BLAST/PSIBLAST alignment of GI: 254780973 and GI: 190891978 at iteration 1
>gi|190891978|ref|YP_001978520.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Rhizobium etli CIAT 652] Length = 254
>gi|218663435|ref|ZP_03519365.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium etli IE4771] Length = 254
>gi|190697257|gb|ACE91342.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase protein [Rhizobium etli CIAT 652] Length = 254
>gi|327190550|gb|EGE57644.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase protein [Rhizobium etli CNPAF512] Length = 254
 Score =  333 bits (853), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 157/245 (64%), Positives = 194/245 (79%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQFFKDD    N  +   ++GKGVLNNRISEY+F+ 
Sbjct: 1   MNRRRRIYEGKAKILYEGPEPGTLIQFFKDDATAFNKKKHEVIDGKGVLNNRISEYIFSH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L KIGIP +FIRR+NMREQL+++VEMIPL I VRN AAGSLAKRL I EG+ LPRS++EF
Sbjct: 61  LNKIGIPTHFIRRLNMREQLIKEVEMIPLEIVVRNVAAGSLAKRLGIEEGVVLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  +VSEEHITAF WAN +E++++ AL+IR+NDFMTGLFLG+ IQLVDF+I+C
Sbjct: 121 YYKSDALDDPMVSEEHITAFGWANPAELDDIMALAIRVNDFMTGLFLGVGIQLVDFKIEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RI+LADEI PD CRLWD+  +E+ DK RF +    LLE YSEVARRLGI  
Sbjct: 181 GRLFEGDMMRIILADEISPDSCRLWDIETREKMDKDRFRRDLGGLLEAYSEVARRLGIIN 240

Query: 241 KNEPA 245
           +NEP 
Sbjct: 241 ENEPV 245