HHsearch alignment of GI: 254780973 and MMDB domain: 1kut_A_1-78_200-230

>1kut_A (A:1-78,A:200-230) Phosphoribosylaminoimidazole-succinocarboxamide synthase; structural genomics, saicar synthetase, PSI, protein structure initiative; 2.20A {Thermotoga maritima}
Probab=94.95  E-value=0.018  Score=35.24  Aligned_cols=86  Identities=15%  Similarity=0.150  Sum_probs=56.6

Q ss_pred             CHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCCEEEEECCCCCCCEEEEEEEECCCCCEEEECCCCCC
Q ss_conf             55788885408989997899999999999999999879766312066631046888879999630587414117675670
Q gi|254780973|r  133 SEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLLDDDILRIVLADEIFPDCCRLWDLSKKEE  212 (255)
Q Consensus       133 ~~~~~~~~~~~~~~~~~~i~~~a~~i~~~l~~~~~~~Gl~LvD~K~EFG~~~~~~~g~iiL~DEItPDs~R~Wd~~~~e~  212 (255)
                      ..|.+.+++-+-.+++..=-....++....-+.....|+-                  =-++.-++|.+|..   ..-+.
T Consensus        21 fkDriTAfDg~k~~~I~gKG~l~~~iS~~~Fe~Le~~GIp------------------THfI~~i~~~~mlV---kk~e~   79 (109)
T 1kut_A           21 FKDDITAGDGLKHDVLTGKGSICAETTAILXKYLSEKGIK------------------THLVEYIPPRTLKV---IPLKI   79 (109)
T ss_dssp             ECCC-----------CCSHHHHHHHHHHHHHHHHHHTTCC------------------BSEEEEETTTEEEE---CCCEC
T ss_pred             EECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCC------------------CHHHHCCCCCEEEE---EECCC
T ss_conf             9788451075257889973099999999999876305988------------------12530467507887---76143


Q ss_pred             CCHHHHHCCHHHHHHHHHHHHHHHCCC
Q ss_conf             447876123677999999999971423
Q gi|254780973|r  213 CDKKRFSKSNDQLLEGYSEVARRLGIF  239 (255)
Q Consensus       213 lDKd~~R~~l~~v~~~Y~ev~~rl~~~  239 (255)
                      ||||+||++||+...+|.||++-+..+
T Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~  106 (109)
T 1kut_A           80 FDKDVYRRDLGDPLKKYREVLELCRSL  106 (109)
T ss_dssp             CCHHHHHHGGGCTTHHHHHHHHHHHHH
T ss_pred             CCHHHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             275888711201659999999999875