HHsearch alignment for GI: 254780973 and conserved domain: KOG2835

>KOG2835 consensus.
Probab=99.97  E-value=1.4e-32  Score=224.95  Aligned_cols=230  Identities=25%  Similarity=0.348  Sum_probs=201.7

Q ss_pred             CCEEEECCCEEEEECC-CCCEEEEEEECCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCEEEEE
Q ss_conf             7763613303768728-899799999368245162014556888799999999999998733997405743884002310
Q gi|254780973|r    4 RNPVYEEKTKIIYEGL-EPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIGIPHYFIRRINMREQLVR   82 (255)
Q Consensus         4 ~~~lyeGKvK~iY~~~-d~~~li~~~~DriSAfD~~~~~~I~gKG~~l~~iS~~~F~~l~~~Gi~th~i~~~~~~~~iv~   82 (255)
T Consensus        12 ~k~la~gkvr~v~~~~~~~~~vlti~kD~I~a~~~~~a~~I~~ka~il~k~t~~~F~~l~~~gv~~~~~~~~~~t~~~~~   91 (373)
T KOG2835          12 GKELAEGKVRDVYELVDSPGLVLTISKDRITALDAAMANSIQGKAAILNKITSFVFELLGEAGIETAFTEQCGETAFEAR   91 (373)
T ss_pred             HHHHHEEEEEEECCCCCCCCEEEEEECCCCCHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHEEECCCCCHHHHHCC
T ss_conf             32343454421024566887367765054103444542012567789887666667654032012111034441344227


Q ss_pred             CCCCCCEEEEEECEEECCHHCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH--HHHCCHHHHHHHHHHHHHHH
Q ss_conf             026553599992446010100256-433773786434443454456886415578888--54089899978999999999
Q gi|254780973|r   83 DVEMIPLLITVRNTAAGSLAKRLN-IPEGLSLPRSLVEFYYLPDSSEKTLVSEEHITA--FNWANQSEVEEMTALSIRIN  159 (255)
Q Consensus        83 k~~~iPiE~VvR~yaaGS~~kry~-~~~G~~l~~pl~e~~~K~d~~~DP~i~~~~~~~--~~~~~~~~~~~i~~~a~~i~  159 (255)
T Consensus        92 p~~~~~~~~v~~~~~ts~f~k~~~~vp~~~~~~~~~~~S~~k~~a~~~n~~g~e~~~~~~~~li~r~~~~~~~~~~~~if  171 (373)
T KOG2835          92 PCPMTPIEWVTRRCATSSFEKKNPGVPEGYRFRGYKTESTFKDDANMDNVWGDEQIIDCAGLLIGRDEVKIMQKLPLYIF  171 (373)
T ss_pred             CCCCCCCEEEEEECCHHHHHHHCCCCCCCEEECCCCCCCCCCCHHHCCCCCCHHHHHHHHHHHCCHHHCCCCCCCCCCHH
T ss_conf             88778730478622236688758667654153476565200221223763330134444433301011441000440001


Q ss_pred             HHHHHHHHHCCCEEECCCEEEEECCCCCCCEEEEE-EEECCCCCEEEECCCCCC-CCHHHHHCCHH-------HHHHHHH
Q ss_conf             99999999879766312066631046888879999-630587414117675670-44787612367-------7999999
Q gi|254780973|r  160 DFMTGLFLGINIQLVDFRIKCGRLLDDDILRIVLA-DEIFPDCCRLWDLSKKEE-CDKKRFSKSND-------QLLEGYS  230 (255)
Q Consensus       160 ~~l~~~~~~~Gl~LvD~K~EFG~~~~~~~g~iiL~-DEItPDs~R~Wd~~~~e~-lDKd~~R~~l~-------~v~~~Y~  230 (255)
T Consensus       172 es~k~~~~~h~~~I~d~~ie~gv~~~--~~~~~~a~~v~~~~~~r~~~~~d~~im~D~~~~~d~~~vt~e~~ilv~~~~t  249 (373)
T KOG2835         172 ESLKAAWAGHNCAISDMKIEFGVDVT--LGEIVLASDVIDNDSWRMWPDGDGRIMKDKKVYFDLDEVTNEGLILVDENTT  249 (373)
T ss_pred             HHHHHHHCCCCCCCCCCHHHHCCCHH--HHHHHHHHCCCCHHHEEEEECCCCCEEEEEEEEECCCCCCCCCEEEEEECCC
T ss_conf             02345424776535642344403343--6555553103531234770067766443006784565777511588840377


Q ss_pred             HHHHH
Q ss_conf             99997
Q gi|254780973|r  231 EVARR  235 (255)
Q Consensus       231 ev~~r  235 (255)
T Consensus       250 ~~msr  254 (373)
T KOG2835         250 PVMSR  254 (373)
T ss_pred             HHHHH
T ss_conf             04666