671 Score = 21.6 bits (44), Expect = 2.5, Method: Compositional matrix adjust. Identities = 8/19 (42%), Positives = 13/19 (68%) Query: 47 MDETLSDIAEEELESICQN 65 D LSD E +++++CQN Sbjct: 836 FDSYLSDAMEIDVDALCQN 854 >gi|254780527|ref|YP_003064940.1| hypothetical protein CLIBASIA_02070 [Candidatus Liberibacter asiaticus str. psy62] Length = 397 Score = 20.8 bits (42), Expect = 4.1, Method: Compositional matrix adjust. Identities = 9/31 (29%), Positives = 19/31 (61%) Query: 48 DETLSDIAEEELESICQNLLANPVIEDYDIK 78 D+ L+ I EE+ + + + NP +D+D++ Sbjct: 24 DDRLNSIQEEKRNNSTKTINKNPNKQDFDVQ 54 >gi|254780434|ref|YP_003064847.1| dihydroorotate dehydrogenase 2 [Candidatus Liberibacter asiaticus str. psy62] Length = 362 Score = 20.8 bits (42), Expect = 4.7, Method: Compositional matrix adjust. Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Query: 36 QIRQGKIFDIEMDETLSDIAEEELESICQNLLANPV 71 +I+ GK I + + D++EEEL+ I +L++ V Sbjct: 203 KIKTGKFVPIFLKIS-PDLSEEELDDIAVEVLSHKV 237 >gi|254780448|ref|YP_003064861.1| hypothetical protein CLIBASIA_01665 [Candidatus Liberibacter asiaticus str. psy62] Length = 311 Score = 20.4 bits (41), Expect = 5.4, Method: Compositional matrix adjust. Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 26 LSNIGFHNINQIRQGKIFDIEMDETLSDIAEEE 58 L+N + ++ R F+ D+T+S +A+EE Sbjct: 242 LANKNIYQLSNPRYSYQFNTLKDKTISFVAKEE 274 >gi|254780124|ref|YP_003064537.1| hypothetical protein CLIBASIA_00015 [Candidatus Liberibacter asiaticus str. psy62] Length = 388 Score = 20.0 bits (40), Expect = 7.9, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 17/36 (47%) Query: 48 DETLSDIAEEELESICQNLLANPVIEDYDIKVQKSS 83 ++ +SD EEL+ + PVI DI K + Sbjct: 341 EQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQT 376 >gi|254780829|ref|YP_003065242.1| ATP-dependent protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 437 Score = 20.0 bits (40), Expect = 8.8, Method: Compositional matrix adjust. Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Query: 23 KTALSNIGFHNINQIRQGKIFDIEMD----ETLSDIA 55 KTA SN ++R G+I D E+D +T SDI+ Sbjct: 141 KTATSNTREVFRKKLRDGEISDKEIDIEVADTSSDIS 177 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.313 0.132 0.349 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,164 Number of Sequences: 1233 Number of extensions: 1690 Number of successful extensions: 9 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of query: 84 length of database: 328,796 effective HSP length: 53 effective length of query: 31 effective length of database: 263,447 effective search space: 8166857 effective search space used: 8166857 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.0 bits) S2: 31 (16.5 bits)