Query         gi|254780973|ref|YP_003065386.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 255
No_of_seqs    142 out of 1715
Neff          6.1 
Searched_HMMs 33803
Date          Wed Jun  1 20:05:24 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780973.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >2gqr_A Phosphoribosylaminoimi 100.0       0       0  370.1  13.2  151   86-240     1-151 (152)
  2 >3kre_A Phosphoribosylaminoimi 100.0       0       0  348.3  10.1  136   84-219     1-136 (136)
  3 >2z02_A Phosphoribosylaminoimi 100.0       0       0  333.9  11.3  131   86-219     1-131 (131)
  4 >2ywv_A Phosphoribosylaminoimi 100.0       0       0  333.0  10.8  131   86-219     1-131 (131)
  5 >2h31_A Multifunctional protei 100.0       0       0  308.5  10.0  136   83-220     1-144 (145)
  6 >1kut_A Phosphoribosylaminoimi 100.0 9.8E-45       0  300.9   9.7  121   86-209     1-121 (121)
  7 >2cnq_A Phosphoribosylaminoimi 100.0 2.1E-42       0  286.2   5.7  123   86-211     1-137 (140)
  8 >2cnq_A Phosphoribosylaminoimi 100.0 3.7E-30 1.1E-34  209.3   5.7  148    2-164     9-160 (165)
  9 >2ywv_A Phosphoribosylaminoimi 100.0 1.8E-29 5.4E-34  204.9   9.0   86    1-86      4-89  (113)
 10 >2gqr_A Phosphoribosylaminoimi 100.0 5.3E-29 1.6E-33  202.0   9.5   84    2-85      2-85  (85)
 11 >3kre_A Phosphoribosylaminoimi 100.0 7.9E-29 2.3E-33  200.9   9.8   86    1-86     22-107 (127)
 12 >2z02_A Phosphoribosylaminoimi  99.9 3.5E-28   1E-32  196.9   8.2   85    1-86      8-92  (111)
 13 >2h31_A Multifunctional protei  99.9 8.8E-28 2.6E-32  194.3   6.3   83    1-83      7-90  (146)
 14 >1kut_A Phosphoribosylaminoimi  99.9 1.4E-26   4E-31  186.8   7.5   81    7-89      2-82  (109)
 15 >2cnq_A Phosphoribosylaminoimi  95.1   0.021 6.1E-07   34.9   3.4   42  196-237   100-159 (165)
 16 >1kut_A Phosphoribosylaminoimi  95.0   0.018 5.4E-07   35.2   2.9   86  133-239    21-106 (109)
 17 >3ffz_A Botulinum neurotoxin t  30.2      30 0.00089   15.0   2.0   31  214-248    11-41  (77)
 18 >1t3c_A Neurotoxin type E; cat  24.6      44  0.0013   14.0   2.3   30  214-247    11-40  (77)
 19 >1jdw_A L-arginine\:glycine am  21.2      26 0.00076   15.5   0.2   33  189-221     5-41  (56)

No 1  
>>2gqr_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; PURC, ADE2, ADE1, nucleotide complex, octahedral magnesium coordination; HET: ADP; 2.00A {Escherichia coli} PDB: 2gqs_A* (A:86-237)
Probab=100.00  E-value=0  Score=370.15  Aligned_cols=151  Identities=38%  Similarity=0.635  Sum_probs=147.3

Q ss_pred             CCCEEEEEECEEECCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             55359999244601010025643377378643444345445688641557888854089899978999999999999999
Q gi|254780973|r   86 MIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGL  165 (255)
Q Consensus        86 ~iPiE~VvR~yaaGS~~kry~~~~G~~l~~pl~e~~~K~d~~~DP~i~~~~~~~~~~~~~~~~~~i~~~a~~i~~~l~~~  165 (255)
                      .||||||||||||||+|+|||+++|++|++|++||++|+|++|||+||++++.++|+++++++++|+++|+++|++++++
T Consensus         1 ~IPlEvVvRn~a~GS~~krygl~eg~~l~~Pive~~~K~d~~~Dp~i~~~~~~~~~~~~~~e~~~i~~~al~v~~~l~~~   80 (152)
T 2gqr_A            1 XVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDLFLKNDAXHDPXVNESYCETFGWVSKENLARXKELTYKANDVLKKL   80 (152)
T ss_dssp             ECSEEEEEEEECCHHHHHHHCCCTTCEEEEEEEEEEECCGGGTCCEECHHHHHHTTSSCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCEEEEEHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             21179997434130204256864223446443322122344688764588999846210345888988888888998888


Q ss_pred             HHHCCCEEECCCEEEEECCCCCCCEEEEEEEECCCCCEEEECCCCCCCCHHHHHCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             998797663120666310468888799996305874141176756704478761236779999999999714232
Q gi|254780973|r  166 FLGINIQLVDFRIKCGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK  240 (255)
Q Consensus       166 ~~~~Gl~LvD~K~EFG~~~~~~~g~iiL~DEItPDs~R~Wd~~~~e~lDKd~~R~~l~~v~~~Y~ev~~rl~~~~  240 (255)
                      |.++|++|||||+|||++    .|+|+||||||||||||||.+++++||||+||+|+++++++|+|+++||+...
T Consensus        81 ~~~~gi~LvD~KlEFG~~----~g~i~L~DEItpDs~Rlw~~~~~e~lDKe~~R~~l~~~~~~Y~ev~~rl~~~~  151 (152)
T 2gqr_A           81 FDDAGLILVDFKLEFGLY----KGEVVLGDEFSPDGSRLWDKETLEKXDKDRFRQSLGGLIEAYEAVARRLGVQL  151 (152)
T ss_dssp             HHHTTEEEEEEEEEEEEE----TTEEEEESCCSTTSEEEEETTTCCBCSTHHHHTTCCCHHHHHHHHHHHHTCCC
T ss_pred             HHHCCCEEEEEEEEEEEC----CCCEEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             986795886416899745----99789999457986424067767745869987212336699999999848887


No 2  
>>3kre_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ATP-binding, ligase; 1.80A {Ehrlichia chaffeensis str} (A:105-240)
Probab=100.00  E-value=0  Score=348.30  Aligned_cols=136  Identities=40%  Similarity=0.839  Sum_probs=133.7

Q ss_pred             CCCCCEEEEEECEEECCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             26553599992446010100256433773786434443454456886415578888540898999789999999999999
Q gi|254780973|r   84 VEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMT  163 (255)
Q Consensus        84 ~~~iPiE~VvR~yaaGS~~kry~~~~G~~l~~pl~e~~~K~d~~~DP~i~~~~~~~~~~~~~~~~~~i~~~a~~i~~~l~  163 (255)
                      |+|||||||||||||||+|||||+++|++|++|++||++|+|++|||+||++++.++|+++++++++|+++|+++|++++
T Consensus         1 ~~~iPiEvIvR~~a~GS~~rr~g~~eg~~l~~Pive~~~K~d~~~Dp~i~~~~~~~~~~~~~~e~~~i~~~a~~i~~~l~   80 (136)
T 3kre_A            1 ITIIPIEVVIRNLAAGNFSKRFQIADGTPFKSPIIEFYYKNDELSDPMVSEGHILSFQWLTNQELEKIKILSLKINNILS   80 (136)
T ss_dssp             EEECSEEEEEEEECCHHHHHHHTCCTTCEEEEEEEEEEECCTTTTCCEECHHHHHHTTSSCHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCEEEEEEEEECHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             36788189999898176551403045630478877652235567545555778988500137889899999999999999


Q ss_pred             HHHHHCCCEEECCCEEEEECCCCCCCEEEEEEEECCCCCEEEECCCCCCCCHHHHH
Q ss_conf             99998797663120666310468888799996305874141176756704478761
Q gi|254780973|r  164 GLFLGINIQLVDFRIKCGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFS  219 (255)
Q Consensus       164 ~~~~~~Gl~LvD~K~EFG~~~~~~~g~iiL~DEItPDs~R~Wd~~~~e~lDKd~~R  219 (255)
                      ++|.++|++|||||+|||+.++++.|+|+|+||||||||||||.+++++||||+||
T Consensus        81 ~~~~~~gl~LvD~K~EFG~~~dd~~g~iiL~DEItPDs~R~w~~~~~e~ldKe~~R  136 (136)
T 3kre_A           81 ELFFNVGIKLVDFKLEFGKLHNDEQSDLFLADEISPDTCRLWDISTNKRLDKDRYR  136 (136)
T ss_dssp             HHHHHTTEEEEEEEECEEEETTCTTCCCEECSCCSTTTEEEEETTTCCBCSTHHHH
T ss_pred             HHHHHCCCEEEEEEEEEEEECCCCCCEEEEEEEECCCCCCCCCCCCCCCCCHHHHH
T ss_conf             99987394887111467431269888699999537985313278888756748876


No 3  
>>2z02_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; 2-layer sandwich, ligase, purine biosynthesis, structural genomics; HET: ATP CIT; 2.03A {Methanocaldococcus jannaschii} PDB: 2yzl_A* (A:92-222)
Probab=100.00  E-value=0  Score=333.94  Aligned_cols=131  Identities=35%  Similarity=0.629  Sum_probs=128.9

Q ss_pred             CCCEEEEEECEEECCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             55359999244601010025643377378643444345445688641557888854089899978999999999999999
Q gi|254780973|r   86 MIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGL  165 (255)
Q Consensus        86 ~iPiE~VvR~yaaGS~~kry~~~~G~~l~~pl~e~~~K~d~~~DP~i~~~~~~~~~~~~~~~~~~i~~~a~~i~~~l~~~  165 (255)
                      |||||||||||||||+|||||+++|++|++|++||++|+|++|||++|++++.++|+++++++++|+++|+++|++++++
T Consensus         1 miPlEvIvR~~a~GS~~kryg~~eg~~l~~Pive~~~K~d~~~Dp~i~~~~~~~~~~~~~~e~~~i~~~~~~i~~~l~~~   80 (131)
T 2z02_A            1 IIPIEVIVRNIAAGSLCRRYPFEEGKELPFPIVQFDYKNDEYGDPMLNEDIAVALGLATREELNKIKEIALKVNEVLKKL   80 (131)
T ss_dssp             ECSEEEEEEEECCTHHHHHSSCCTTCEEEEEEEEEEECCGGGTCCBCCHHHHHHTTSSCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEEEEEEEEEEECHHHHHHHHHHHCCCCCCCCCCCCCCCHHCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             62479999768714443110111045478532244554010376311457899971077889999999999999999999


Q ss_pred             HHHCCCEEECCCEEEEECCCCCCCEEEEEEEECCCCCEEEECCCCCCCCHHHHH
Q ss_conf             998797663120666310468888799996305874141176756704478761
Q gi|254780973|r  166 FLGINIQLVDFRIKCGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFS  219 (255)
Q Consensus       166 ~~~~Gl~LvD~K~EFG~~~~~~~g~iiL~DEItPDs~R~Wd~~~~e~lDKd~~R  219 (255)
                      |.++|++|||||+|||++.+|   +|+|+||||||||||||.+++++||||+||
T Consensus        81 ~~~~gl~LvD~K~EFG~~~~g---~ivL~DEitpDs~R~wd~~~~~~ldK~~~R  131 (131)
T 2z02_A           81 FDEKGIILVDFKIEIGKDREG---NLLVADEISPDTMRLWDKETRDVLDKDVFR  131 (131)
T ss_dssp             HHHTTEEEEEEEECEEEETTC---CEEECSCCSTTTEEEEETTTCCBCSTHHHH
T ss_pred             HHHCCCEEEEEEEEEEECCCC---CEEEEECCCCCCCCCCCCCCCCCCCHHHHH
T ss_conf             985796786402587335898---689998347975332358876323728888


No 4  
>>2ywv_A Phosphoribosylaminoimidazole succinocarboxamide synthetase; ADP complex, structural genomics, NPPSFA; HET: ADP; 1.75A {Geobacillus kaustophilus} (A:89-219)
Probab=100.00  E-value=0  Score=333.04  Aligned_cols=131  Identities=44%  Similarity=0.735  Sum_probs=128.8

Q ss_pred             CCCEEEEEECEEECCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             55359999244601010025643377378643444345445688641557888854089899978999999999999999
Q gi|254780973|r   86 MIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGL  165 (255)
Q Consensus        86 ~iPiE~VvR~yaaGS~~kry~~~~G~~l~~pl~e~~~K~d~~~DP~i~~~~~~~~~~~~~~~~~~i~~~a~~i~~~l~~~  165 (255)
                      |||||||||||||||+||||+.++|++|++|++|+++|+|++|||++|++++.++|+++++++++|+++|+++|++++++
T Consensus         1 miPiE~IvR~~~~GS~~rry~~~eg~~~~~Pi~e~~~K~d~~~D~~i~~~~~~~~~~~~~~e~~~i~~~~l~i~~~l~~~   80 (131)
T 2ywv_A            1 IIPLEVVVRNVVAGSLAKRIGLEEGTPLEAPLVEFYYKNDDLGDPLLLEDHIFILKLASREEVAALKQAALAVNDVLRLH   80 (131)
T ss_dssp             ECSEEEEEEEEECHHHHHHHTCCTTEEEEEEEEEEEECCGGGTCCEECHHHHHHHTSSCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             55479999999843641037887886789875665315622365434214677751035876533577777788999999


Q ss_pred             HHHCCCEEECCCEEEEECCCCCCCEEEEEEEECCCCCEEEECCCCCCCCHHHHH
Q ss_conf             998797663120666310468888799996305874141176756704478761
Q gi|254780973|r  166 FLGINIQLVDFRIKCGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFS  219 (255)
Q Consensus       166 ~~~~Gl~LvD~K~EFG~~~~~~~g~iiL~DEItPDs~R~Wd~~~~e~lDKd~~R  219 (255)
                      |.++|++|||||||||++.+|   +|+|+||||||||||||.+++++||||+||
T Consensus        81 ~~~~Gl~LvD~K~EFG~d~~g---~iiL~DEitpDs~R~w~~~~~~~ldKe~~R  131 (131)
T 2ywv_A           81 FAERNVRLIDFKLEFGRTADG---AILLADEISPDTCRLWDAKTNEKLDKDVFR  131 (131)
T ss_dssp             HHHTTEEEEEEEECEEECTTS---CEEECSCCSTTTEEEEETTTCCBCSTHHHH
T ss_pred             HHHCCCCCEEEEEEEEECCCC---CEEEEEECCCCCCCCCCCCCCCCCCHHHHH
T ss_conf             987798411113597376899---389999428986444508986433859997


No 5  
>>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} (A:90-234)
Probab=100.00  E-value=0  Score=308.49  Aligned_cols=136  Identities=30%  Similarity=0.435  Sum_probs=128.8

Q ss_pred             CCCCCCEEEEEECEEECCHHCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH------HCCHHHHHHHHHHH
Q ss_conf             02655359999244601010025-643377378643444345445688641557888854------08989997899999
Q gi|254780973|r   83 DVEMIPLLITVRNTAAGSLAKRL-NIPEGLSLPRSLVEFYYLPDSSEKTLVSEEHITAFN------WANQSEVEEMTALS  155 (255)
Q Consensus        83 k~~~iPiE~VvR~yaaGS~~kry-~~~~G~~l~~pl~e~~~K~d~~~DP~i~~~~~~~~~------~~~~~~~~~i~~~a  155 (255)
                      ||+|||+|||||||||||+|+|| +..+|..|++|++|+++|+++++||+++.+|+..++      ++|++++++|+++|
T Consensus         1 k~~~iPlEvVvR~~a~GS~~kry~~~~~G~~l~~~l~e~~~k~d~~~dP~~k~e~~~~~~~a~~~~~~~~~e~~~i~~~a   80 (145)
T 2h31_A            1 QCEXIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIXSHAT   80 (145)
T ss_dssp             CEEECSCEEEEESBCCHHHHHHSTTCCTTCBCSSCCEEEESCCCSSCCCCBCHHHHHTTTCEETTEECCHHHHHHHHHHH
T ss_pred             ECCCCCEEEEECCEECCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHH
T ss_conf             21421259997024323245415676367758842121112445678954011214566667775016888999999999


Q ss_pred             HHHHHHHHHHHHHCCCEEECCCEEEEECCCCCCCEEEEEEEECCCCCEEEECCCC-CCCCHHHHHC
Q ss_conf             9999999999998797663120666310468888799996305874141176756-7044787612
Q gi|254780973|r  156 IRINDFMTGLFLGINIQLVDFRIKCGRLLDDDILRIVLADEIFPDCCRLWDLSKK-EECDKKRFSK  220 (255)
Q Consensus       156 ~~i~~~l~~~~~~~Gl~LvD~K~EFG~~~~~~~g~iiL~DEItPDs~R~Wd~~~~-e~lDKd~~R~  220 (255)
                      +++|++++++|.++|++|||||+|||++.++  |+++|+||||||||||||.+++ ++||||+||+
T Consensus        81 l~i~~~l~~~~~~~Gl~LvD~K~EFG~d~~~--~~ivl~deitpDs~R~w~~~~~~~~ldK~~~R~  144 (145)
T 2h31_A           81 QAIFEILEKSWLPQNCTLVDXKIEFGVDVTT--KEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRD  144 (145)
T ss_dssp             HHHHHHHHHHHGGGSCEEEEEEECEEEETTT--CCEEECSCCCTTSEEEECCC-------------
T ss_pred             HHHHHHHHHHHHHCCCEEEEEEEEEEEECCC--CEEEEEECCCCCCCCCCCCCCCCCCCCHHHHCC
T ss_conf             9999999999997797687536898662689--859998635887511445888651134266505


No 6  
>>1kut_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; structural genomics, saicar synthetase, PSI, protein structure initiative; 2.20A {Thermotoga maritima} (A:79-199)
Probab=100.00  E-value=9.8e-45  Score=300.90  Aligned_cols=121  Identities=31%  Similarity=0.470  Sum_probs=117.3

Q ss_pred             CCCEEEEEECEEECCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             55359999244601010025643377378643444345445688641557888854089899978999999999999999
Q gi|254780973|r   86 MIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGL  165 (255)
Q Consensus        86 ~iPiE~VvR~yaaGS~~kry~~~~G~~l~~pl~e~~~K~d~~~DP~i~~~~~~~~~~~~~~~~~~i~~~a~~i~~~l~~~  165 (255)
                      .||||||||||||||+|||||+++|++|++|++||++|+|++|||+||++++.++|+++++++++|+++|+++|++++++
T Consensus         1 ~iPiEvIvR~~~~GS~~rr~g~~eg~~l~~Pive~~~K~d~~~Dp~i~~~~~~~~~~~~~~e~~~i~~~~l~i~~~l~~~   80 (121)
T 1kut_A            1 XFPLEVVVRLKKAGSFVRRYGGAEGEDLPVPLVEFFIKDDERHDPXVCVDHLEILGIATKKQAEKXKEAAVKITLALKEF   80 (121)
T ss_dssp             ECSEEEEEEEECCHHHHHHHCCCTTCEEEEEEEEEEECCGGGTCCBCCHHHHHHTTSCCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CEEEEEEEECEECCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             41089999570633346551654465179986541004423688520045666650134999987899999999999998


Q ss_pred             HHHCCCEEECCCEEEEECCCCCCCEEEEEEEECCCCCEEEECCC
Q ss_conf             99879766312066631046888879999630587414117675
Q gi|254780973|r  166 FLGINIQLVDFRIKCGRLLDDDILRIVLADEIFPDCCRLWDLSK  209 (255)
Q Consensus       166 ~~~~Gl~LvD~K~EFG~~~~~~~g~iiL~DEItPDs~R~Wd~~~  209 (255)
                      |.++|++|||||+|||++.+|   +|+|+||||||||||||+++
T Consensus        81 ~~~~gl~LvD~K~EFG~~~~g---~iiL~DEitPDs~RlWd~~~  121 (121)
T 1kut_A           81 FERANFELWDIKYEFGLDKDG---NVVLGDEISPDTFRLRKKGE  121 (121)
T ss_dssp             HHTTTEEEEEEEECEEECTTC---CEEECSCCSTTTEEEEETTC
T ss_pred             HHHCCCEEEEEEEEEEECCCC---EEEEEEEECCCCCCCCCCCC
T ss_conf             752496888873898871598---09999953796226788986


No 7  
>>2cnq_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; ligase, phosphoribosylaminoimidazolesuccinocarboxamide (saicar) SYN ligase; HET: ADP AMZ AMP; 1.00A {Saccharomyces cerevisiae} (A:113-252)
Probab=100.00  E-value=2.1e-42  Score=286.21  Aligned_cols=123  Identities=19%  Similarity=0.266  Sum_probs=117.6

Q ss_pred             CCCEEEEEECEEECCHHCCC-------------CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCHHHHHHHH
Q ss_conf             55359999244601010025-------------64337737864344434544568864155788885408989997899
Q gi|254780973|r   86 MIPLLITVRNTAAGSLAKRL-------------NIPEGLSLPRSLVEFYYLPDSSEKTLVSEEHITAFNWANQSEVEEMT  152 (255)
Q Consensus        86 ~iPiE~VvR~yaaGS~~kry-------------~~~~G~~l~~pl~e~~~K~d~~~DP~i~~~~~~~~~~~~~~~~~~i~  152 (255)
                      |||||||||||||||+|+||             ++++|++|++|++||++|++ ++||++|.+++.+++++|++++++|+
T Consensus         1 miPlE~IvR~y~~GS~~~ry~~~~~~~g~~l~~g~~eg~~l~~pi~e~~~K~d-~~D~~i~~~~~~~~~~~~~~e~~~i~   79 (140)
T 2cnq_A            1 LIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKAE-QGEHDENISPAQAAELVGEDLSRRVA   79 (140)
T ss_dssp             EECSSBEEEEEECCHHHHHHHHHHSEETTEECCTTCCTTCEEEEEEECCBCCC-C---CCCBCCHHHHHHHHCHHHHHHH
T ss_pred             CCCEEEEEEECCEECCCEEECCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCHHHHHHHHHHHHHCCHHHHHHH
T ss_conf             20104899955541121221245861527668877422445774346742121-00101445657889875258999999


Q ss_pred             HHHHHHHHHHHHHHHHCCCEEECCCEEEEECCCCCCCEEEEEEEE-CCCCCEEEECCCCC
Q ss_conf             999999999999999879766312066631046888879999630-58741411767567
Q gi|254780973|r  153 ALSIRINDFMTGLFLGINIQLVDFRIKCGRLLDDDILRIVLADEI-FPDCCRLWDLSKKE  211 (255)
Q Consensus       153 ~~a~~i~~~l~~~~~~~Gl~LvD~K~EFG~~~~~~~g~iiL~DEI-tPDs~R~Wd~~~~e  211 (255)
                      ++|+++|++++++|.++|++|||||+|||++.++  |+|+|+||| |||||||||+++++
T Consensus        80 ~~~~~i~~~l~~~~~~~Gl~LvD~K~EFG~~~~~--g~ivL~DEi~tpDs~R~w~~~~~~  137 (140)
T 2cnq_A           80 ELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKT--NEIILVDEVLTPDSSRFWNGASYK  137 (140)
T ss_dssp             HHHHHHHHHHHHHHHHHHTEEEEEEEEEEEEETT--TTEEEEESCCSCTTTEEEEETTTC
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEEEEEEEEECC--CCCCEEEEEECCCCCCCCCCCCCC
T ss_conf             9999999999999987469057632689886136--564046323216864320135333


No 8  
>>2cnq_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; ligase, phosphoribosylaminoimidazolesuccinocarboxamide (saicar) SYN ligase; HET: ADP AMZ AMP; 1.00A {Saccharomyces cerevisiae} (A:1-112,A:253-305)
Probab=99.96  E-value=3.7e-30  Score=209.27  Aligned_cols=148  Identities=18%  Similarity=0.088  Sum_probs=113.2

Q ss_pred             CCCCEEEECCCEEEEECCCCCEEEEEEECCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCEEEE
Q ss_conf             98776361330376872889979999936824516201455688879999999999999873399740574388400231
Q gi|254780973|r    2 RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIGIPHYFIRRINMREQLV   81 (255)
Q Consensus         2 ~~~~~lyeGKvK~iY~~~d~~~li~~~~DriSAfD~~~~~~I~gKG~~l~~iS~~~F~~l~~~Gi~th~i~~~~~~~~iv   81 (255)
                      .+.++||+||||+||++++ +.|+|+||||+||||+++++.|||||++||+||+|||++|++. |||||++.++++.|+|
T Consensus         9 ~~~~li~~GKvKdvY~~~~-~~lllv~tDriSAfD~v~~~~Ip~KG~vl~~iS~~wF~~L~~g-I~tH~i~~~~~~~~~~   86 (165)
T 2cnq_A            9 GILPLVARGKVRDIYEVDA-GTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSND-VRNHLVDIAPGKTIFD   86 (165)
T ss_dssp             TTSSCEEEECSSEEEEEEE-TTEEEEEECSCCEETTEECSSCCTTHHHHHHHHHHHHHHHTTT-TSEESBCCCCTTCCGG
T ss_pred             CCCCCCEECCCCEEEEECC-CCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC-CCCCCEECCCCCHHHH
T ss_conf             7778510015761689708-9969999848850546415788997689999999999998654-5766511368840010


Q ss_pred             ECCCCCCEEEEEECEEECCHHCC-CCCCCCCCCCC-CCCCCCCCCC--CCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHH
Q ss_conf             00265535999924460101002-56433773786-4344434544--56886415578888540898999789999999
Q gi|254780973|r   82 RDVEMIPLLITVRNTAAGSLAKR-LNIPEGLSLPR-SLVEFYYLPD--SSEKTLVSEEHITAFNWANQSEVEEMTALSIR  157 (255)
Q Consensus        82 ~k~~~iPiE~VvR~yaaGS~~kr-y~~~~G~~l~~-pl~e~~~K~d--~~~DP~i~~~~~~~~~~~~~~~~~~i~~~a~~  157 (255)
                      ++|+++|+|++.|.++.+|++.+ .+  .-..|+. .+-+......  ...-|.           +.++-++..++.-++
T Consensus        87 ~k~~~~~~~~~~~~~~gRs~~vkk~~--~q~s~dKq~vRdwl~~~~~~~~~~p~-----------lp~~iv~~t~~~Y~e  153 (165)
T 2cnq_A           87 YLPAKLSEPKYKTQLEDRSLLVHKHK--SQDSYDKQFLRDWLTANKLNGVNGVK-----------MPQDIVDRTRAKYIE  153 (165)
T ss_dssp             GGSCGGGGSHHHHHHHTTSEEEEECC--SCCCCSSTHHHHHHHHHTTCTTCTTC-----------CCCHHHHHHHHHHHH
T ss_pred             HCCCCCCCCCCHHHCCCCCEEEEEEC--CCCCCCCHHHHHHHHHHCCCCCCCCC-----------CCCHHHHHHHHHHHH
T ss_conf             01321124631121158842799850--87545245999989986686789888-----------899999999999999


Q ss_pred             HHHHHHH
Q ss_conf             9999999
Q gi|254780973|r  158 INDFMTG  164 (255)
Q Consensus       158 i~~~l~~  164 (255)
                      +|+.++.
T Consensus       154 ~~e~ltG  160 (165)
T 2cnq_A          154 AYETLTG  160 (165)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHHH
T ss_conf             9999986


No 9  
>>2ywv_A Phosphoribosylaminoimidazole succinocarboxamide synthetase; ADP complex, structural genomics, NPPSFA; HET: ADP; 1.75A {Geobacillus kaustophilus} (A:1-88,A:220-244)
Probab=99.96  E-value=1.8e-29  Score=204.91  Aligned_cols=86  Identities=40%  Similarity=0.534  Sum_probs=84.0

Q ss_pred             CCCCCEEEECCCEEEEECCCCCEEEEEEECCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCEEE
Q ss_conf             99877636133037687288997999993682451620145568887999999999999987339974057438840023
Q gi|254780973|r    1 MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIGIPHYFIRRINMREQL   80 (255)
Q Consensus         1 m~~~~~lyeGKvK~iY~~~d~~~li~~~~DriSAfD~~~~~~I~gKG~~l~~iS~~~F~~l~~~Gi~th~i~~~~~~~~i   80 (255)
                      |+++++||+||||+||+++|++.|+|+||||+||||++++++|||||++||+||+|||++|+++||||||++.+++++|+
T Consensus         4 m~~~~liYeGK~K~iY~~~d~~~li~~fkDriTAfDg~~~~~IpgKG~~~~~iS~~~F~~L~~~GIpTHfI~~~~~~~~i   83 (113)
T 2ywv_A            4 PTKQQLLYEGKAKKIYATDEPDVLWVEYKDSATAFNGEKKATIAGKGRLNNEISSLLFLKLREAGIANHFIEKLSPTEQL   83 (113)
T ss_dssp             CCEEEEEEECSSEEEEEESSTTEEEEEECSEEEETTTTEEEECTTHHHHHHHHHHHHHHHHHHTTCCBSEEEECSSSEEE
T ss_pred             CCCCCEEEECCCEEEEECCCCCEEEEEEECCCEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEE
T ss_conf             86673556226758998599999999997995403760577768837888898999997443455432210135972058


Q ss_pred             EECCCC
Q ss_conf             100265
Q gi|254780973|r   81 VRDVEM   86 (255)
Q Consensus        81 v~k~~~   86 (255)
                      |+||+.
T Consensus        84 vkklE~   89 (113)
T 2ywv_A           84 VRRVTR   89 (113)
T ss_dssp             EECCET
T ss_pred             EEECCH
T ss_conf             863134


No 10 
>>2gqr_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; PURC, ADE2, ADE1, nucleotide complex, octahedral magnesium coordination; HET: ADP; 2.00A {Escherichia coli} PDB: 2gqs_A* (A:1-85)
Probab=99.96  E-value=5.3e-29  Score=202.00  Aligned_cols=84  Identities=25%  Similarity=0.498  Sum_probs=81.9

Q ss_pred             CCCCEEEECCCEEEEECCCCCEEEEEEECCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCEEEE
Q ss_conf             98776361330376872889979999936824516201455688879999999999999873399740574388400231
Q gi|254780973|r    2 RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIGIPHYFIRRINMREQLV   81 (255)
Q Consensus         2 ~~~~~lyeGKvK~iY~~~d~~~li~~~~DriSAfD~~~~~~I~gKG~~l~~iS~~~F~~l~~~Gi~th~i~~~~~~~~iv   81 (255)
                      +++++||+||||+||+++|++.|+++||||+||||+++++.|||||++||+||++||++|+++||||||++.+++++|+|
T Consensus         2 ~~~~~lyeGK~K~vY~~~d~~~li~~fkD~iTafdg~~~~~i~gKG~~~~~iS~~~F~~L~~~GI~TH~i~~~~~~~~~v   81 (85)
T 2gqr_A            2 QKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGXVNNKFNYFIXSKLAEAGIPTQXERLLSDTECLV   81 (85)
T ss_dssp             CCCEEEEECSSEEEEECSSTTEEEEEECSEECCTTTTCCEECTTHHHHHHHHHHHHHHHHHHTTCCBCEEEECSSSEEEE
T ss_pred             CCCCCCEECCCEEEEECCCCCEEEEEEECCCCCCCCEECCCCCCHHHHHCCCHHHHHHHHCCCCCCCCHHCCCCCCEEEE
T ss_conf             86665200146588886999999999818840436530578784137754015654545413687520102588716888


Q ss_pred             ECCC
Q ss_conf             0026
Q gi|254780973|r   82 RDVE   85 (255)
Q Consensus        82 ~k~~   85 (255)
                      +||+
T Consensus        82 kk~e   85 (85)
T 2gqr_A           82 KKLD   85 (85)
T ss_dssp             ECCE
T ss_pred             EECC
T ss_conf             7515


No 11 
>>3kre_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ATP-binding, ligase; 1.80A {Ehrlichia chaffeensis str} (A:1-104,A:241-263)
Probab=99.96  E-value=7.9e-29  Score=200.89  Aligned_cols=86  Identities=41%  Similarity=0.645  Sum_probs=83.4

Q ss_pred             CCCCCEEEECCCEEEEECCCCCEEEEEEECCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCEEE
Q ss_conf             99877636133037687288997999993682451620145568887999999999999987339974057438840023
Q gi|254780973|r    1 MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIGIPHYFIRRINMREQL   80 (255)
Q Consensus         1 m~~~~~lyeGKvK~iY~~~d~~~li~~~~DriSAfD~~~~~~I~gKG~~l~~iS~~~F~~l~~~Gi~th~i~~~~~~~~i   80 (255)
                      |++.++||+||||+||+++|++.|+|+||||+||||+++++.|||||+++|+||+|||++|+++||||||++.+++++|+
T Consensus        22 m~~~~liyeGK~K~VY~~~d~~~lil~fkDriTAfDg~~~~~I~gKG~l~~~iS~~~F~~L~~~GIpTHfI~~~~~~~mi  101 (127)
T 3kre_A           22 MENKEKIYEGKAKIIFATLNPLEVIQHFKDEITAFNNKKAAIIHEKGILNNYISSFLMKKLIDKGIKTHFISLLNQREQL  101 (127)
T ss_dssp             ----CEEEECSSEEEEECSSTTEEEEEECSEEEETTTTEEEECTTHHHHHHHHHHHHHHHHHHTTCCBSEEEECSSSEEE
T ss_pred             CCCCCEEEECCCEEEEECCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHCCCCHHHH
T ss_conf             64566455226748887599998999997987573640678899888999999999999987413021202014663342


Q ss_pred             EECCCC
Q ss_conf             100265
Q gi|254780973|r   81 VRDVEM   86 (255)
Q Consensus        81 v~k~~~   86 (255)
                      |+|+..
T Consensus       102 vkk~~~  107 (127)
T 3kre_A          102 VKKLNL  107 (127)
T ss_dssp             EECTTC
T ss_pred             HEEHCH
T ss_conf             000232


No 12 
>>2z02_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; 2-layer sandwich, ligase, purine biosynthesis, structural genomics; HET: ATP CIT; 2.03A {Methanocaldococcus jannaschii} PDB: 2yzl_A* (A:1-91,A:223-242)
Probab=99.95  E-value=3.5e-28  Score=196.86  Aligned_cols=85  Identities=31%  Similarity=0.466  Sum_probs=80.9

Q ss_pred             CCCCCEEEECCCEEEEECCCCCEEEEEEECCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCEEE
Q ss_conf             99877636133037687288997999993682451620145568887999999999999987339974057438840023
Q gi|254780973|r    1 MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIGIPHYFIRRINMREQL   80 (255)
Q Consensus         1 m~~~~~lyeGKvK~iY~~~d~~~li~~~~DriSAfD~~~~~~I~gKG~~l~~iS~~~F~~l~~~Gi~th~i~~~~~~~~i   80 (255)
                      |.++++||+||||+||++++ +.++|+|+||+||||++++++|||||++||+||+|||++|+++||||||++.+++++|+
T Consensus         8 ~~~~~liyeGK~K~vY~~~d-~~lll~fkDriTAfDg~~~~~i~gKG~~~~~iS~~~F~~L~~~GI~TH~I~~~~~~~mi   86 (111)
T 2z02_A            8 ILKKQPLYSGKAKSIYEIDD-DKVLIEFRDDITAGNGAKHDVKQGKGYLNALISSKLFEALEENGVKTHYIKYIEPRYMI   86 (111)
T ss_dssp             HTTSCCSEECSSEEEEECSS-SEEEEEECSEEEETTTTEEEECTTHHHHHHHHHHHHHHHHHHTTCCBSEEEEETTTEEE
T ss_pred             HHCCCCCEECCCEEEEECCC-CEEEEEEECCCEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHCCCCCCHH
T ss_conf             74258651024636898189-94999996885503752577789806999998888874214444453022036774320


Q ss_pred             EECCCC
Q ss_conf             100265
Q gi|254780973|r   81 VRDVEM   86 (255)
Q Consensus        81 v~k~~~   86 (255)
                      |+||+-
T Consensus        87 vkkle~   92 (111)
T 2z02_A           87 AKKVEK   92 (111)
T ss_dssp             EECEET
T ss_pred             HCCCCH
T ss_conf             120646


No 13 
>>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} (A:1-89,A:235-260,A:395-425)
Probab=99.94  E-value=8.8e-28  Score=194.31  Aligned_cols=83  Identities=29%  Similarity=0.421  Sum_probs=79.8

Q ss_pred             CCCCCEEEECCCEEEEEC-CCCCEEEEEEECCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCEE
Q ss_conf             998776361330376872-8899799999368245162014556888799999999999998733997405743884002
Q gi|254780973|r    1 MRPRNPVYEEKTKIIYEG-LEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIGIPHYFIRRINMREQ   79 (255)
Q Consensus         1 m~~~~~lyeGKvK~iY~~-~d~~~li~~~~DriSAfD~~~~~~I~gKG~~l~~iS~~~F~~l~~~Gi~th~i~~~~~~~~   79 (255)
                      |++.++|||||||+||++ ++++.++|+||||+|||||++++.|||||+++|+||++||++|+++||||||++.++|++|
T Consensus         7 m~~~klIyeGKtK~VY~~~ed~~~lil~fkDriTAfDg~~~~~I~GKG~i~n~iS~~~Fe~L~~~GI~THfI~~~~~~~m   86 (146)
T 2h31_A            7 LNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRKCGETAF   86 (146)
T ss_dssp             CCCCCCCCBCSSCEEECCTTSCSSCEEEEC---------------CCHHHHHHHHHHHHHHHHHHTCCBSCCEECSSSEE
T ss_pred             HHCCCEEEECCCEEEEECCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEECCCCCCEE
T ss_conf             54389632046748873489999899999789746267577999987899999999999987307999736205899757


Q ss_pred             EEEC
Q ss_conf             3100
Q gi|254780973|r   80 LVRD   83 (255)
Q Consensus        80 iv~k   83 (255)
                      +|||
T Consensus        87 iVk~   90 (146)
T 2h31_A           87 IAPK   90 (146)
T ss_dssp             EEC-
T ss_pred             EEEC
T ss_conf             7762


No 14 
>>1kut_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; structural genomics, saicar synthetase, PSI, protein structure initiative; 2.20A {Thermotoga maritima} (A:1-78,A:200-230)
Probab=99.93  E-value=1.4e-26  Score=186.84  Aligned_cols=81  Identities=25%  Similarity=0.287  Sum_probs=76.9

Q ss_pred             EEECCCEEEEECCCCCEEEEEEECCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCEEEEECCCC
Q ss_conf             36133037687288997999993682451620145568887999999999999987339974057438840023100265
Q gi|254780973|r    7 VYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIGIPHYFIRRINMREQLVRDVEM   86 (255)
Q Consensus         7 lyeGKvK~iY~~~d~~~li~~~~DriSAfD~~~~~~I~gKG~~l~~iS~~~F~~l~~~Gi~th~i~~~~~~~~iv~k~~~   86 (255)
                      -||||||+||+++|  .++|+||||+||||++++++|||||++||+||++||++|+++||||||++.+++++|+|++|++
T Consensus         2 ~YeGKtKdvY~~dD--~lil~fkDriTAfDg~k~~~I~gKG~l~~~iS~~~Fe~Le~~GIpTHfI~~i~~~~mlVkk~e~   79 (109)
T 1kut_A            2 NYEGKTKIVKVTGD--YALLEFKDDITAGDGLKHDVLTGKGSICAETTAILXKYLSEKGIKTHLVEYIPPRTLKVIPLKI   79 (109)
T ss_dssp             -----CEEEEEETT--EEEEEECCC-----------CCSHHHHHHHHHHHHHHHHHHTTCCBSEEEEETTTEEEECCCEC
T ss_pred             CCCCCEEEEEECCC--EEEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHCCCCCEEEEEECCC
T ss_conf             30020018872699--3899997884510752578899730999999999998763059881253046750788776143


Q ss_pred             CCE
Q ss_conf             535
Q gi|254780973|r   87 IPL   89 (255)
Q Consensus        87 iPi   89 (255)
                      +.-
T Consensus        80 ~~~   82 (109)
T 1kut_A           80 FDK   82 (109)
T ss_dssp             CCH
T ss_pred             CCH
T ss_conf             275


No 15 
>>2cnq_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; ligase, phosphoribosylaminoimidazolesuccinocarboxamide (saicar) SYN ligase; HET: ADP AMZ AMP; 1.00A {Saccharomyces cerevisiae} (A:1-112,A:253-305)
Probab=95.05  E-value=0.021  Score=34.93  Aligned_cols=42  Identities=12%  Similarity=0.077  Sum_probs=29.5

Q ss_pred             EECCCCCEEEECCCCCCCCHHHHHCCHH------------------HHHHHHHHHHHHHC
Q ss_conf             3058741411767567044787612367------------------79999999999714
Q gi|254780973|r  196 EIFPDCCRLWDLSKKEECDKKRFSKSND------------------QLLEGYSEVARRLG  237 (255)
Q Consensus       196 EItPDs~R~Wd~~~~e~lDKd~~R~~l~------------------~v~~~Y~ev~~rl~  237 (255)
                      ++..-|+.--..+..++||||++|+||.                  ...++|.|+++||-
T Consensus       100 ~~~gRs~~vkk~~~q~s~dKq~vRdwl~~~~~~~~~~p~lp~~iv~~t~~~Y~e~~e~lt  159 (165)
T 2cnq_A          100 QLEDRSLLVHKHKSQDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLT  159 (165)
T ss_dssp             HHHTTSEEEEECCSCCCCSSTHHHHHHHHHTTCTTCTTCCCCHHHHHHHHHHHHHHHHHH
T ss_pred             HCCCCCEEEEEECCCCCCCCHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             115884279985087545245999989986686789888899999999999999999998


No 16 
>>1kut_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; structural genomics, saicar synthetase, PSI, protein structure initiative; 2.20A {Thermotoga maritima} (A:1-78,A:200-230)
Probab=94.95  E-value=0.018  Score=35.24  Aligned_cols=86  Identities=15%  Similarity=0.150  Sum_probs=56.6

Q ss_pred             CHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCCEEEEECCCCCCCEEEEEEEECCCCCEEEECCCCCC
Q ss_conf             55788885408989997899999999999999999879766312066631046888879999630587414117675670
Q gi|254780973|r  133 SEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLLDDDILRIVLADEIFPDCCRLWDLSKKEE  212 (255)
Q Consensus       133 ~~~~~~~~~~~~~~~~~~i~~~a~~i~~~l~~~~~~~Gl~LvD~K~EFG~~~~~~~g~iiL~DEItPDs~R~Wd~~~~e~  212 (255)
                      ..|.+.+++-+-.+++..=-....++....-+.....|+-                  =-++.-++|.+|..   ..-+.
T Consensus        21 fkDriTAfDg~k~~~I~gKG~l~~~iS~~~Fe~Le~~GIp------------------THfI~~i~~~~mlV---kk~e~   79 (109)
T 1kut_A           21 FKDDITAGDGLKHDVLTGKGSICAETTAILXKYLSEKGIK------------------THLVEYIPPRTLKV---IPLKI   79 (109)
T ss_dssp             ECCC-----------CCSHHHHHHHHHHHHHHHHHHTTCC------------------BSEEEEETTTEEEE---CCCEC
T ss_pred             EECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCC------------------CHHHHCCCCCEEEE---EECCC
T ss_conf             9788451075257889973099999999999876305988------------------12530467507887---76143


Q ss_pred             CCHHHHHCCHHHHHHHHHHHHHHHCCC
Q ss_conf             447876123677999999999971423
Q gi|254780973|r  213 CDKKRFSKSNDQLLEGYSEVARRLGIF  239 (255)
Q Consensus       213 lDKd~~R~~l~~v~~~Y~ev~~rl~~~  239 (255)
                      ||||+||++||+...+|.||++-+..+
T Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~  106 (109)
T 1kut_A           80 FDKDVYRRDLGDPLKKYREVLELCRSL  106 (109)
T ss_dssp             CCHHHHHHGGGCTTHHHHHHHHHHHHH
T ss_pred             CCHHHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             275888711201659999999999875


No 17 
>>3ffz_A Botulinum neurotoxin type E; botulinum neurotoxin serotype E, botulism, domain organization, endopeptidase, translocation, hydrolase; 2.65A {Clostridium botulinum} (A:258-334)
Probab=30.24  E-value=30  Score=15.04  Aligned_cols=31  Identities=23%  Similarity=0.503  Sum_probs=23.2

Q ss_pred             CHHHHHCCHHHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             47876123677999999999971423236878886
Q gi|254780973|r  214 DKKRFSKSNDQLLEGYSEVARRLGIFKKNEPALKE  248 (255)
Q Consensus       214 DKd~~R~~l~~v~~~Y~ev~~rl~~~~~~~p~~~~  248 (255)
                      +++++++    +...|+.||.||+.....-|++.+
T Consensus        11 ~~~~~~~----~l~~y~~IA~rLn~v~~~~~~i~~   41 (77)
T 3ffz_A           11 SNDIYTN----LLADYKKIASKLSKVQVSNPLLNP   41 (77)
T ss_dssp             HHHHHHH----HHHHHHHHTTTSSSCCCSSTTSCT
T ss_pred             HHHHHHH----HHHHHHHHHHHHHHHHCCCCCHHH
T ss_conf             6779999----999999999988764078732789


No 18 
>>1t3c_A Neurotoxin type E; catalytic domain, E212Q mutant, light chain, hydrolase; 1.90A {Clostridium botulinum} (A:257-333)
Probab=24.60  E-value=44  Score=13.98  Aligned_cols=30  Identities=23%  Similarity=0.525  Sum_probs=21.4

Q ss_pred             CHHHHHCCHHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             4787612367799999999997142323687888
Q gi|254780973|r  214 DKKRFSKSNDQLLEGYSEVARRLGIFKKNEPALK  247 (255)
Q Consensus       214 DKd~~R~~l~~v~~~Y~ev~~rl~~~~~~~p~~~  247 (255)
                      +++++++    +...|+.||.||+.....-|++.
T Consensus        11 ~~~~~~~----~l~~y~~IA~rLn~v~~~~~~i~   40 (77)
T 1t3c_A           11 SNDIYTN----LLADYKKIASKLSKVQVSNPLLN   40 (77)
T ss_dssp             HHHHHHH----HHHHHHHHHHHHHTSCCSCGGGH
T ss_pred             HHHHHHH----HHHHHHHHHHHHHHHHCCCCCHH
T ss_conf             7779999----99999999999988636883178


No 19 
>>1jdw_A L-arginine\:glycine amidinotransferase; creatine biosynthesis, catalytic triad, reaction mechanism, novel fold, fivefold pseudosymmetry; 1.90A {Homo sapiens} (A:167-222)
Probab=21.22  E-value=26  Score=15.48  Aligned_cols=33  Identities=24%  Similarity=0.361  Sum_probs=20.5

Q ss_pred             CEEEEEEEE--CCCCCEE--EECCCCCCCCHHHHHCC
Q ss_conf             879999630--5874141--17675670447876123
Q gi|254780973|r  189 LRIVLADEI--FPDCCRL--WDLSKKEECDKKRFSKS  221 (255)
Q Consensus       189 g~iiL~DEI--tPDs~R~--Wd~~~~e~lDKd~~R~~  221 (255)
                      +-++++|||  ||=++|-  +....+..+=+++|+.+
T Consensus         5 ~llvvG~~IIEapm~~R~RyfE~~ayr~ll~eYf~~G   41 (56)
T 1jdw_A            5 ILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRG   41 (56)
T ss_dssp             HEEEEBTEEEECCBSCGGGTTGGGGTHHHHHHHHHTT
T ss_pred             EEEEECCCEEECCCCCHHCCCCHHHHHHHHHHHHHCC
T ss_conf             2688777133156530210246655425778764137


Done!