PSIBLAST alignment of GI: 254780973 and protein with PDB id: 1obd

>gi|157879484|pdb|1OBD|A Chain A, Saicar-Synthase Complexed With Atp Length = 305
>gi|157879485|pdb|1OBG|A Chain A, Saicar-Synthase Complexed With Atp Length = 305
 Score =  161 bits (407), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 45/258 (17%), Positives = 82/258 (31%), Gaps = 45/258 (17%)

Query: 6   PVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIG 65
            V   K + IYE  + GTL+    D     +     ++  KG+L  ++SE+ F  L    
Sbjct: 13  LVARGKVRDIYEV-DAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDV 71

Query: 66  IPH---------------------YFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKR 104
             H                      +  ++  R  LV   ++IPL + VR    GS  K 
Sbjct: 72  RNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAWKE 131

Query: 105 LNIPEGLSLPRSLVEFYYLPDSSEKTLV-------------SEEHITAFNWANQSEVEEM 151
             +  G        +         + +              +     A     +     +
Sbjct: 132 Y-VKTGTVHGLKQPQGLKESQEFPEPIFTPSTKAEQGEHDENISPAQAAELVGEDLSRRV 190

Query: 152 TALSIRINDFMTGLFLGINIQLVDFRIKCGRLLDDDILRIVLADEI-FPDCCRLWDLSKK 210
             L++++            I + D + + G   D+    I+L DE+  PD  R W+ +  
Sbjct: 191 AELAVKLYSKCKDYAKEKGIIIADTKFEFGI--DEKTNEIILVDEVLTPDSSRFWNGASY 248

Query: 211 E------ECDKKRFSKSN 222
           +        DK+      
Sbjct: 249 KVGESQDSYDKQFLRDWL 266