BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780973|ref|YP_003065386.1|
phosphoribosylaminoimidazole-succinocarboxamide synthase [Candidatus
Liberibacter asiaticus str. psy62]
         (255 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|300023608|ref|YP_003756219.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525429|gb|ADJ23898.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Hyphomicrobium denitrificans ATCC 51888]
          Length = 263

 Score =  293 bits (749), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 142/252 (56%), Positives = 183/252 (72%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  + A + GKGVLNNRISEY+F +
Sbjct: 1   MNKRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHALIEGKGVLNNRISEYIFAK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+IG+P +FI+R+NMREQL+R+VE++PL + VRN AAGSLA RL + EG  LPRS+VEF
Sbjct: 61  LGEIGVPTHFIKRLNMREQLIREVEIVPLEVVVRNIAAGSLATRLGLEEGAQLPRSIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA   E++E+  L++R+NDF+ GLFLGI I+LVDF+++ 
Sbjct: 121 YYKKDELNDPMVSEEHITAFGWATPQEIDEIMQLALRVNDFLVGLFLGIGIRLVDFKVEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL D++ +RIVLADEI PDCCRLWD    ++ DK RF +    +LE Y EVARRLG+  
Sbjct: 181 GRLYDNEQVRIVLADEISPDCCRLWDAQSGDKLDKDRFRRDLGGVLEAYQEVARRLGVLT 240

Query: 241 KNEPALKENLIL 252
           +N        +L
Sbjct: 241 ENPRPRGAGPVL 252


>gi|254476681|ref|ZP_05090067.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ruegeria
           sp. R11]
 gi|214030924|gb|EEB71759.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ruegeria
           sp. R11]
          Length = 253

 Score =  290 bits (741), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 125/253 (49%), Positives = 176/253 (69%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +YEG EPGT++Q+FKDD    N  +   + GKGVLNN +SE+    
Sbjct: 1   MARRKKIYEGKAKTLYEGPEPGTIVQYFKDDATAFNAEKHDVIEGKGVLNNILSEFFMQG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+IG+P +F++R+NMREQLVR  E+IPL + VRN AAGS+ KRL + EG  LPR +VE+
Sbjct: 61  LGQIGVPTHFLKRLNMREQLVRSCEIIPLEVIVRNYAAGSICKRLGLEEGTQLPRPIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    LV+EEHI AF WA+Q +++++ +L++R+NDFM+G+ L + I+LVDF+I+ 
Sbjct: 121 CYKDDALGDPLVTEEHIAAFGWASQQDMDDILSLALRVNDFMSGVMLAVGIKLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D D  R+V+ADEI PD CRLWDL   ++ DK  F +    L + Y+EVARRLG+  
Sbjct: 181 GRIYDGDFQRLVVADEISPDSCRLWDLKTGQKLDKDVFRRDLGSLTDAYTEVARRLGVMP 240

Query: 241 KNEPALKENLILN 253
            N PA  +  ++N
Sbjct: 241 NNPPAPGKPTLVN 253


>gi|23013896|ref|ZP_00053745.1| COG0152: Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR)
           synthase [Magnetospirillum magnetotacticum MS-1]
          Length = 254

 Score =  288 bits (738), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 139/254 (54%), Positives = 186/254 (73%), Gaps = 1/254 (0%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K+++EG EPGTL+Q+FKDD    NN +  T+ GKGVLNNRISEY+  +
Sbjct: 1   MARRRQIYEGKAKVLFEGPEPGTLVQYFKDDASAFNNKKRGTITGKGVLNNRISEYLMLR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+IG+P +F+RR+NMREQLVR+VE+IPL + VRN AAGSLA+R  + EG  LPR +VE+
Sbjct: 61  LGEIGVPTHFVRRLNMREQLVREVEIIPLEVVVRNVAAGSLAQRFGLSEGTPLPRCIVEW 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D+ +  +VSEEHITAF WA   +++EM +L++RINDF+ GLFLG+ I+LVDF+I+ 
Sbjct: 121 YFKSDALDDPMVSEEHITAFGWATTQDLDEMMSLALRINDFLCGLFLGVGIRLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D ++IVLADEI PD CRLWDL   ++ DK RF +    + E Y EVARRLGI  
Sbjct: 181 GRLYNGDDMQIVLADEISPDSCRLWDLRTGDKMDKDRFRRDLGGVEEAYQEVARRLGILP 240

Query: 241 KNEP-ALKENLILN 253
           +  P  LK   ++ 
Sbjct: 241 EGGPRDLKGPALMQ 254


>gi|83310638|ref|YP_420902.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Magnetospirillum magneticum AMB-1]
 gi|82945479|dbj|BAE50343.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Magnetospirillum magneticum AMB-1]
          Length = 254

 Score =  288 bits (738), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 140/254 (55%), Positives = 186/254 (73%), Gaps = 1/254 (0%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K+++EG EPGTL+Q+FKDD    NN +  T+ GKGVLNNRISEY+  +
Sbjct: 1   MARRRQIYEGKAKVLFEGPEPGTLVQYFKDDATAFNNKKRGTITGKGVLNNRISEYLMLR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+IGIP +F+RR+NMREQLVR+VE+IPL + VRN AAGSLA+R  + EG  LPR +VE+
Sbjct: 61  LGEIGIPTHFVRRLNMREQLVREVEIIPLEVVVRNVAAGSLAQRFGLSEGTPLPRCIVEW 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D+ +  +VSEEHITAF WA   +++EM +L++RINDF+ GLFLG+ I+LVDF+I+ 
Sbjct: 121 YFKSDALDDPMVSEEHITAFGWATTQDLDEMMSLALRINDFLCGLFLGVGIRLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D ++IVLADEI PD CRLWDL   ++ DK RF +    + E Y EVARRLGI  
Sbjct: 181 GRLYNGDDMQIVLADEISPDSCRLWDLRTGDKMDKDRFRRDLGGVEEAYQEVARRLGILP 240

Query: 241 KNEP-ALKENLILN 253
           +  P  LK   ++ 
Sbjct: 241 EGGPRDLKGPALMQ 254


>gi|162211271|ref|YP_576912.2| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nitrobacter hamburgensis X14]
          Length = 255

 Score =  288 bits (737), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 142/254 (55%), Positives = 188/254 (74%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   + GKGVLNNRISEY+F  
Sbjct: 1   MSRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHQVIEGKGVLNNRISEYLFQH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE++PL + VRN AAGSL++RL I EG  LPRS++EF
Sbjct: 61  LNDIGVPTHFIRRLNMREQLIREVEIVPLEVVVRNVAAGSLSQRLGIEEGTQLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEH+TAF WA   E++++ AL+IR+NDF+TGLFLGI I+LVDF+++C
Sbjct: 121 YYKNDQLNDPMVSEEHVTAFGWATPQEIDDIMALAIRVNDFLTGLFLGIGIRLVDFKMEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL +++++RI++ADEI PD CRLWD+   E+ DK RF +    LLE Y+EVA+RLGI  
Sbjct: 181 GRLFENEMMRIIVADEISPDSCRLWDIKSNEKLDKDRFRRDLGGLLEAYTEVAKRLGILM 240

Query: 241 KNEPALKENLILNR 254
           +NE  L    +L +
Sbjct: 241 ENERPLGAGPVLVK 254


>gi|39936882|ref|NP_949158.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris CGA009]
 gi|39650739|emb|CAE29262.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris CGA009]
          Length = 255

 Score =  288 bits (736), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 142/254 (55%), Positives = 187/254 (73%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   + GKGVLNNRISEY+F  
Sbjct: 1   MSRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHQVIEGKGVLNNRISEYLFQH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE++PL + VRN AAGSL++RL I EG  LPRS++EF
Sbjct: 61  LNDIGVPTHFIRRLNMREQLIREVEIVPLEVVVRNVAAGSLSQRLGIEEGTQLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA   E++++ AL+IR+NDF+TGLFLGI I+LVDF+++C
Sbjct: 121 YYKNDQLNDPMVSEEHITAFGWATPQEIDDIMALAIRVNDFLTGLFLGIGIRLVDFKMEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + +++RI++ADEI PD CRLWD+   E+ DK RF +    LLE Y+EVA+RLGI  
Sbjct: 181 GRLFESEMMRIIVADEISPDSCRLWDIKSNEKLDKDRFRRDLGGLLEAYTEVAKRLGILM 240

Query: 241 KNEPALKENLILNR 254
           +NE  +    +L +
Sbjct: 241 ENERPIGSGPVLVK 254


>gi|85715188|ref|ZP_01046172.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nitrobacter sp. Nb-311A]
 gi|85698103|gb|EAQ35976.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nitrobacter sp. Nb-311A]
          Length = 255

 Score =  288 bits (736), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 141/254 (55%), Positives = 188/254 (74%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   + GKGVLNNRISEY+F  
Sbjct: 1   MSRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHQVIEGKGVLNNRISEYLFQH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE++PL + +RN AAGSL++RL I EG  LPRS++EF
Sbjct: 61  LNDIGVPTHFIRRLNMREQLIREVEIVPLEVVIRNVAAGSLSQRLGIEEGTQLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEH+TAF WA   E++++ AL+IR+NDF+TGLFLGI I+LVDF+++C
Sbjct: 121 YYKNDQLNDPMVSEEHVTAFGWATPQEIDDIMALAIRVNDFLTGLFLGIGIRLVDFKMEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL +++++RIV+ADEI PD CRLWD+   E+ DK RF +    LLE Y+EVA+RLGI  
Sbjct: 181 GRLFENEMMRIVVADEISPDSCRLWDMKSNEKLDKDRFRRDLGGLLEAYTEVAKRLGILM 240

Query: 241 KNEPALKENLILNR 254
           +NE  +    +L +
Sbjct: 241 ENERPIGAGPVLVK 254


>gi|162139848|ref|YP_317917.2| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nitrobacter winogradskyi Nb-255]
          Length = 255

 Score =  287 bits (735), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 141/254 (55%), Positives = 187/254 (73%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   + GKGVLNNRISEY+F  
Sbjct: 1   MSRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHQVIEGKGVLNNRISEYLFQH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE++PL + VRN AAGSL++RL I EG  LPRS++EF
Sbjct: 61  LNDIGVPTHFIRRLNMREQLIREVEIVPLEVVVRNVAAGSLSQRLGIEEGTQLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEH+TAF WA   E++++ AL+IR+NDF+TGLFLGI I+LVDF+++C
Sbjct: 121 YYKNDQLNDPMVSEEHVTAFGWATPQEIDDIMALAIRVNDFLTGLFLGIGIRLVDFKMEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL +++++RIV+ADEI PD CRLWD+   E+ DK  F +    LLE Y+EVA+RLGI  
Sbjct: 181 GRLFENEMMRIVVADEISPDSCRLWDIKSNEKLDKDVFRRDLGGLLEAYTEVAKRLGILM 240

Query: 241 KNEPALKENLILNR 254
           +NE  +    +L +
Sbjct: 241 ENERPIGAGPVLVK 254


>gi|182680026|ref|YP_001834172.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182635909|gb|ACB96683.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 264

 Score =  287 bits (735), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 137/245 (55%), Positives = 184/245 (75%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   ++GKGVLNNRISE++F  
Sbjct: 11  MNRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHEVIDGKGVLNNRISEFIFQN 70

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE++PL + VRN AAGSL+ RL I EG  LPRS++EF
Sbjct: 71  LNDIGVPTHFIRRLNMREQLIREVEIVPLEVVVRNVAAGSLSTRLGIEEGTQLPRSIIEF 130

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEH+TAF WA+  E++++ AL+IR+NDF++GLFLG+ I+LVDF+++C
Sbjct: 131 YYKNDELNDPMVSEEHVTAFGWASPQEIDDIMALAIRVNDFLSGLFLGVGIRLVDFKMEC 190

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RIV+ADEI PD CRLWD+   ++ DK RF +    L+E Y+EVARRLGI  
Sbjct: 191 GRLWEGDMMRIVVADEISPDSCRLWDIKSNDKLDKDRFRRDLGGLVEAYTEVARRLGILP 250

Query: 241 KNEPA 245
           ++E  
Sbjct: 251 ESEQP 255


>gi|27380840|ref|NP_772369.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bradyrhizobium japonicum USDA 110]
 gi|146339776|ref|YP_001204824.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bradyrhizobium sp. ORS278]
 gi|148256702|ref|YP_001241287.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bradyrhizobium sp. BTAi1]
 gi|39931933|sp|Q89IB0|PUR71_BRAJA RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase A; AltName: Full=SAICAR synthetase A
 gi|27354005|dbj|BAC50994.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bradyrhizobium japonicum USDA 110]
 gi|146192582|emb|CAL76587.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase (SAICAR
           synthetase) [Bradyrhizobium sp. ORS278]
 gi|146408875|gb|ABQ37381.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bradyrhizobium sp. BTAi1]
          Length = 255

 Score =  287 bits (735), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 142/254 (55%), Positives = 187/254 (73%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   + GKGVLNNRISEY+F  
Sbjct: 1   MSRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHQVIEGKGVLNNRISEYLFQH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE++PL + VRN AAGSL++RL I EG  LPRS++EF
Sbjct: 61  LNDIGVPTHFIRRLNMREQLIREVEIVPLEVVVRNVAAGSLSQRLGIEEGTQLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA   E++++ AL+IR+NDF+TGLFLGI I+LVDF+++C
Sbjct: 121 YYKNDQLNDPMVSEEHITAFGWATPQEIDDIMALAIRVNDFLTGLFLGIGIRLVDFKMEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL +++++RI++ADEI PD CRLWD+   E+ DK RF +    LLE Y+EVA+RLGI  
Sbjct: 181 GRLFENEMMRIIVADEISPDSCRLWDIKSNEKLDKDRFRRDLGGLLEAYTEVAKRLGILM 240

Query: 241 KNEPALKENLILNR 254
           +NE       +L +
Sbjct: 241 ENERPAGSGPVLVK 254


>gi|162138290|ref|YP_568884.2| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris BisB5]
          Length = 255

 Score =  287 bits (735), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 142/254 (55%), Positives = 188/254 (74%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   + GKGVLNNRISEY+F  
Sbjct: 1   MSRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHQVIEGKGVLNNRISEYLFQH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE++PL + VRN AAGSL++RL I EG  LPRS++EF
Sbjct: 61  LNDIGVPTHFIRRLNMREQLIREVEIVPLEVVVRNVAAGSLSQRLGIEEGTQLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA   E++++ AL+IR+NDF+TGLFLGI I+LVDF+++C
Sbjct: 121 YYKNDQLNDPMVSEEHITAFGWATPQEIDDIMALAIRVNDFLTGLFLGIGIRLVDFKMEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL +++++RI++ADEI PD CRLWD+   E+ DK RF +    LLE Y+EVA+RLGI  
Sbjct: 181 GRLFENEMMRIIVADEISPDSCRLWDIKSNEKLDKDRFRRDLGGLLEAYTEVAKRLGILM 240

Query: 241 KNEPALKENLILNR 254
           +NE  +    +L +
Sbjct: 241 ENERPVGSGPVLVK 254


>gi|163736214|ref|ZP_02143633.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Phaeobacter gallaeciensis BS107]
 gi|163741258|ref|ZP_02148650.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Phaeobacter gallaeciensis 2.10]
 gi|161385611|gb|EDQ09988.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Phaeobacter gallaeciensis 2.10]
 gi|161390084|gb|EDQ14434.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Phaeobacter gallaeciensis BS107]
          Length = 253

 Score =  287 bits (735), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 125/253 (49%), Positives = 177/253 (69%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +YEG EPGT++Q+FKDD    N  +   + GKGVLNN +SE+    
Sbjct: 1   MARRKKIYEGKAKTLYEGPEPGTIVQYFKDDATAFNAEKRDVIEGKGVLNNLLSEFFMQG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+IG+P +F++R+NMREQLVR  E+IPL + VRN AAGS++KRL I EG  LPR +VE+
Sbjct: 61  LGQIGVPTHFLKRLNMREQLVRSCEIIPLEVIVRNYAAGSISKRLGIEEGTQLPRPIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    LV+EEHI AF WA+Q +++++ +L++R+NDF++G+ L + I+LVDF+I+ 
Sbjct: 121 CYKDDALGDPLVTEEHIAAFGWASQQDMDDILSLALRVNDFLSGVMLAVGIKLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D D  R+V+ADEI PD CRLWDL   ++ DK  F +    L + Y+EVARRLG+  
Sbjct: 181 GRIYDGDFQRLVVADEISPDSCRLWDLKTGQKLDKDVFRRDLGNLTDAYTEVARRLGVMP 240

Query: 241 KNEPALKENLILN 253
            N PA  +  ++N
Sbjct: 241 NNPPAGGKPTLVN 253


>gi|162138519|ref|YP_487325.2| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris HaA2]
          Length = 255

 Score =  287 bits (734), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 143/254 (56%), Positives = 187/254 (73%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   + GKGVLNNRISEY+F  
Sbjct: 1   MSRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHQVIEGKGVLNNRISEYLFQH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE++PL + VRN AAGSL++RL I EG  LPRS++EF
Sbjct: 61  LNDIGVPTHFIRRLNMREQLIREVEIVPLEVVVRNVAAGSLSQRLGIEEGTQLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA   E++++ AL+IR+NDF+TGLFLGI I+LVDF+++C
Sbjct: 121 YYKNDQLNDPMVSEEHITAFGWATPQEIDDIMALAIRVNDFLTGLFLGIGIRLVDFKMEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL ++D++RI++ADEI PD CRLWD+   E+ DK RF +    LLE Y+EVA+RLGI  
Sbjct: 181 GRLFENDMMRIIVADEISPDSCRLWDIKSNEKLDKDRFRRDLGGLLEAYTEVAKRLGILM 240

Query: 241 KNEPALKENLILNR 254
           +NE       +L +
Sbjct: 241 ENERPAGSGPVLVK 254


>gi|154253030|ref|YP_001413854.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Parvibaculum lavamentivorans DS-1]
 gi|171769655|sp|A7HWB4|PUR7_PARL1 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|154156980|gb|ABS64197.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Parvibaculum lavamentivorans DS-1]
          Length = 253

 Score =  287 bits (734), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 146/252 (57%), Positives = 188/252 (74%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  VYE K K++YEG EPGTLIQ FKDD    +  + AT+ GKGVLNNRISE++FT+
Sbjct: 1   MSRRRRVYEGKAKVLYEGPEPGTLIQHFKDDATAFDAQKRATIEGKGVLNNRISEFIFTR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IG+P +FIR +NMREQL+R+VE+IP  + VRN AAGSL+KRL I EG  LPRS++EF
Sbjct: 61  LNEIGVPTHFIRALNMREQLIREVEIIPCEVVVRNVAAGSLSKRLGIDEGTVLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA   E+++M AL++RINDF+TGLFLGI I+LVDF+++ 
Sbjct: 121 YYKNDELHDPMVSEEHITAFGWATPQEIDDMMALALRINDFLTGLFLGIGIRLVDFKVEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + +++R+VLADEI PDCCRLWD    ++ DK RF +    L+E YSEVARRLGI  
Sbjct: 181 GRLYEGEMVRVVLADEISPDCCRLWDTRTNDKMDKDRFRRDMGGLIEAYSEVARRLGILF 240

Query: 241 KNEPALKENLIL 252
           +NEP      ++
Sbjct: 241 ENEPKRSGPKLV 252


>gi|15965525|ref|NP_385878.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sinorhizobium meliloti 1021]
 gi|307302645|ref|ZP_07582401.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sinorhizobium meliloti BL225C]
 gi|307318492|ref|ZP_07597926.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sinorhizobium meliloti AK83]
 gi|22001861|sp|Q92PI3|PUR7_RHIME RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|15074706|emb|CAC46351.1| Probable phosphoribosylaminoimidazole-succinocarboxamide synthase
           (SAICAR synthetase) [Sinorhizobium meliloti 1021]
 gi|306895832|gb|EFN26584.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sinorhizobium meliloti AK83]
 gi|306903009|gb|EFN33600.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sinorhizobium meliloti BL225C]
          Length = 254

 Score =  287 bits (734), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 155/254 (61%), Positives = 194/254 (76%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQFFKDD    N  +   ++GKGVLNNRISEY+FT 
Sbjct: 1   MNRRRRIYEGKAKILYEGPEPGTLIQFFKDDATAFNKKKHDVIDGKGVLNNRISEYIFTH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L KIGIP +FIRR+NMREQL+++VE+IPL I VRN AAGSLAKRL I EG  LPRS++EF
Sbjct: 61  LNKIGIPTHFIRRLNMREQLIKEVEIIPLEIVVRNVAAGSLAKRLGIEEGTVLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  +VSEEHITAF WA+  E++++ AL+IRINDF++GLFLG+ IQLVDF+++C
Sbjct: 121 YYKADALDDPMVSEEHITAFGWASPQELDDIMALAIRINDFLSGLFLGVGIQLVDFKVEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RIVLADEI PD CRLWD+  KE+ DK RF +    L+E Y EVARRLGI  
Sbjct: 181 GRLYEGDMMRIVLADEISPDSCRLWDIETKEKMDKDRFRRDMGGLVEAYQEVARRLGIIN 240

Query: 241 KNEPALKENLILNR 254
           +NEP      +L +
Sbjct: 241 ENEPPRGSGPVLVK 254


>gi|99037586|gb|ABF64198.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ruegeria
           sp. TM1040]
          Length = 274

 Score =  287 bits (734), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 124/253 (49%), Positives = 176/253 (69%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +YEG EPGT++Q+FKDD    N  +   + GKGVLNN +SE+    
Sbjct: 22  MARRKKIYEGKAKTLYEGPEPGTIVQYFKDDATAFNAEKHDVIEGKGVLNNILSEFFMLG 81

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+IG+P +F++R+NMREQLVR  E++PL I VRN AAGSL KRL + EG  LPR +VE+
Sbjct: 82  LGQIGVPTHFLKRLNMREQLVRSCEIVPLEIIVRNYAAGSLCKRLGMDEGTQLPRPIVEY 141

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    LV+EEHI AF WA+Q +++++ +L++R+NDF++G+ L + I+LVDF+I+ 
Sbjct: 142 CYKDDALGDPLVTEEHIAAFGWASQQDMDDILSLALRVNDFLSGVMLAVGIRLVDFKIEI 201

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D D  R+V+ADEI PD CRLWD+   ++ DK  F +    L + Y+EVARRLG+  
Sbjct: 202 GRIYDGDFQRLVVADEISPDSCRLWDIKTGQKLDKDVFRRDLGSLTDAYTEVARRLGVMP 261

Query: 241 KNEPALKENLILN 253
            N PA  +  ++N
Sbjct: 262 NNPPAPGKPQLVN 274


>gi|91800077|gb|ABE62452.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nitrobacter hamburgensis X14]
          Length = 277

 Score =  287 bits (734), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 142/254 (55%), Positives = 188/254 (74%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   + GKGVLNNRISEY+F  
Sbjct: 23  MSRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHQVIEGKGVLNNRISEYLFQH 82

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE++PL + VRN AAGSL++RL I EG  LPRS++EF
Sbjct: 83  LNDIGVPTHFIRRLNMREQLIREVEIVPLEVVVRNVAAGSLSQRLGIEEGTQLPRSIIEF 142

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEH+TAF WA   E++++ AL+IR+NDF+TGLFLGI I+LVDF+++C
Sbjct: 143 YYKNDQLNDPMVSEEHVTAFGWATPQEIDDIMALAIRVNDFLTGLFLGIGIRLVDFKMEC 202

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL +++++RI++ADEI PD CRLWD+   E+ DK RF +    LLE Y+EVA+RLGI  
Sbjct: 203 GRLFENEMMRIIVADEISPDSCRLWDIKSNEKLDKDRFRRDLGGLLEAYTEVAKRLGILM 262

Query: 241 KNEPALKENLILNR 254
           +NE  L    +L +
Sbjct: 263 ENERPLGAGPVLVK 276


>gi|114328330|ref|YP_745487.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Granulibacter bethesdensis CGDNIH1]
 gi|114316504|gb|ABI62564.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Granulibacter bethesdensis CGDNIH1]
          Length = 298

 Score =  287 bits (734), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 131/244 (53%), Positives = 182/244 (74%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI++EG EPGTL+Q+FKDD    N  +   + GKGVLNNRISEY+  +
Sbjct: 45  MARRRQLYEGKAKILFEGPEPGTLVQYFKDDATAGNGAKKGIITGKGVLNNRISEYLMQR 104

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+IGIP +F+RR+NMREQL+R+VE+IPL + VRN AAGS++ RL IPEG  LPRS++E+
Sbjct: 105 LGEIGIPTHFVRRLNMREQLIREVEIIPLEVVVRNVAAGSISSRLGIPEGTRLPRSILEY 164

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    +V+EEHITAF WA+ ++++++ +L++R+NDF++GLFLG+ I LVDF+++ 
Sbjct: 165 YYKNDALNDPMVAEEHITAFGWASTTDMDDIVSLTLRVNDFLSGLFLGVGILLVDFKLEF 224

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL +++ +RIVLADEI PD CRLWD    E+ DK RF +    + E Y EVA+RLGI  
Sbjct: 225 GRLWENEEMRIVLADEISPDNCRLWDAKTNEKMDKDRFRRDLGGVEEAYQEVAKRLGILP 284

Query: 241 KNEP 244
           +   
Sbjct: 285 EAGS 288


>gi|227822166|ref|YP_002826137.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sinorhizobium fredii NGR234]
 gi|254783970|sp|C3MD65|PUR7_RHISN RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|227341166|gb|ACP25384.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) PurC [Sinorhizobium fredii NGR234]
          Length = 254

 Score =  286 bits (733), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 155/254 (61%), Positives = 194/254 (76%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQFFKDD    N  +   ++GKGVLNNRISEY+FT 
Sbjct: 1   MNRRRRIYEGKAKILYEGPEPGTLIQFFKDDATAFNKKKHDVIDGKGVLNNRISEYIFTH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L KIGIP +FIRR+NMREQL+++VE+IPL I VRN AAGSLAKRL I EG  LPRS++EF
Sbjct: 61  LNKIGIPTHFIRRLNMREQLIKEVEIIPLEIVVRNVAAGSLAKRLGIEEGTVLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  +VSEEHITAF WA+  E++++ AL+IRINDF++GLFLG+ IQLVDF+I+C
Sbjct: 121 YYKADALDDPMVSEEHITAFGWASPQELDDIMALAIRINDFLSGLFLGVGIQLVDFKIEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RI+LADEI PD CRLWD+  KE+ DK RF +    L+E Y EVARRLGI  
Sbjct: 181 GRLYEGDMMRIILADEISPDSCRLWDVETKEKMDKDRFRRDMGGLVEAYQEVARRLGIIN 240

Query: 241 KNEPALKENLILNR 254
           +NEP      +L +
Sbjct: 241 ENEPPRGSGPVLVK 254


>gi|163759569|ref|ZP_02166654.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Hoeflea
           phototrophica DFL-43]
 gi|162283166|gb|EDQ33452.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Hoeflea
           phototrophica DFL-43]
          Length = 254

 Score =  286 bits (733), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 147/254 (57%), Positives = 193/254 (75%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQFFKDD    N  +   ++GKGVLNNRISE++F+ 
Sbjct: 1   MNRRRRIYEGKAKILYEGPEPGTLIQFFKDDATAFNKKKHDVVDGKGVLNNRISEFIFSH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IGIP +FI+RINMREQL+++VE+IPL + VRN AAGSL+KRL I EG  LPRS++EF
Sbjct: 61  LNRIGIPTHFIKRINMREQLIKEVEIIPLEVVVRNVAAGSLSKRLGIEEGTVLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  +VSEEH+TAF WA+  E++++ AL+IR+NDF+TGLFLG+ IQLVDF+I+C
Sbjct: 121 YYKADALDDPMVSEEHVTAFGWASPQEIDDIMALAIRVNDFLTGLFLGVGIQLVDFKIEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RIV+ADEI PD CRLWD++  E+ DK  F +    L+E Y EVARRLGI  
Sbjct: 181 GRLFEGDMMRIVVADEISPDSCRLWDVNTSEKFDKDVFRRDLGNLVEAYQEVARRLGIMN 240

Query: 241 KNEPALKENLILNR 254
           +NEP      +L +
Sbjct: 241 ENEPNRPTGPVLVK 254


>gi|162136032|ref|YP_531465.2| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris BisB18]
          Length = 255

 Score =  286 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 141/254 (55%), Positives = 187/254 (73%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   + GKGVLNNRISE++F  
Sbjct: 1   MSRRRRIYEGKGKVLYEGPEPGTLIQHFKDDATAFNAKKHQVIEGKGVLNNRISEFLFQH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE++PL + VRN AAGSL++RL I EG  LPRS++EF
Sbjct: 61  LNDIGVPTHFIRRLNMREQLIREVEIVPLEVVVRNVAAGSLSQRLGIEEGTQLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA   E++++ AL+IR+NDF+TGLFLGI I+LVDF+++C
Sbjct: 121 YYKNDQLNDPMVSEEHITAFGWATPQEIDDIMALAIRVNDFLTGLFLGIGIRLVDFKMEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL ++D++RI++ADEI PD CRLWD+   E+ DK RF +    +LE Y+EVA+RLGI  
Sbjct: 181 GRLFENDMMRIIVADEISPDSCRLWDIKSNEKLDKDRFRRDLGGVLEAYTEVAKRLGILM 240

Query: 241 KNEPALKENLILNR 254
           +NE       +L +
Sbjct: 241 ENERPAGSGPVLVK 254


>gi|74420366|gb|ABA04565.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nitrobacter winogradskyi Nb-255]
          Length = 265

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 141/254 (55%), Positives = 187/254 (73%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   + GKGVLNNRISEY+F  
Sbjct: 11  MSRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHQVIEGKGVLNNRISEYLFQH 70

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE++PL + VRN AAGSL++RL I EG  LPRS++EF
Sbjct: 71  LNDIGVPTHFIRRLNMREQLIREVEIVPLEVVVRNVAAGSLSQRLGIEEGTQLPRSIIEF 130

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEH+TAF WA   E++++ AL+IR+NDF+TGLFLGI I+LVDF+++C
Sbjct: 131 YYKNDQLNDPMVSEEHVTAFGWATPQEIDDIMALAIRVNDFLTGLFLGIGIRLVDFKMEC 190

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL +++++RIV+ADEI PD CRLWD+   E+ DK  F +    LLE Y+EVA+RLGI  
Sbjct: 191 GRLFENEMMRIVVADEISPDSCRLWDIKSNEKLDKDVFRRDLGGLLEAYTEVAKRLGILM 250

Query: 241 KNEPALKENLILNR 254
           +NE  +    +L +
Sbjct: 251 ENERPIGAGPVLVK 264


>gi|150396710|ref|YP_001327177.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sinorhizobium medicae WSM419]
 gi|166230842|sp|A6U9L2|PUR7_SINMW RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|150028225|gb|ABR60342.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sinorhizobium medicae WSM419]
          Length = 254

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 154/254 (60%), Positives = 194/254 (76%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQFFKDD    N  +   ++GKGVLNNRISEY+FT 
Sbjct: 1   MNRRRRIYEGKAKILYEGPEPGTLIQFFKDDATAFNKKKHDVIDGKGVLNNRISEYIFTH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L KIGIP +FIRR+NMREQL+++VE+IPL I VRN AAGSL+KRL I EG  LPRS++EF
Sbjct: 61  LNKIGIPTHFIRRLNMREQLIKEVEIIPLEIVVRNVAAGSLSKRLGIEEGTVLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  +VSEEHITAF WA+  E++++ AL+IRINDF++GLFLG+ IQLVDF+I+C
Sbjct: 121 YYKADALDDPMVSEEHITAFGWASPQELDDIMALAIRINDFLSGLFLGVGIQLVDFKIEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RI+LADEI PD CRLWD+  KE+ DK RF +    L+E Y EVARRLGI  
Sbjct: 181 GRLYEGDMMRIILADEISPDSCRLWDIETKEKMDKDRFRRDMGGLVEAYQEVARRLGIIN 240

Query: 241 KNEPALKENLILNR 254
           +NEP      +L +
Sbjct: 241 ENEPPRGSGPVLVK 254


>gi|192292713|ref|YP_001993318.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris TIE-1]
 gi|192286462|gb|ACF02843.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris TIE-1]
          Length = 265

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 142/254 (55%), Positives = 187/254 (73%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   + GKGVLNNRISEY+F  
Sbjct: 11  MSRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHQVIEGKGVLNNRISEYLFQH 70

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE++PL + VRN AAGSL++RL I EG  LPRS++EF
Sbjct: 71  LNDIGVPTHFIRRLNMREQLIREVEIVPLEVVVRNVAAGSLSQRLGIEEGTQLPRSIIEF 130

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA   E++++ AL+IR+NDF+TGLFLGI I+LVDF+++C
Sbjct: 131 YYKNDQLNDPMVSEEHITAFGWATPQEIDDIMALAIRVNDFLTGLFLGIGIRLVDFKMEC 190

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + +++RI++ADEI PD CRLWD+   E+ DK RF +    LLE Y+EVA+RLGI  
Sbjct: 191 GRLFESEMMRIIVADEISPDSCRLWDIKSNEKLDKDRFRRDLGGLLEAYTEVAKRLGILM 250

Query: 241 KNEPALKENLILNR 254
           +NE  +    +L +
Sbjct: 251 ENERPIGSGPVLVK 264


>gi|115523625|ref|YP_780536.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris BisA53]
 gi|115517572|gb|ABJ05556.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris BisA53]
          Length = 265

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 143/254 (56%), Positives = 187/254 (73%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   + GKGVLNNRISE++F  
Sbjct: 11  MSRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHQVIEGKGVLNNRISEFLFQH 70

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE+IPL + VRN AAGSL++RL I EG  LPRS++EF
Sbjct: 71  LNDIGVPTHFIRRLNMREQLIREVEIIPLEVVVRNVAAGSLSERLGIEEGTQLPRSIIEF 130

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA   E++++ AL+IR+NDF+TGLFLGI I+LVDF+++C
Sbjct: 131 YYKNDQLNDPMVSEEHITAFGWATPQEIDDVMALAIRVNDFLTGLFLGIGIRLVDFKMEC 190

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL ++D++RI++ADEI PD CRLWD+   E+ DK RF +    LLE Y+EVA+RLGI  
Sbjct: 191 GRLFENDMMRIIVADEISPDSCRLWDIKSNEKLDKDRFRRDLGGLLEAYTEVAKRLGILM 250

Query: 241 KNEPALKENLILNR 254
           +NE       +L +
Sbjct: 251 ENERPAGSGPVLVK 264


>gi|296446980|ref|ZP_06888915.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylosinus trichosporium OB3b]
 gi|296255547|gb|EFH02639.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylosinus trichosporium OB3b]
          Length = 264

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 140/254 (55%), Positives = 191/254 (75%), Gaps = 1/254 (0%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   ++GKGVLNNRISE++F  
Sbjct: 11  MNRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHEVIDGKGVLNNRISEFIFQH 70

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE++PL + VRN AAGSL+KRL + EG  LPRS++EF
Sbjct: 71  LNDIGVPTHFIRRLNMREQLIREVEIVPLEVVVRNVAAGSLSKRLGMEEGTQLPRSIIEF 130

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  +VSEEHITAF WA   E++++ AL+IR+NDF++GLFLG+ I+LVDF+++C
Sbjct: 131 YYKNDALDDPMVSEEHITAFGWATPQEIDDIMALAIRVNDFLSGLFLGVGIRLVDFKMEC 190

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RIV+ADEI PD CRLWD+   ++ DK RF +    L+E Y+EVARRLGI +
Sbjct: 191 GRLWEGDMMRIVVADEISPDSCRLWDIKSNDKLDKDRFRRDMGGLVEAYTEVARRLGILQ 250

Query: 241 KNE-PALKENLILN 253
           +NE P   +  ++ 
Sbjct: 251 ENEAPRPSQPKLVQ 264


>gi|83574964|gb|ABC21515.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodospirillum rubrum ATCC 11170]
          Length = 278

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 131/255 (51%), Positives = 189/255 (74%), Gaps = 2/255 (0%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K+++EG EPGTL+Q+FKDD    NN +  T+ GKGVLNNRISEY+ T+
Sbjct: 24  MARRKQIYEGKAKVLFEGPEPGTLVQYFKDDATAFNNKKHGTITGKGVLNNRISEYLMTR 83

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IG+P++F+RR+NMREQLVR VE+IP+ + +RN AAGS++ +  IPEG  LPRS+VE+
Sbjct: 84  LTEIGVPNHFVRRLNMREQLVRQVEIIPIEVVIRNVAAGSISTKFAIPEGTQLPRSIVEY 143

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEH+TAF WA+  E++E+ +LS+RIND+++GLFLG+ ++LVDF+++ 
Sbjct: 144 YYKNDELNDPMVSEEHVTAFGWASVQELDEILSLSLRINDYLSGLFLGVQLRLVDFKLEF 203

Query: 181 GRLLDDD-ILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
           GR+ +++  ++I+LADEI PD CRLWD++  E+ DK RF +    + E Y EVARRLGI 
Sbjct: 204 GRIYNENGDVQIILADEISPDNCRLWDVTTGEKLDKDRFRRDLGGVAEAYQEVARRLGIL 263

Query: 240 KKNEP-ALKENLILN 253
            +  P  +K   ++ 
Sbjct: 264 PEGGPRDIKGPPVMQ 278


>gi|316932893|ref|YP_004107875.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris DX-1]
 gi|315600607|gb|ADU43142.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris DX-1]
          Length = 265

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 142/254 (55%), Positives = 187/254 (73%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   + GKGVLNNRISEY+F  
Sbjct: 11  MSRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHQVIEGKGVLNNRISEYLFQH 70

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE++PL + VRN AAGSL++RL I EG  LPRS++EF
Sbjct: 71  LNDIGVPTHFIRRLNMREQLIREVEIVPLEVVVRNVAAGSLSQRLGIEEGTQLPRSIIEF 130

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA   E++++ AL+IR+NDF+TGLFLGI I+LVDF+++C
Sbjct: 131 YYKNDQLNDPMVSEEHITAFGWATPQEIDDIMALAIRVNDFLTGLFLGIGIRLVDFKMEC 190

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + +++RI++ADEI PD CRLWD+   E+ DK RF +    LLE Y+EVA+RLGI  
Sbjct: 191 GRLFEAEMMRIIVADEISPDSCRLWDIKSNEKLDKDRFRRDLGGLLEAYTEVAKRLGILM 250

Query: 241 KNEPALKENLILNR 254
           +NE  +    +L +
Sbjct: 251 ENERPIGSGPVLVK 264


>gi|94498688|ref|ZP_01305239.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sphingomonas sp. SKA58]
 gi|94421851|gb|EAT06901.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sphingomonas sp. SKA58]
          Length = 260

 Score =  286 bits (731), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 136/255 (53%), Positives = 182/255 (71%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGT+IQ+FKDD    N  +  T++GKGVLNNRISE++FT 
Sbjct: 1   MARRRQIYEGKAKILYEGPEPGTIIQYFKDDATAFNAQKKGTISGKGVLNNRISEHIFTL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+IG+P +FIRR+NMREQL+R VE++P+ + VRN AAGSL+K+L I EG  LPR+L+E+
Sbjct: 61  LGQIGVPTHFIRRLNMREQLIRQVEIVPIEVIVRNVAAGSLSKKLGIEEGTQLPRTLIEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    LVSEEHI  F WA Q E+ ++  ++IR+NDF+ GLF GI I+L+DF+++ 
Sbjct: 121 CYKDDALGDPLVSEEHIACFGWATQEEMHDIADMAIRVNDFLCGLFAGIGIRLIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL D D  RI+LADEI PD CRLWD++  E+ DK RF +     +E Y EVARRLG+  
Sbjct: 181 GRLYDGDYSRIILADEISPDGCRLWDMATNEKLDKDRFRRDLGGEVEAYQEVARRLGLLP 240

Query: 241 KNEPALKENLILNRK 255
           +       +L  +RK
Sbjct: 241 EGLDTTVLDLDTHRK 255


>gi|91682681|gb|ABE38983.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris BisB5]
          Length = 265

 Score =  286 bits (731), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 142/254 (55%), Positives = 188/254 (74%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   + GKGVLNNRISEY+F  
Sbjct: 11  MSRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHQVIEGKGVLNNRISEYLFQH 70

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE++PL + VRN AAGSL++RL I EG  LPRS++EF
Sbjct: 71  LNDIGVPTHFIRRLNMREQLIREVEIVPLEVVVRNVAAGSLSQRLGIEEGTQLPRSIIEF 130

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA   E++++ AL+IR+NDF+TGLFLGI I+LVDF+++C
Sbjct: 131 YYKNDQLNDPMVSEEHITAFGWATPQEIDDIMALAIRVNDFLTGLFLGIGIRLVDFKMEC 190

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL +++++RI++ADEI PD CRLWD+   E+ DK RF +    LLE Y+EVA+RLGI  
Sbjct: 191 GRLFENEMMRIIVADEISPDSCRLWDIKSNEKLDKDRFRRDLGGLLEAYTEVAKRLGILM 250

Query: 241 KNEPALKENLILNR 254
           +NE  +    +L +
Sbjct: 251 ENERPVGSGPVLVK 264


>gi|161899029|ref|YP_613460.2| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ruegeria
           sp. TM1040]
          Length = 253

 Score =  286 bits (731), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 124/253 (49%), Positives = 176/253 (69%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +YEG EPGT++Q+FKDD    N  +   + GKGVLNN +SE+    
Sbjct: 1   MARRKKIYEGKAKTLYEGPEPGTIVQYFKDDATAFNAEKHDVIEGKGVLNNILSEFFMLG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+IG+P +F++R+NMREQLVR  E++PL I VRN AAGSL KRL + EG  LPR +VE+
Sbjct: 61  LGQIGVPTHFLKRLNMREQLVRSCEIVPLEIIVRNYAAGSLCKRLGMDEGTQLPRPIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    LV+EEHI AF WA+Q +++++ +L++R+NDF++G+ L + I+LVDF+I+ 
Sbjct: 121 CYKDDALGDPLVTEEHIAAFGWASQQDMDDILSLALRVNDFLSGVMLAVGIRLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D D  R+V+ADEI PD CRLWD+   ++ DK  F +    L + Y+EVARRLG+  
Sbjct: 181 GRIYDGDFQRLVVADEISPDSCRLWDIKTGQKLDKDVFRRDLGSLTDAYTEVARRLGVMP 240

Query: 241 KNEPALKENLILN 253
            N PA  +  ++N
Sbjct: 241 NNPPAPGKPQLVN 253


>gi|259415955|ref|ZP_05739875.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Silicibacter sp. TrichCH4B]
 gi|259347394|gb|EEW59171.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Silicibacter sp. TrichCH4B]
          Length = 253

 Score =  286 bits (731), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 126/253 (49%), Positives = 176/253 (69%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +YEG EPGT++Q+FKDD    N  +   + GKGVLNN +SE+    
Sbjct: 1   MARRKKIYEGKAKTLYEGPEPGTIVQYFKDDATAFNAEKHDVIEGKGVLNNILSEFFMLG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+IG+P +F++R+NMREQLVR  E+IPL I VRN AAGSL KRL I EG  LPR +VE+
Sbjct: 61  LGQIGVPTHFLKRLNMREQLVRSCEIIPLEIIVRNYAAGSLCKRLGIDEGTQLPRPIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    LV+EEHI AF WA+Q +++++ +L++R+NDF++G+ L + I+LVDF+I+ 
Sbjct: 121 CYKDDALGDPLVTEEHIAAFGWASQQDMDDILSLALRVNDFLSGVMLAVGIRLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D D  R+V+ADEI PD CRLWD+   ++ DK  F +    L + Y+EVARRLG+  
Sbjct: 181 GRVYDGDFQRLVVADEISPDSCRLWDIKTGQKLDKDVFRRDLGSLTDAYTEVARRLGVMP 240

Query: 241 KNEPALKENLILN 253
            N PA  +  ++N
Sbjct: 241 NNPPAPGKPQLVN 253


>gi|86573857|gb|ABD08414.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris HaA2]
          Length = 265

 Score =  286 bits (731), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 143/254 (56%), Positives = 187/254 (73%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   + GKGVLNNRISEY+F  
Sbjct: 11  MSRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHQVIEGKGVLNNRISEYLFQH 70

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE++PL + VRN AAGSL++RL I EG  LPRS++EF
Sbjct: 71  LNDIGVPTHFIRRLNMREQLIREVEIVPLEVVVRNVAAGSLSQRLGIEEGTQLPRSIIEF 130

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA   E++++ AL+IR+NDF+TGLFLGI I+LVDF+++C
Sbjct: 131 YYKNDQLNDPMVSEEHITAFGWATPQEIDDIMALAIRVNDFLTGLFLGIGIRLVDFKMEC 190

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL ++D++RI++ADEI PD CRLWD+   E+ DK RF +    LLE Y+EVA+RLGI  
Sbjct: 191 GRLFENDMMRIIVADEISPDSCRLWDIKSNEKLDKDRFRRDLGGLLEAYTEVAKRLGILM 250

Query: 241 KNEPALKENLILNR 254
           +NE       +L +
Sbjct: 251 ENERPAGSGPVLVK 264


>gi|299131730|ref|ZP_07024925.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Afipia
           sp. 1NLS2]
 gi|298591867|gb|EFI52067.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Afipia
           sp. 1NLS2]
          Length = 265

 Score =  285 bits (730), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 139/254 (54%), Positives = 188/254 (74%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   + GKGVLNNRISEY+F  
Sbjct: 11  MSRRRRIYEGKGKVLYEGPEPGTLIQHFKDDATAFNAKKHQVIEGKGVLNNRISEYVFQH 70

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IG+P +FI+R+NMREQL+R+VE++PL + VRN AAGSL++RL I EG  LPRS++EF
Sbjct: 71  LNEIGVPTHFIKRLNMREQLIREVEIVPLEVVVRNVAAGSLSQRLGIEEGTQLPRSIIEF 130

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA   E++++ AL+IR+NDF++G+FLG+ I+LVDF+++C
Sbjct: 131 YYKNDQLGDPMVSEEHITAFGWATPQEIDDIMALAIRVNDFLSGVFLGVGIRLVDFKMEC 190

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL +++++RIV+ADEI PD CRLWD+   E+ DK RF +    LLE Y+EVA+RLGI  
Sbjct: 191 GRLYENEMMRIVVADEISPDSCRLWDIKSNEKMDKDRFRRDLGGLLEAYTEVAKRLGILI 250

Query: 241 KNEPALKENLILNR 254
           +NE       +L +
Sbjct: 251 ENERPAGSGPVLVK 264


>gi|86139902|ref|ZP_01058467.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseobacter sp. MED193]
 gi|85823320|gb|EAQ43530.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseobacter sp. MED193]
          Length = 253

 Score =  285 bits (730), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 129/253 (50%), Positives = 177/253 (69%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +YEG EPGT++Q+FKDD    N  +   + GKGVLNN +SEY    
Sbjct: 1   MARRKKIYEGKAKTLYEGPEPGTIVQYFKDDATAFNAEKKDVIEGKGVLNNLLSEYFMVG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+IG+P +F++R+NMREQLVR  E+IPL + VRN AAGS++KRL I EG  LPR +VE+
Sbjct: 61  LGQIGVPTHFLKRLNMREQLVRSCEIIPLEVIVRNYAAGSMSKRLGIDEGTQLPRPIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  DS    LVSEEHI AF WA+Q +++++ +L++R+NDFM+G+  G+ I+LVDF+I+ 
Sbjct: 121 CYKDDSLGDPLVSEEHIAAFGWASQQDMDDILSLALRVNDFMSGVMFGVGIRLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D D  R+V+ADEI PD CRLWD+   ++ DK  F +    L + YSEVARRLG+  
Sbjct: 181 GRVYDGDFQRLVVADEISPDSCRLWDIESGQKLDKDVFRRDLGSLTDAYSEVARRLGVMP 240

Query: 241 KNEPALKENLILN 253
            N PA  +  ++N
Sbjct: 241 NNPPAPSKPTLVN 253


>gi|90105109|gb|ABD87146.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodopseudomonas palustris BisB18]
          Length = 265

 Score =  285 bits (730), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 141/254 (55%), Positives = 187/254 (73%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   + GKGVLNNRISE++F  
Sbjct: 11  MSRRRRIYEGKGKVLYEGPEPGTLIQHFKDDATAFNAKKHQVIEGKGVLNNRISEFLFQH 70

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE++PL + VRN AAGSL++RL I EG  LPRS++EF
Sbjct: 71  LNDIGVPTHFIRRLNMREQLIREVEIVPLEVVVRNVAAGSLSQRLGIEEGTQLPRSIIEF 130

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA   E++++ AL+IR+NDF+TGLFLGI I+LVDF+++C
Sbjct: 131 YYKNDQLNDPMVSEEHITAFGWATPQEIDDIMALAIRVNDFLTGLFLGIGIRLVDFKMEC 190

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL ++D++RI++ADEI PD CRLWD+   E+ DK RF +    +LE Y+EVA+RLGI  
Sbjct: 191 GRLFENDMMRIIVADEISPDSCRLWDIKSNEKLDKDRFRRDLGGVLEAYTEVAKRLGILM 250

Query: 241 KNEPALKENLILNR 254
           +NE       +L +
Sbjct: 251 ENERPAGSGPVLVK 264


>gi|260460819|ref|ZP_05809069.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mesorhizobium opportunistum WSM2075]
 gi|319784038|ref|YP_004143514.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|259033396|gb|EEW34657.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mesorhizobium opportunistum WSM2075]
 gi|317169926|gb|ADV13464.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 264

 Score =  285 bits (730), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 146/252 (57%), Positives = 194/252 (76%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ R  +YE K KI+YEG EPGTLIQFFKDD    N  +   ++GKGVLNNRISEY+F  
Sbjct: 1   MKNRRRIYEGKAKILYEGPEPGTLIQFFKDDATAFNKKKHEVIDGKGVLNNRISEYIFNH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GIP +FIRR+NMREQL+++VE+IPL + VRN AAGSL+KRL I EG  LPRS++EF
Sbjct: 61  LNRMGIPTHFIRRLNMREQLIKEVEIIPLEVVVRNVAAGSLSKRLGIEEGTVLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  +VSEEHITAF WA+  E++++ AL+IR+NDF++GLF+G+ IQLVDF+I+C
Sbjct: 121 YYKADALDDPMVSEEHITAFGWASPQEIDDVMALAIRVNDFLSGLFMGVGIQLVDFKIEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RIV+ADEI PD CRLWD++ +++ DK RF +    L+E Y EVARRLGI  
Sbjct: 181 GRLFEGDMMRIVVADEISPDSCRLWDVATQDKLDKDRFRRDMGGLVEAYQEVARRLGIMN 240

Query: 241 KNEPALKENLIL 252
           +NEP      +L
Sbjct: 241 ENEPPRPTGPVL 252


>gi|254465723|ref|ZP_05079134.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacterales bacterium Y4I]
 gi|206686631|gb|EDZ47113.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacterales bacterium Y4I]
          Length = 253

 Score =  285 bits (729), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 126/253 (49%), Positives = 179/253 (70%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +YEG EPGT++Q+FKDD    N  +   + GKGVLNN +SE+    
Sbjct: 1   MARRKKIYEGKAKTLYEGPEPGTIVQYFKDDATAFNAEKHDVIEGKGVLNNILSEFFMLG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+IG+P +F++R+NMREQLVR  E+IPL I VRN AAGS++KRL I EG  LPR +VE+
Sbjct: 61  LGQIGVPTHFLKRLNMREQLVRSCEIIPLEIIVRNYAAGSISKRLGIDEGTQLPRPIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    LV+EEHI AF WA+Q +++++ +L++R+NDF++G+FL + I+LVDF+I+ 
Sbjct: 121 CYKDDALGDPLVTEEHIAAFGWASQQDMDDILSLALRVNDFLSGVFLAVGIRLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ + D  R+V+ADEI PD CRLWD++  ++ DK  F +    L + YSEVARRLG+  
Sbjct: 181 GRIYEGDFQRLVIADEISPDSCRLWDINTGQKLDKDVFRRDLGSLTDAYSEVARRLGVMP 240

Query: 241 KNEPALKENLILN 253
            N PA  +  ++N
Sbjct: 241 NNPPAPGKPTLVN 253


>gi|103486077|ref|YP_615638.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sphingopyxis alaskensis RB2256]
 gi|123380092|sp|Q1GVL7|PUR7_SPHAL RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|98976154|gb|ABF52305.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sphingopyxis alaskensis RB2256]
          Length = 258

 Score =  285 bits (729), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 136/255 (53%), Positives = 182/255 (71%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQ+FKDD    N  +  T+NGKGVLNNRISE++FT 
Sbjct: 1   MARRRQIYEGKAKILYEGPEPGTLIQYFKDDATAFNAQKRGTINGKGVLNNRISEHVFTL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG IG+P +FIRR+NMREQL+R VE++P+ + VRN AAG+L+KRL I EG  LPR+L+E+
Sbjct: 61  LGNIGVPTHFIRRLNMREQLIRQVEIVPIEVIVRNVAAGTLSKRLGIEEGTQLPRTLIEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    LV+EEHI  FNW +Q E+ ++  ++IRINDFM+G+F  + I+LVDF+++ 
Sbjct: 121 CYKDDALGDPLVAEEHIACFNWCSQDELHDIQDMAIRINDFMSGMFAAVGIRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D  RI+LADEI PD CRLWD++  E+ DK RF +     +E Y EVARRLG+  
Sbjct: 181 GRLYEGDFSRIILADEISPDGCRLWDMTTNEKLDKDRFRRDLGGEVEAYQEVARRLGLLP 240

Query: 241 KNEPALKENLILNRK 255
           +       +L  +RK
Sbjct: 241 EGGDNAVLDLESHRK 255


>gi|217977363|ref|YP_002361510.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylocella silvestris BL2]
 gi|217502739|gb|ACK50148.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylocella silvestris BL2]
          Length = 264

 Score =  285 bits (729), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 143/254 (56%), Positives = 185/254 (72%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    +  +   ++GKGVLNNRISEY+F  
Sbjct: 11  MNRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFDAKKHEVIDGKGVLNNRISEYIFQN 70

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE+IPL I VRN AAGSLA RL I EG  LPRS++EF
Sbjct: 71  LNDIGVPTHFIRRLNMREQLIREVEIIPLEICVRNVAAGSLATRLGIEEGTQLPRSIIEF 130

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA+  E++++ AL+IR+NDF+TGLFLG+ I+LVDF+++C
Sbjct: 131 YYKNDELHDPMVSEEHITAFGWASPQEIDDIMALAIRVNDFLTGLFLGVGIRLVDFKMEC 190

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RI +ADE  PD CRLWD+   ++ DK RF +    L+E Y+EVARRLGI +
Sbjct: 191 GRLWEGDMMRIAVADEFSPDSCRLWDMKSNDKLDKDRFRRDLGGLVEAYTEVARRLGILQ 250

Query: 241 KNEPALKENLILNR 254
           +NE        L R
Sbjct: 251 ENEQPRASGPKLVR 264


>gi|158423852|ref|YP_001525144.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Azorhizobium caulinodans ORS 571]
 gi|158330741|dbj|BAF88226.1| SAICAR synthetase [Azorhizobium caulinodans ORS 571]
          Length = 264

 Score =  285 bits (728), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 145/254 (57%), Positives = 191/254 (75%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   ++GKGVLNNRISEY+F +
Sbjct: 11  MSRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHDVIDGKGVLNNRISEYIFQR 70

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IG+P +FIRR+NMREQL+R+VE+IPL I VRN AAGSL+ RL I EG +LPRS++EF
Sbjct: 71  LNEIGVPTHFIRRLNMREQLIREVEIIPLEIVVRNVAAGSLSTRLGIEEGTALPRSIIEF 130

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    +VSEEH+TAF WA   E++++ AL+IR+NDF+TGLFLG+ I+LVDF+++C
Sbjct: 131 YYKNDALNDPMVSEEHVTAFGWATTQEIDDIIALAIRVNDFLTGLFLGVGIRLVDFKMEC 190

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL ++D++RIV+ADEI PD CRLWD+   ++ DK RF +    L+E YSEVARRLGI  
Sbjct: 191 GRLWENDMMRIVVADEISPDSCRLWDIKSNDKLDKDRFRRDLGGLVEAYSEVARRLGILT 250

Query: 241 KNEPALKENLILNR 254
            NEP   +   L +
Sbjct: 251 DNEPNQTKGPALVK 264


>gi|255262078|ref|ZP_05341420.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thalassiobium sp. R2A62]
 gi|255104413|gb|EET47087.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thalassiobium sp. R2A62]
          Length = 253

 Score =  284 bits (727), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 119/253 (47%), Positives = 175/253 (69%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+Y+G EPGT +Q+FKDD    N  +   + GKGVLNNR+SE+    
Sbjct: 1   MARRKLIYEGKAKILYDGPEPGTYVQYFKDDATAFNAGKKDVIEGKGVLNNRLSEFFMNG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IG+P +FI+R+NMREQL+R  E+IPL + VRN AAG++AKRL + EG  LPR +VEF
Sbjct: 61  LQQIGVPTHFIKRLNMREQLIRQCEIIPLEVIVRNYAAGTMAKRLGMEEGTQLPRPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  DS    LV EE+I AF WA+Q +++++ ++++++NDF++G+  G+ I+LVDF+I+ 
Sbjct: 121 SYKDDSLGDPLVPEEYIAAFGWASQQDLDDIVSIALKVNDFISGVMYGVGIKLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D+D  R+V+ADEI PD CRLWD+    + DK  F +    L + Y+EVA+RLG+  
Sbjct: 181 GRVWDNDFQRLVVADEISPDSCRLWDIETGRKLDKDVFRRDLGDLADAYTEVAKRLGVLP 240

Query: 241 KNEPALKENLILN 253
            N   + +  ++N
Sbjct: 241 TNTAQMPKPTLIN 253


>gi|13470379|ref|NP_101947.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mesorhizobium loti MAFF303099]
 gi|22001866|sp|Q98NM8|PUR71_RHILO RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase 1; AltName: Full=SAICAR synthetase 1
 gi|14021120|dbj|BAB47733.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mesorhizobium loti MAFF303099]
          Length = 264

 Score =  284 bits (727), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 145/252 (57%), Positives = 194/252 (76%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ R  +YE K KI+YEG EPGTLIQFFKDD    N  +   ++GKGVLNNRISE++F  
Sbjct: 1   MKNRRRIYEGKAKILYEGPEPGTLIQFFKDDATAFNKKKHEVVDGKGVLNNRISEHIFNH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GIP +FIRR+NMREQL+++VE+IPL + VRN AAGSL+KRL I EG  LPRS++EF
Sbjct: 61  LNRMGIPTHFIRRLNMREQLIKEVEIIPLEVVVRNVAAGSLSKRLGIEEGTVLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  +VSEEHITAF WA+  E++++ AL+IR+NDF++GLF+G+ IQLVDF+I+C
Sbjct: 121 YYKADALDDPMVSEEHITAFGWASPQEIDDVMALAIRVNDFLSGLFMGVGIQLVDFKIEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RIV+ADEI PD CRLWD++ +++ DK RF +    L+E Y EVARRLGI  
Sbjct: 181 GRLFEGDMMRIVVADEISPDSCRLWDVATQDKLDKDRFRRDMGGLVEAYQEVARRLGIMN 240

Query: 241 KNEPALKENLIL 252
           +NEP      +L
Sbjct: 241 ENEPPRPTGPVL 252


>gi|288957475|ref|YP_003447816.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Azospirillum sp. B510]
 gi|288909783|dbj|BAI71272.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Azospirillum sp. B510]
          Length = 254

 Score =  284 bits (727), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 134/245 (54%), Positives = 184/245 (75%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K+++EG EPGTL+Q+FKDD    NN +   + GKGVLNNRISEY+ ++
Sbjct: 1   MTRRRRIYEGKAKVLFEGPEPGTLVQYFKDDATAFNNQKKGVITGKGVLNNRISEYLMSR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IG+P +F+RR+NMREQLVR+VE+IP+ + VRN AAGSL+ R  IPEG  LPRS++E+
Sbjct: 61  LSEIGVPTHFMRRLNMREQLVREVEIIPIEVVVRNVAAGSLSSRFGIPEGTPLPRSIIEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA   ++++M ALS+R+ND+++GLFLGI ++LVDF+++ 
Sbjct: 121 YYKSDELNDPMVSEEHITAFGWAAPQDLDDMVALSLRVNDYLSGLFLGIGLRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL +++ +RIVLADEI PD CRLWD+   E+ DK RF +   ++ E Y EVARRLGI  
Sbjct: 181 GRLWENEEMRIVLADEISPDNCRLWDVKTNEKLDKDRFRQDLGRVEEAYQEVARRLGILP 240

Query: 241 KNEPA 245
           +  P+
Sbjct: 241 EGGPS 245


>gi|304391564|ref|ZP_07373506.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Ahrensia
           sp. R2A130]
 gi|303295793|gb|EFL90151.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Ahrensia
           sp. R2A130]
          Length = 256

 Score =  284 bits (726), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 146/254 (57%), Positives = 191/254 (75%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTL+QFFKDD    N  +   ++GKGVLNNRISEY+F Q
Sbjct: 1   MSRRRKIYEGKAKILYEGPEPGTLVQFFKDDATAFNAQKHEIVDGKGVLNNRISEYVFEQ 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IG+P +FIRRINMREQL+++VE+IPL + VRN AAGSL+KRL + EG  LPRS++EF
Sbjct: 61  LNRIGLPTHFIRRINMREQLIKEVEIIPLEVVVRNVAAGSLSKRLGVEEGSVLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA+  E+++M AL+IRINDF++GLF G+ IQLVDF+I+ 
Sbjct: 121 YYKNDELNDPIVSEEHITAFGWASPPEIDDMMALAIRINDFLSGLFYGVGIQLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL ++D++R++LADEI PD CRLWD+  K++ DK RF +    +LE Y EVA RLGI  
Sbjct: 181 GRLYENDMMRVILADEISPDSCRLWDVKTKDKMDKDRFRQDLGGMLEAYREVASRLGILN 240

Query: 241 KNEPALKENLILNR 254
           +NEP   +  +L +
Sbjct: 241 ENEPPRGKGPVLVK 254


>gi|209884589|ref|YP_002288446.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oligotropha carboxidovorans OM5]
 gi|209872785|gb|ACI92581.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oligotropha carboxidovorans OM5]
          Length = 265

 Score =  284 bits (726), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 140/254 (55%), Positives = 186/254 (73%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   + GKGVLNNRISEY+F  
Sbjct: 11  MSRRRRIYEGKGKVLYEGPEPGTLIQHFKDDATAFNAKKHQIIEGKGVLNNRISEYIFQH 70

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FI+R+NMREQL+R+VE++PL + VRN AAGSL++RL I EG  LPRS++EF
Sbjct: 71  LNDIGVPTHFIKRLNMREQLIREVEIVPLEVVVRNVAAGSLSQRLGIEEGTQLPRSIIEF 130

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA   E++++ AL+IR+NDF++GLFLG+ I+LVDF+++C
Sbjct: 131 YYKNDQLGDPMVSEEHITAFGWATPQEIDDIMALAIRVNDFLSGLFLGVGIRLVDFKMEC 190

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL +++++RIV+ADEI PD CRLWD+   E+ DK RF +    LLE Y+EVA+RLGI  
Sbjct: 191 GRLYENEMMRIVVADEISPDSCRLWDIKSNEKMDKDRFRRDLGGLLEAYTEVAKRLGILI 250

Query: 241 KNEPALKENLILNR 254
            NE       +L +
Sbjct: 251 DNERPAGSGPVLVK 264


>gi|209966617|ref|YP_002299532.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodospirillum centenum SW]
 gi|229564410|sp|B6IWP6|PUR7_RHOCS RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|209960083|gb|ACJ00720.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodospirillum centenum SW]
          Length = 254

 Score =  284 bits (726), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 134/254 (52%), Positives = 185/254 (72%), Gaps = 1/254 (0%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI++EG EPGTL+Q+FKDD    N  +   + GKGVLNNRISEY+  +
Sbjct: 1   MTRRRRIYEGKAKILFEGPEPGTLVQYFKDDATAFNAQKKGVITGKGVLNNRISEYLMMK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+IGIP +F+RR+NMREQL+R+VE+IP+ + VRN AAGSL KR  IPEG  LPRS+VE+
Sbjct: 61  LGEIGIPTHFVRRLNMREQLIREVEIIPIEVVVRNVAAGSLTKRFGIPEGTQLPRSIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D     +VSEEHITAF WA   ++++M AL++R+ND+++GLFLGI ++LVDF+++ 
Sbjct: 121 YFKNDELGDPMVSEEHITAFGWAAPQDLDDMLALALRVNDYLSGLFLGIGLRLVDFKVEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL +++ +RI+LADEI PD CRLWD+   E+ DK RF +    + E Y EVA+RLGI  
Sbjct: 181 GRLWENEEMRIILADEISPDNCRLWDVKTNEKLDKDRFRQDLGNVAEAYQEVAKRLGIMP 240

Query: 241 KNEP-ALKENLILN 253
           +  P  +K   ++ 
Sbjct: 241 EAGPGDMKAPKLVQ 254


>gi|110679527|ref|YP_682534.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseobacter denitrificans OCh 114]
 gi|122972776|sp|Q167J5|PUR7_ROSDO RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|109455643|gb|ABG31848.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseobacter denitrificans OCh 114]
          Length = 253

 Score =  284 bits (726), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 128/253 (50%), Positives = 179/253 (70%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGT++Q+FKDD    N  + A + GKGVLNNR+SE+  T 
Sbjct: 1   MARRKKIYEGKAKILYEGPEPGTIVQYFKDDATAFNAEKKAVIEGKGVLNNRLSEFFMTG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG IG+P +FI+R+NMREQLVR V++IPL I VRN AAG+++KRL + EG  LPR +VE+
Sbjct: 61  LGHIGVPTHFIKRLNMREQLVRSVDIIPLEIIVRNYAAGTMSKRLGLEEGTQLPRPIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     LV+EEHI AF WA+Q ++++M +L++R+NDF++GL  G+ I+LVDF+I+ 
Sbjct: 121 CYKDDKLGDPLVTEEHIAAFGWASQQDMDDMLSLALRVNDFLSGLMFGVGIRLVDFKIEV 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D D  R+V+ADEI PD CRLWD+    + DK  F +    L + Y+EVA+RLG+  
Sbjct: 181 GRVYDGDFQRLVVADEISPDSCRLWDIESGRKLDKDVFRRDLGDLADAYTEVAQRLGVMP 240

Query: 241 KNEPALKENLILN 253
           KN   + +  ++N
Sbjct: 241 KNATPITKPTLIN 253


>gi|170742989|ref|YP_001771644.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylobacterium sp. 4-46]
 gi|168197263|gb|ACA19210.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylobacterium sp. 4-46]
          Length = 254

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 141/243 (58%), Positives = 183/243 (75%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   ++GKGVLNNRISE++F  
Sbjct: 1   MNRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHEVIDGKGVLNNRISEFVFQH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE+IPL + VRN AAGSLA RL + EG  LPRS++EF
Sbjct: 61  LNDIGVPTHFIRRLNMREQLIREVEIIPLEVVVRNVAAGSLATRLGLEEGTQLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA   E++++ AL+IR+NDF++GLFLG+ I+LVDF+++ 
Sbjct: 121 YYKNDQLNDPMVSEEHITAFGWATPQEIDDIMALAIRVNDFLSGLFLGVGIRLVDFKMET 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RIV+ADEI PD CRLWD+  +++ DK RF K    L+E YSEVARRLGI  
Sbjct: 181 GRLWEGDLMRIVVADEISPDSCRLWDIKSQDKLDKDRFRKDLGGLIEAYSEVARRLGILG 240

Query: 241 KNE 243
           +NE
Sbjct: 241 ENE 243


>gi|110633634|ref|YP_673842.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mesorhizobium sp. BNC1]
 gi|123162445|sp|Q11IU8|PUR7_MESSB RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|110284618|gb|ABG62677.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chelativorans sp. BNC1]
          Length = 263

 Score =  283 bits (725), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 151/252 (59%), Positives = 193/252 (76%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQFFKDD    N  +   ++GKGVLNNRISEY+F  
Sbjct: 1   MNRRRRIYEGKAKILYEGPEPGTLIQFFKDDATAFNKKKHEVVDGKGVLNNRISEYIFEH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IGIP +FIRR+NMREQL+++VE++PL I VRN AAGSLAKRL I EG  LPRS++EF
Sbjct: 61  LNRIGIPTHFIRRLNMREQLIKEVEIVPLEIVVRNIAAGSLAKRLGIEEGTVLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  +VSEEHITAF WA+  E++++ ALSIR+NDF+TGLFLG+ IQLVDF+I+C
Sbjct: 121 YYKADALDDPMVSEEHITAFGWASPQEIDDIMALSIRVNDFLTGLFLGVGIQLVDFKIEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RIV+ADEI PD CRLWD++ +++ DK RF +    L+E Y EVARRLGI  
Sbjct: 181 GRLWEGDMMRIVVADEISPDSCRLWDINTRDKLDKDRFRRDMGGLVEAYQEVARRLGIMN 240

Query: 241 KNEPALKENLIL 252
           +NEP      +L
Sbjct: 241 ENEPPKPAGPVL 252


>gi|86357893|ref|YP_469785.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium
           etli CFN 42]
 gi|86281995|gb|ABC91058.1| phosphoribosylaminoimidazole-succinocarboxamide synthase protein
           [Rhizobium etli CFN 42]
          Length = 254

 Score =  283 bits (725), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 159/254 (62%), Positives = 197/254 (77%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQFFKDD    N  +   ++GKGVLNNRISEY+F+ 
Sbjct: 1   MNRRRRIYEGKAKILYEGPEPGTLIQFFKDDATAFNKKKHEVIDGKGVLNNRISEYIFSH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L KIGIP +FIRR+NMREQL+R+VEMIPL I VRN AAGSLAKRL I EG+ LPRS++EF
Sbjct: 61  LNKIGIPTHFIRRLNMREQLIREVEMIPLEIVVRNVAAGSLAKRLGIEEGVVLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  +VSEEHITAF WAN +E++++ AL+IR+NDFMTGLFLG+ IQLVDF+I+C
Sbjct: 121 YYKSDALDDPMVSEEHITAFGWANPAELDDIMALAIRVNDFMTGLFLGVGIQLVDFKIEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RI+LADEI PD CRLWD+  +E+ DK RF +    LLE YSEVARRLGI  
Sbjct: 181 GRLFEGDMMRIILADEISPDSCRLWDIETREKMDKDRFRRDLGGLLEAYSEVARRLGIIN 240

Query: 241 KNEPALKENLILNR 254
           +NEP      +L +
Sbjct: 241 ENEPVRGTGPVLVK 254


>gi|319405622|emb|CBI79245.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Bartonella
           sp. AR 15-3]
          Length = 254

 Score =  283 bits (725), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 141/254 (55%), Positives = 185/254 (72%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R+ +YE K KI+YEG EPGT IQFFKDD    N  +   ++GKGVLNNRISEY+FTQ
Sbjct: 1   MNRRHRIYEGKAKILYEGPEPGTYIQFFKDDATAFNAKKHEIIDGKGVLNNRISEYIFTQ 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GIP +FI+RINMREQL++ VE+IPL + VRN AAGSL+KRL + EG +LP+S++EF
Sbjct: 61  LARLGIPTHFIKRINMREQLIKAVEIIPLEVVVRNIAAGSLSKRLGLEEGTTLPQSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  DS +  +V+EEHI AF WA   EVE++  LS RIND ++GLF G+ IQLVDF+++ 
Sbjct: 121 YYKNDSLDDPMVTEEHIVAFGWAAPQEVEDIMQLSFRINDVLSGLFAGVGIQLVDFKVEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL   + +RIVLADEI PD  RLWD+  KE+ DK RF +    L++ Y ++ARRLGI  
Sbjct: 181 GRLWIGETMRIVLADEISPDSSRLWDIQTKEKLDKDRFRRDMGGLIDAYQDIARRLGIMN 240

Query: 241 KNEPALKENLILNR 254
           +NEP      +L +
Sbjct: 241 ENEPPRPSGPVLVK 254


>gi|163746418|ref|ZP_02153776.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oceanibulbus indolifex HEL-45]
 gi|161380303|gb|EDQ04714.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oceanibulbus indolifex HEL-45]
          Length = 253

 Score =  283 bits (724), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 128/253 (50%), Positives = 181/253 (71%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  RN +YE K KI+YEG EPGT++Q+FKDD    N  + AT+ GKGVLNNR+SE+  T 
Sbjct: 1   MARRNKIYEGKAKILYEGPEPGTIVQYFKDDATAFNAEKKATIEGKGVLNNRLSEFFMTG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FI+R+NMREQLVR VE+IPL + VRN AAGS++KRL I EG  LPR +VE+
Sbjct: 61  LNNIGVPTHFIKRLNMREQLVRQVEIIPLEVIVRNYAAGSMSKRLGIEEGTQLPRPIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    LV+EEHI AF WA Q +++++ +L++R+NDFM+G+ + + I+LVDF+I+ 
Sbjct: 121 CYKDDALGDPLVTEEHIAAFGWATQQDMDDILSLALRVNDFMSGVMMAVGIKLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D D  R+++ADEI PD CRLWD+   ++ DK  F +    L + Y+EVA+RLG+  
Sbjct: 181 GRVYDGDFQRLIVADEISPDSCRLWDIETGQKLDKDVFRRDLGSLTDAYTEVAKRLGVMP 240

Query: 241 KNEPALKENLILN 253
           KN   + +  ++N
Sbjct: 241 KNNQPVTKPTLIN 253


>gi|220921835|ref|YP_002497136.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylobacterium nodulans ORS 2060]
 gi|219946441|gb|ACL56833.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylobacterium nodulans ORS 2060]
          Length = 264

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 141/243 (58%), Positives = 183/243 (75%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   ++GKGVLNNRISE++F  
Sbjct: 11  MNRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHEVIDGKGVLNNRISEFIFQH 70

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE+IPL + VRN AAGSLA RL + EG  LPRS++EF
Sbjct: 71  LNDIGVPTHFIRRLNMREQLIREVEIIPLEVVVRNVAAGSLATRLGLEEGTQLPRSIIEF 130

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA   E++++ AL+IR+NDF++GLFLG+ I+LVDF+++ 
Sbjct: 131 YYKNDQLNDPMVSEEHITAFGWATPQEIDDIMALAIRVNDFLSGLFLGVGIRLVDFKMET 190

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RIV+ADEI PD CRLWD+  +++ DK RF K    L+E YSEVARRLGI  
Sbjct: 191 GRLWEGDLMRIVVADEISPDSCRLWDIKSQDKLDKDRFRKDLGGLIEAYSEVARRLGILG 250

Query: 241 KNE 243
           +NE
Sbjct: 251 ENE 253


>gi|190891978|ref|YP_001978520.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Rhizobium
           etli CIAT 652]
 gi|218663435|ref|ZP_03519365.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium
           etli IE4771]
 gi|190697257|gb|ACE91342.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase protein
           [Rhizobium etli CIAT 652]
 gi|327190550|gb|EGE57644.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase protein
           [Rhizobium etli CNPAF512]
          Length = 254

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 158/254 (62%), Positives = 197/254 (77%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQFFKDD    N  +   ++GKGVLNNRISEY+F+ 
Sbjct: 1   MNRRRRIYEGKAKILYEGPEPGTLIQFFKDDATAFNKKKHEVIDGKGVLNNRISEYIFSH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L KIGIP +FIRR+NMREQL+++VEMIPL I VRN AAGSLAKRL I EG+ LPRS++EF
Sbjct: 61  LNKIGIPTHFIRRLNMREQLIKEVEMIPLEIVVRNVAAGSLAKRLGIEEGVVLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  +VSEEHITAF WAN +E++++ AL+IR+NDFMTGLFLG+ IQLVDF+I+C
Sbjct: 121 YYKSDALDDPMVSEEHITAFGWANPAELDDIMALAIRVNDFMTGLFLGVGIQLVDFKIEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RI+LADEI PD CRLWD+  +E+ DK RF +    LLE YSEVARRLGI  
Sbjct: 181 GRLFEGDMMRIILADEISPDSCRLWDIETREKMDKDRFRRDLGGLLEAYSEVARRLGIIN 240

Query: 241 KNEPALKENLILNR 254
           +NEP      +L +
Sbjct: 241 ENEPVRGTGPVLVK 254


>gi|84687054|ref|ZP_01014937.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84665028|gb|EAQ11509.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacterales bacterium HTCC2654]
          Length = 253

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 124/253 (49%), Positives = 177/253 (69%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTL+Q+FKDD    N  +   + GKGVLNNR+SE+  T 
Sbjct: 1   MARRKKLYEGKAKILYEGPEPGTLVQYFKDDATAFNAQKKDVIEGKGVLNNRLSEFFMTG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P++FI+R+NMREQL+R VE++PL + VRN AAGS+AKRL + EG +LPR +VEF
Sbjct: 61  LTAIGVPNHFIKRLNMREQLIRQVEIVPLEVIVRNFAAGSMAKRLGLEEGTALPRPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    LV EE+I AF WA+Q +++++ AL++R+NDFM G+  G+ I+L+DF+I+ 
Sbjct: 121 SYKDDALGDPLVPEEYIIAFGWASQQDLDDIVALALRVNDFMAGVMHGVGIKLIDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D D +R+++ADEI PD CRLWD+    + DK  F +    L + Y+EVA+RLG+  
Sbjct: 181 GRVWDGDFMRLIVADEISPDSCRLWDIETGRKLDKDVFRQDLGSLSDAYTEVAKRLGVLP 240

Query: 241 KNEPALKENLILN 253
            N     +  ++N
Sbjct: 241 TNVTHATKPTLIN 253


>gi|154248014|ref|YP_001418972.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthobacter autotrophicus Py2]
 gi|154162099|gb|ABS69315.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthobacter autotrophicus Py2]
          Length = 264

 Score =  283 bits (723), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 143/254 (56%), Positives = 191/254 (75%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   ++GKGVLNNRISEY+F++
Sbjct: 11  MSRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHDVIDGKGVLNNRISEYIFSR 70

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE+IPL I VRN AAGS++ RL I EG  LPRS++EF
Sbjct: 71  LNDIGVPTHFIRRLNMREQLIREVEIIPLEIVVRNVAAGSISTRLGIEEGTPLPRSIIEF 130

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    +VSEEHITAF WA   E++++ AL+IR+NDF++GLFLG  I+LVDF+++C
Sbjct: 131 YYKNDALNDPMVSEEHITAFGWATTQEIDDIIALAIRVNDFLSGLFLGAGIRLVDFKMEC 190

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL ++D++RIV+ADEI PD CRLWD+   ++ DK RF +    L+E YSEVARRLGI  
Sbjct: 191 GRLWENDMMRIVVADEISPDSCRLWDIKSNDKMDKDRFRRDMGGLVEAYSEVARRLGILM 250

Query: 241 KNEPALKENLILNR 254
           +N+P   +  +L +
Sbjct: 251 ENDPTQGKGPVLVK 264


>gi|161777628|ref|YP_425802.2| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodospirillum rubrum ATCC 11170]
          Length = 255

 Score =  283 bits (723), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 131/255 (51%), Positives = 189/255 (74%), Gaps = 2/255 (0%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K+++EG EPGTL+Q+FKDD    NN +  T+ GKGVLNNRISEY+ T+
Sbjct: 1   MARRKQIYEGKAKVLFEGPEPGTLVQYFKDDATAFNNKKHGTITGKGVLNNRISEYLMTR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IG+P++F+RR+NMREQLVR VE+IP+ + +RN AAGS++ +  IPEG  LPRS+VE+
Sbjct: 61  LTEIGVPNHFVRRLNMREQLVRQVEIIPIEVVIRNVAAGSISTKFAIPEGTQLPRSIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEH+TAF WA+  E++E+ +LS+RIND+++GLFLG+ ++LVDF+++ 
Sbjct: 121 YYKNDELNDPMVSEEHVTAFGWASVQELDEILSLSLRINDYLSGLFLGVQLRLVDFKLEF 180

Query: 181 GRLLDDD-ILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
           GR+ +++  ++I+LADEI PD CRLWD++  E+ DK RF +    + E Y EVARRLGI 
Sbjct: 181 GRIYNENGDVQIILADEISPDNCRLWDVTTGEKLDKDRFRRDLGGVAEAYQEVARRLGIL 240

Query: 240 KKNEP-ALKENLILN 253
            +  P  +K   ++ 
Sbjct: 241 PEGGPRDIKGPPVMQ 255


>gi|114767137|ref|ZP_01446017.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pelagibaca bermudensis HTCC2601]
 gi|114540699|gb|EAU43767.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseovarius sp. HTCC2601]
          Length = 253

 Score =  283 bits (723), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 125/253 (49%), Positives = 175/253 (69%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGT++Q+FKDD    N  +   + GKGVLNNR+SE+  T 
Sbjct: 1   MARRKKIYEGKAKILYEGPEPGTIVQYFKDDATAFNAQKKDVIEGKGVLNNRLSEFFMTG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +F++R+NMREQLVR  E+IPL + VRN AAGSLAKRL + EG  LPR +VE+
Sbjct: 61  LNNIGVPTHFLKRLNMREQLVRSCEIIPLEVIVRNFAAGSLAKRLGLEEGTPLPRPIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     LV+EEHI AF WA+Q +++++ +L++R+ND+++GL  G+ I+LVDF+I+ 
Sbjct: 121 CYKDDKLGDPLVTEEHIAAFGWASQQDMDDILSLALRVNDYLSGLMYGVGIRLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D D  R+V+ADEI PD CRLWDL   ++ DK  F +    L + Y+EVA RLG+  
Sbjct: 181 GRVYDGDFQRLVVADEISPDSCRLWDLQTGQKLDKDVFRRDLGSLTDAYTEVAERLGVMP 240

Query: 241 KNEPALKENLILN 253
           K    + +  ++N
Sbjct: 241 KQATHISKPKLIN 253


>gi|90420943|ref|ZP_01228848.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Aurantimonas manganoxydans SI85-9A1]
 gi|90334918|gb|EAS48690.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Aurantimonas manganoxydans SI85-9A1]
          Length = 254

 Score =  283 bits (723), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 147/254 (57%), Positives = 193/254 (75%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTL+QFFKDD    N  +   ++GKGVLNNRISEY+F+ 
Sbjct: 1   MTRRRRIYEGKGKILYEGPEPGTLVQFFKDDATAFNKKKHEVVDGKGVLNNRISEYIFSH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K+GIP +FI+R+NMREQL+++VE+IPL + VRN AAGSLAKRL I EG  LPRS++EF
Sbjct: 61  LNKMGIPTHFIKRLNMREQLIKEVEIIPLEVVVRNVAAGSLAKRLGIEEGTVLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  LVSEEHITAF WA+  E++++ AL+IR+NDF++GLFLG+ IQLVDF+I+ 
Sbjct: 121 YYKADALDDPLVSEEHITAFGWASPQEIDDIMALAIRVNDFLSGLFLGVGIQLVDFKIEM 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RI++ADEI PD CRLWD+  +E+ DK RF +    L+E Y EVARRLGI  
Sbjct: 181 GRLFEGDMMRIIVADEISPDSCRLWDVQTQEKLDKDRFRRDMGGLVEAYQEVARRLGIMN 240

Query: 241 KNEPALKENLILNR 254
           +NEP      +L +
Sbjct: 241 ENEPPRPSGPVLVK 254


>gi|319404176|emb|CBI77769.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Bartonella
           rochalimae ATCC BAA-1498]
          Length = 254

 Score =  283 bits (723), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 139/254 (54%), Positives = 184/254 (72%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R+ +YE K KI+YEG EPGT IQFFKDD    N  +   ++GKGVLNNRISEY+FTQ
Sbjct: 1   MNRRHRIYEGKAKILYEGPEPGTYIQFFKDDATAFNAKKHEIIDGKGVLNNRISEYIFTQ 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GIP +FI+RINMREQL++ VE+IPL + VRN  AGSL+KRL + EG +LP+S++EF
Sbjct: 61  LSRLGIPTHFIKRINMREQLIKAVEIIPLEVVVRNIVAGSLSKRLGLEEGTALPQSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  +V+EEHI A  WA   EVE++  LS RINDF++GLF G+ IQLVDF+++ 
Sbjct: 121 YYKNDALDDPMVTEEHIVALGWAASQEVEDIMQLSFRINDFLSGLFAGVGIQLVDFKVEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL   + +R+VLADEI PD  RLWD+  KE+ DK RF +    L++ Y +VARRLGI  
Sbjct: 181 GRLWTGETMRVVLADEISPDSSRLWDIQTKEKLDKDRFRRDMGGLIDAYQDVARRLGIMN 240

Query: 241 KNEPALKENLILNR 254
           +NEP      +L +
Sbjct: 241 ENEPPRPSGPVLVK 254


>gi|254452666|ref|ZP_05066103.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Octadecabacter antarcticus 238]
 gi|198267072|gb|EDY91342.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Octadecabacter antarcticus 238]
          Length = 253

 Score =  282 bits (722), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 125/253 (49%), Positives = 178/253 (70%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  VYE K KI+YEG EPGTL+Q+FKDD    N  +   ++GKGVLNNR+SE+    
Sbjct: 1   MARRKLVYEGKAKILYEGTEPGTLVQYFKDDATAFNAQKKGIIDGKGVLNNRLSEFFMLG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IG+P +FIRR+NMREQL+R VE+IPL + VRN AAG++AKRL + EG  LPR +VEF
Sbjct: 61  LARIGVPTHFIRRLNMREQLIRQVEIIPLEVIVRNFAAGTMAKRLGMEEGTPLPRPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    LV EE+I AF WA+Q +++++ AL++R+NDFM G+  G+ I+L+DF+I+ 
Sbjct: 121 SYKDDALGDPLVPEEYIIAFGWASQQDLDDIIALALRVNDFMAGVMHGVGIKLIDFKIEV 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D+D +R+++ADEI PD CRLWD+    + DK  F +    L + Y+EVA+RLG+  
Sbjct: 181 GRVWDNDFMRLIVADEISPDSCRLWDIESGRKLDKDVFRQDLGDLADAYTEVAKRLGVLP 240

Query: 241 KNEPALKENLILN 253
            N   + +  ++N
Sbjct: 241 SNATHMPKPTLIN 253


>gi|218514554|ref|ZP_03511394.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium
           etli 8C-3]
          Length = 254

 Score =  282 bits (722), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 158/254 (62%), Positives = 197/254 (77%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQFFKDD    N  +   ++GKGVLNNRISEY+F+ 
Sbjct: 1   MNRRRSIYEGKAKILYEGPEPGTLIQFFKDDATAFNKKKHEVIDGKGVLNNRISEYIFSH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L KIGIP +FIRR+NMREQL+++VEMIPL I VRN AAGSLAKRL I EG+ LPRS++EF
Sbjct: 61  LNKIGIPTHFIRRLNMREQLIKEVEMIPLEIVVRNVAAGSLAKRLGIEEGVVLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  +VSEEHITAF WAN +E++++ AL+IR+NDFMTGLFLG+ IQLVDF+I+C
Sbjct: 121 YYKSDALDDPMVSEEHITAFGWANPAELDDIMALAIRVNDFMTGLFLGVGIQLVDFKIEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RI+LADEI PD CRLWD+  +E+ DK RF +    LLE YSEVARRLGI  
Sbjct: 181 GRLFEGDMMRIILADEISPDSCRLWDIETREKMDKDRFRRDLGGLLEAYSEVARRLGIIN 240

Query: 241 KNEPALKENLILNR 254
           +NEP      +L +
Sbjct: 241 ENEPVRGTGPVLVK 254


>gi|209549520|ref|YP_002281437.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209535276|gb|ACI55211.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 254

 Score =  282 bits (722), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 158/254 (62%), Positives = 196/254 (77%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQFFKDD    N  +   ++GKGVLNNRISEY+F+ 
Sbjct: 1   MNRRRRIYEGKAKILYEGPEPGTLIQFFKDDATAFNKKKHEVIDGKGVLNNRISEYIFSH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L KIGIP +FIRR+NMREQL+++VEMIPL I VRN AAGSLAKRL I EG+ LPRS++EF
Sbjct: 61  LNKIGIPTHFIRRLNMREQLIKEVEMIPLEIVVRNVAAGSLAKRLGIDEGVVLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  +VSEEHITAF WAN +E++++ AL+IR+NDFMTGLFLG+ IQLVDF+I+C
Sbjct: 121 YYKSDALDDPMVSEEHITAFGWANPAELDDIMALAIRVNDFMTGLFLGVGIQLVDFKIEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RI+LADEI PD CRLWD+   E+ DK RF +    LLE YSEVARRLGI  
Sbjct: 181 GRLFEGDLMRIILADEISPDSCRLWDIETHEKMDKDRFRRDLGGLLEAYSEVARRLGIIN 240

Query: 241 KNEPALKENLILNR 254
           +NEP      +L +
Sbjct: 241 ENEPVRGTGPVLVK 254


>gi|163735124|ref|ZP_02142560.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseobacter litoralis Och 149]
 gi|161391582|gb|EDQ15915.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseobacter litoralis Och 149]
          Length = 253

 Score =  282 bits (722), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 128/253 (50%), Positives = 178/253 (70%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGT++Q+FKDD    N  + A + GKGVLNNR+SE+  T 
Sbjct: 1   MARRKKIYEGKAKILYEGPEPGTIVQYFKDDATAFNAEKKAVIEGKGVLNNRLSEFFMTG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG IG+P +FI+R+NMREQLVR V++IPL I VRN AAG+++KRL + EG+ LPR +VE+
Sbjct: 61  LGHIGVPTHFIKRLNMREQLVRSVDIIPLEIIVRNYAAGTMSKRLGLEEGVQLPRPIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     LVSEEHI AF WA+Q ++++M +L++R+NDF++GL  G+ I+LVDF+I+ 
Sbjct: 121 CYKDDKLGDPLVSEEHIAAFGWASQQDMDDMLSLALRVNDFLSGLMFGVGIRLVDFKIEV 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D D  R+V+ADEI PD CRLWD+    + DK  F +    L + Y+EVA RLG+  
Sbjct: 181 GRVYDGDFQRLVVADEISPDSCRLWDIESGRKLDKDVFRRDLGDLADAYTEVAERLGVMP 240

Query: 241 KNEPALKENLILN 253
           K    + +  ++N
Sbjct: 241 KKATPMTKPTLIN 253


>gi|126731314|ref|ZP_01747121.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Sagittula
           stellata E-37]
 gi|126708225|gb|EBA07284.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Sagittula
           stellata E-37]
          Length = 253

 Score =  282 bits (722), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 128/253 (50%), Positives = 178/253 (70%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGT++Q+FKDD    N  +   + GKGVLNNR+SE+  T 
Sbjct: 1   MARRKKIYEGKAKILYEGPEPGTIVQYFKDDATAFNAQKKDVIEGKGVLNNRLSEFFMTG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  +G+P +FI+R+NMREQLVR VE+IPL I VRN AAGSL+KRL I EG +LPR +VE+
Sbjct: 61  LNNVGVPTHFIKRLNMREQLVRAVEIIPLEIIVRNYAAGSLSKRLGIEEGTALPRPIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     LV+EEHI AF WA+Q +++++ AL++R+ND+++GL  G+ I+LVDF+I+ 
Sbjct: 121 CYKDDKLGDPLVTEEHIAAFGWASQQDMDDILALALRVNDYLSGLMYGVGIKLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D D  R+++ADEI PD CRLWDL   ++ DK  F +    L + Y+EVARRLG+  
Sbjct: 181 GRVYDGDYQRLIVADEISPDSCRLWDLETGQKLDKDVFRQDLGNLADAYTEVARRLGVMP 240

Query: 241 KNEPALKENLILN 253
           K    + +  ++N
Sbjct: 241 KQSTHMPKPKLIN 253


>gi|17987405|ref|NP_540039.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           melitensis bv. 1 str. 16M]
 gi|225852355|ref|YP_002732588.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           melitensis ATCC 23457]
 gi|254689095|ref|ZP_05152349.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           abortus bv. 6 str. 870]
 gi|254693578|ref|ZP_05155406.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           abortus bv. 3 str. Tulya]
 gi|256044517|ref|ZP_05447421.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|256113378|ref|ZP_05454232.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           melitensis bv. 3 str. Ether]
 gi|256257344|ref|ZP_05462880.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           abortus bv. 9 str. C68]
 gi|256264146|ref|ZP_05466678.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           melitensis bv. 2 str. 63/9]
 gi|260563871|ref|ZP_05834357.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           melitensis bv. 1 str. 16M]
 gi|260754593|ref|ZP_05866941.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           abortus bv. 6 str. 870]
 gi|260883620|ref|ZP_05895234.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           abortus bv. 9 str. C68]
 gi|261213843|ref|ZP_05928124.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           abortus bv. 3 str. Tulya]
 gi|265990942|ref|ZP_06103499.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|265994780|ref|ZP_06107337.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           melitensis bv. 3 str. Ether]
 gi|297248193|ref|ZP_06931911.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           abortus bv. 5 str. B3196]
 gi|22001855|sp|Q8YGN6|PUR7_BRUME RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|254783940|sp|C0RIH6|PUR7_BRUMB RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|17983095|gb|AAL52303.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           melitensis bv. 1 str. 16M]
 gi|225640720|gb|ACO00634.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           melitensis ATCC 23457]
 gi|260153887|gb|EEW88979.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           melitensis bv. 1 str. 16M]
 gi|260674701|gb|EEX61522.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           abortus bv. 6 str. 870]
 gi|260873148|gb|EEX80217.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           abortus bv. 9 str. C68]
 gi|260915450|gb|EEX82311.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           abortus bv. 3 str. Tulya]
 gi|262765893|gb|EEZ11682.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           melitensis bv. 3 str. Ether]
 gi|263001726|gb|EEZ14301.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|263094364|gb|EEZ18209.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           melitensis bv. 2 str. 63/9]
 gi|297175362|gb|EFH34709.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           abortus bv. 5 str. B3196]
 gi|326408862|gb|ADZ65927.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           melitensis M28]
 gi|326538579|gb|ADZ86794.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           melitensis M5-90]
          Length = 254

 Score =  282 bits (722), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 144/254 (56%), Positives = 191/254 (75%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTL+QFFKDD    N  +   ++GKGVLNNRISE++FTQ
Sbjct: 1   MNRRRRIYEGKAKILYEGPEPGTLVQFFKDDATAFNAKKHEVIDGKGVLNNRISEHIFTQ 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IGIP +FIRR+NMREQL+++VE+IPL + VRN AAGSLAK L + EG  LPRS++EF
Sbjct: 61  LNRIGIPTHFIRRLNMREQLIKEVEIIPLEVVVRNVAAGSLAKHLGLEEGTILPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  +V+EEHITAF WA+  E++++ AL+IR+NDF+TGLFLGI IQLVDF+++C
Sbjct: 121 YYKADALDDPMVTEEHITAFGWASPQEIDDIMALAIRVNDFLTGLFLGIGIQLVDFKMEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RIV+ADEI PD  RLWD++  ++ DK RF +    L+E Y EVARRLGI  
Sbjct: 181 GRLWEGDMMRIVVADEISPDSARLWDITTNDKLDKDRFRRDMGGLVEAYQEVARRLGIMN 240

Query: 241 KNEPALKENLILNR 254
           +N+        L +
Sbjct: 241 ENDTPRPSGPTLVK 254


>gi|84517073|ref|ZP_01004429.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Loktanella vestfoldensis SKA53]
 gi|84508968|gb|EAQ05429.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Loktanella vestfoldensis SKA53]
          Length = 253

 Score =  282 bits (721), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 130/253 (51%), Positives = 180/253 (71%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTL+Q+FKDD    N  + A + GKGVLNNR+SE+  T 
Sbjct: 1   MARRKKIYEGKAKILYEGPEPGTLVQYFKDDATAFNAEKRAVIEGKGVLNNRLSEFFMTG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+IGIP +FIRR+NMREQL+R VE+IPL I VRN AAGS+AKRL I EG  LPR +VEF
Sbjct: 61  LGQIGIPTHFIRRLNMREQLIRQVEIIPLEIIVRNVAAGSMAKRLGIEEGTQLPRPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    LV EE+I AF WA+Q +++++ +L++R+ND+M+G+  G+ I+LVDF+I+ 
Sbjct: 121 SYKDDALGDPLVPEEYIIAFGWASQQDMDDIVSLALRVNDWMSGVMYGVGIKLVDFKIEV 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D++  R++LADEI PD CRLWD+   ++ DK  F +    L + Y+EVA+RLG+  
Sbjct: 181 GRVWDNEFPRLLLADEISPDSCRLWDIETGQKLDKDVFRRDLGNLTDAYTEVAKRLGVMP 240

Query: 241 KNEPALKENLILN 253
            N     +  ++N
Sbjct: 241 SNVTHRPKPTLIN 253


>gi|297184392|gb|ADI20508.1| phosphoribosylaminoimidazolesuccinocarboxamide (saicar) synthase
           [uncultured alpha proteobacterium EB080_L58F04]
          Length = 253

 Score =  282 bits (721), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 125/253 (49%), Positives = 176/253 (69%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTL+Q+FKDD    N  +   ++GKGVLNNR+SE+    
Sbjct: 1   MARRVKIYEGKAKILYEGPEPGTLVQYFKDDATAYNAEKKDVIDGKGVLNNRLSEFFMAG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IG+P +FI+R+NMREQLVR+ E+IPL + VRN AAGS+ KRL + EG  LPR +VE+
Sbjct: 61  LNEIGVPTHFIKRLNMREQLVRNCEIIPLEVIVRNFAAGSICKRLGLEEGSRLPRPIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    LV+EEHI AF WA Q +++++ +L++R+NDF++G+ LG  I+L DF+I+ 
Sbjct: 121 CYKDDALGDPLVTEEHIAAFGWATQQDMDDILSLALRVNDFISGIMLGAGIRLADFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D D  R+V+ADEI PD CRLWD    ++ DK  F +    L + Y+EVARRLG+  
Sbjct: 181 GRVYDGDFQRLVIADEISPDSCRLWDFETGQKLDKDVFRRDLGSLTDAYTEVARRLGVLP 240

Query: 241 KNEPALKENLILN 253
           KN   + +  ++N
Sbjct: 241 KNATNITKPTLIN 253


>gi|254462023|ref|ZP_05075439.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacterales bacterium HTCC2083]
 gi|206678612|gb|EDZ43099.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 253

 Score =  282 bits (721), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 123/253 (48%), Positives = 174/253 (68%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +YEG EPGTLIQ+FKDD    N  +   + GKGVLNN +SEY    
Sbjct: 1   MARGKKIYEGKAKTLYEGTEPGTLIQYFKDDATAFNAEKKDVIEGKGVLNNMLSEYFMVG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG IG+P +FI+RINMREQLVR  E++PL I VRN AAG++++RL I EG  LPR ++E+
Sbjct: 61  LGSIGVPTHFIKRINMREQLVRTCEIVPLEIIVRNYAAGTMSQRLGIEEGTQLPRPIIEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
               D     LVSEEHI AF WA+Q ++E++ +L++R+NDF++G+  G+ I+L+DF+I+ 
Sbjct: 121 CLKDDKLGDPLVSEEHIAAFGWASQQDMEDILSLTLRVNDFLSGIMYGVGIKLIDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ + D  R++LADEI PD CRLWD+   ++ DK  F +    L + Y+EVARRLG+  
Sbjct: 181 GRVYEGDYQRLILADEISPDSCRLWDMETNQKLDKDVFRRDLGSLTDAYTEVARRLGVLP 240

Query: 241 KNEPALKENLILN 253
           KN+  + +  ++N
Sbjct: 241 KNQQPVTKPTLIN 253


>gi|62289789|ref|YP_221582.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           abortus bv. 1 str. 9-941]
 gi|82699716|ref|YP_414290.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           melitensis biovar Abortus 2308]
 gi|189024031|ref|YP_001934799.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           abortus S19]
 gi|237815274|ref|ZP_04594272.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           abortus str. 2308 A]
 gi|254697228|ref|ZP_05159056.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|254730127|ref|ZP_05188705.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           abortus bv. 4 str. 292]
 gi|260545463|ref|ZP_05821204.1| saicar synthetase [Brucella abortus NCTC 8038]
 gi|260757816|ref|ZP_05870164.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           abortus bv. 4 str. 292]
 gi|260761639|ref|ZP_05873982.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|81309428|sp|Q57DR3|PUR7_BRUAB RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|123546640|sp|Q2YNG1|PUR7_BRUA2 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229485667|sp|B2S578|PUR7_BRUA1 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|62195921|gb|AAX74221.1| PurC, phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Brucella abortus bv. 1 str. 9-941]
 gi|82615817|emb|CAJ10818.1| SAICAR synthetase [Brucella melitensis biovar Abortus 2308]
 gi|189019603|gb|ACD72325.1| SAICAR synthetase [Brucella abortus S19]
 gi|237790111|gb|EEP64321.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           abortus str. 2308 A]
 gi|260096870|gb|EEW80745.1| saicar synthetase [Brucella abortus NCTC 8038]
 gi|260668134|gb|EEX55074.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           abortus bv. 4 str. 292]
 gi|260672071|gb|EEX58892.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           abortus bv. 2 str. 86/8/59]
          Length = 254

 Score =  282 bits (721), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 144/254 (56%), Positives = 190/254 (74%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTL+QFFKDD    N  +   ++GKGVLNNRISE++FTQ
Sbjct: 1   MNRRRRIYEGKAKILYEGPEPGTLVQFFKDDATAFNAKKHEVIDGKGVLNNRISEHIFTQ 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IGIP +FIRR+NMREQL+++VE+IPL + VRN AAGSLAK L + EG  LPRS++EF
Sbjct: 61  LNRIGIPTHFIRRLNMREQLIKEVEIIPLEVVVRNVAAGSLAKHLGLEEGTILPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    +V+EEHITAF WA+  E++++ AL+IR+NDF+TGLFLGI IQLVDF+++C
Sbjct: 121 YYKADALNDPMVTEEHITAFGWASPQEIDDIMALAIRVNDFLTGLFLGIGIQLVDFKMEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RIV+ADEI PD  RLWD++  ++ DK RF +    L+E Y EVARRLGI  
Sbjct: 181 GRLWEGDMMRIVVADEISPDSARLWDITTNDKLDKDRFRRDMGGLVEAYQEVARRLGIMN 240

Query: 241 KNEPALKENLILNR 254
           +N+        L +
Sbjct: 241 ENDTPRPSGPTLVK 254


>gi|121601990|ref|YP_989146.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bartonella bacilliformis KC583]
 gi|120614167|gb|ABM44768.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bartonella bacilliformis KC583]
          Length = 255

 Score =  282 bits (721), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 140/254 (55%), Positives = 187/254 (73%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGT IQFFKDD    N  +   ++GKGVLNNRISE++FTQ
Sbjct: 2   MSRRRRIYEGKAKILYEGPEPGTYIQFFKDDATAFNAKKHEVIDGKGVLNNRISEHIFTQ 61

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG++ IP +FI+RINMREQL++ VE+IPL + +RN AAGSL+KRL + EG  LP+S++EF
Sbjct: 62  LGRLNIPTHFIKRINMREQLIKAVEIIPLEVVIRNVAAGSLSKRLGLEEGTVLPQSIIEF 121

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  DS +  +V+EEHITAF WA   EVE++  LSIRINDF++GLF G+ IQL+DF+++ 
Sbjct: 122 YYKNDSLDDPMVTEEHITAFGWAAPQEVEDIMQLSIRINDFLSGLFAGVGIQLIDFKMEF 181

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL +++ +RIVLADEI PD  RLWD+  +E+ DK RF +    L+  Y +VARRLGI  
Sbjct: 182 GRLWENETMRIVLADEISPDSARLWDMQTQEKMDKDRFRRDLGGLINAYQDVARRLGIMN 241

Query: 241 KNEPALKENLILNR 254
           +N+P      +L +
Sbjct: 242 ENDPPRPNGPVLVK 255


>gi|240137163|ref|YP_002961632.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase (SAICAR
           synthetase) [Methylobacterium extorquens AM1]
 gi|240007129|gb|ACS38355.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase (SAICAR
           synthetase) [Methylobacterium extorquens AM1]
          Length = 254

 Score =  282 bits (721), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 139/243 (57%), Positives = 182/243 (74%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   ++GKGVLNNRISE++F  
Sbjct: 1   MNRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHEVIDGKGVLNNRISEFVFQH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE+IPL + VRN AAGSLA RL + EG  LPRS++EF
Sbjct: 61  LNDIGVPTHFIRRLNMREQLIREVEIIPLEVVVRNVAAGSLATRLGLEEGTQLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA   E++++ AL+IR+NDF++GLFLG+ I+LVDF+++ 
Sbjct: 121 YYKNDQLNDPMVSEEHITAFGWATPQEIDDIMALAIRVNDFLSGLFLGVGIRLVDFKMET 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RIV+ADEI PD CRLWD+   ++ DK RF K    L+E Y+EVA+RLGI  
Sbjct: 181 GRLWEGDLMRIVVADEISPDSCRLWDIKSSDKLDKDRFRKDLGGLIEAYTEVAKRLGIMS 240

Query: 241 KNE 243
           +NE
Sbjct: 241 ENE 243


>gi|153009710|ref|YP_001370925.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Ochrobactrum anthropi ATCC 49188]
 gi|166230829|sp|A6X1J2|PUR7_OCHA4 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|151561598|gb|ABS15096.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Ochrobactrum anthropi ATCC 49188]
          Length = 254

 Score =  282 bits (721), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 145/254 (57%), Positives = 192/254 (75%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTL+QFFKDD    N  +   ++GKGVLNNRISE++FTQ
Sbjct: 1   MNRRRRIYEGKAKILYEGPEPGTLVQFFKDDATAFNAKKHEVIDGKGVLNNRISEHIFTQ 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IGIP +FIRR+NMREQL+++VE+IPL + VRN AAGSLAKRL + EG  LPRS++EF
Sbjct: 61  LNRIGIPTHFIRRLNMREQLIKEVEIIPLEVVVRNVAAGSLAKRLGLEEGTVLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  +V+EEHITAF WA+  E++++ AL+IR+NDF+TGLFLGI IQLVDF+++C
Sbjct: 121 YYKADALDDPMVTEEHITAFGWASPPEIDDIMALAIRVNDFLTGLFLGIGIQLVDFKMEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RIV+ADEI PD  RLWD++  ++ DK RF +    L+E Y EVARRLGI  
Sbjct: 181 GRLWEGDMMRIVVADEISPDSARLWDITTNDKLDKDRFRRDMGGLVEAYQEVARRLGIMN 240

Query: 241 KNEPALKENLILNR 254
           +N+        L +
Sbjct: 241 ENDTPRPAGPTLVK 254


>gi|296284367|ref|ZP_06862365.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Citromicrobium bathyomarinum JL354]
          Length = 267

 Score =  282 bits (721), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 138/248 (55%), Positives = 181/248 (72%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQ+FKDD    N  +  T+NGKGV+NNRISE++FT+
Sbjct: 1   MSRRRQIYEGKAKILYEGPEPGTLIQYFKDDATAFNAEKKGTINGKGVINNRISEHVFTR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IGIP +FIRR+NMREQL+R VE+IPL + VRN AAGSL KRL + EG  LP SL+E+
Sbjct: 61  LANIGIPTHFIRRLNMREQLIRQVEIIPLEVVVRNVAAGSLCKRLGLEEGEPLPHSLIEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    LV+EEHI  FNWA+Q E+++M+A++IRINDF+ G+F  ++I+LVDF+++ 
Sbjct: 121 YYKDDALGDPLVAEEHIACFNWASQEEMQDMSAMAIRINDFIAGMFAAVDIRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL D D  R++LADEI PD CRLWD++  E+ DK RF +      E Y EVARRLG+ +
Sbjct: 181 GRLWDGDYARVILADEISPDGCRLWDMNSGEKLDKDRFRRDLGGEEEAYQEVARRLGVLQ 240

Query: 241 KNEPALKE 248
            +     E
Sbjct: 241 NDGNTPGE 248


>gi|144901037|emb|CAM77901.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 254

 Score =  281 bits (720), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 135/244 (55%), Positives = 183/244 (75%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K+++EG EPGTL+Q+FKDD    NN +  T+ GKGVLNNRISEY+  +
Sbjct: 1   MARRRQIYEGKAKVLFEGPEPGTLVQYFKDDATAFNNKKKGTITGKGVLNNRISEYLMIK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+IGIP +F+RR+NMREQLVR+VE+IPL + VRN +AGSLA+R  + EG  LPRS+VE+
Sbjct: 61  LGEIGIPTHFVRRLNMREQLVREVEIIPLEVVVRNISAGSLAQRFGLSEGTPLPRSIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D+    +V+EEHITAF WA   +++E+ ++S+R+NDF+TGLFLG+ I+LVDF+++ 
Sbjct: 121 YFKSDALGDPMVAEEHITAFGWATTQDIDELMSMSLRVNDFLTGLFLGVGIRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D ++IVLADEI PD CRLWDL   E+ DK RF +    + + Y EVARRLGI  
Sbjct: 181 GRLYNGDDMQIVLADEISPDNCRLWDLKTGEKMDKDRFRRDLGNVEDAYQEVARRLGILP 240

Query: 241 KNEP 244
           +  P
Sbjct: 241 EGGP 244


>gi|254439128|ref|ZP_05052622.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Octadecabacter antarcticus 307]
 gi|198254574|gb|EDY78888.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Octadecabacter antarcticus 307]
          Length = 253

 Score =  281 bits (720), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 126/253 (49%), Positives = 178/253 (70%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  VYE K KI+YEG EPGTL+Q+FKDD    N  +   ++GKGVLNNR+SE+    
Sbjct: 1   MARRKLVYEGKAKILYEGTEPGTLVQYFKDDATAFNAQKKEIIDGKGVLNNRLSEFFMMG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IG+P +FIRR+NMREQL+R VE+IPL + VRN AAG++AKRL + EG  LPR +VEF
Sbjct: 61  LARIGVPTHFIRRLNMREQLIRQVEIIPLEVIVRNFAAGTMAKRLGMEEGTPLPRPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  DS    LV EE+I AF WA+Q +++++ AL++R+NDFM G+  G+ I+L+DF+I+ 
Sbjct: 121 SYKDDSLGDPLVPEEYIIAFGWASQQDLDDIIALALRVNDFMAGVMHGVGIKLIDFKIEV 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D+D +R+++ADEI PD CRLWD+    + DK  F +    L + Y+EVA+RLG+  
Sbjct: 181 GRVWDNDFMRLIVADEISPDSCRLWDIESGRKLDKDVFRQDLGDLADAYTEVAKRLGVLP 240

Query: 241 KNEPALKENLILN 253
            N   + +  ++N
Sbjct: 241 SNATHMPKPTLIN 253


>gi|85373319|ref|YP_457381.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Erythrobacter litoralis HTCC2594]
 gi|122545095|sp|Q2NCK7|PUR7_ERYLH RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|84786402|gb|ABC62584.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Erythrobacter litoralis HTCC2594]
          Length = 272

 Score =  281 bits (720), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 132/241 (54%), Positives = 178/241 (73%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGT+IQ+FKDD    N  +  T++GKGV+NNRISE++FT+
Sbjct: 1   MSRRRQIYEGKAKILYEGPEPGTIIQYFKDDATAFNAEKKGTISGKGVINNRISEHVFTR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IGIP +FIRR+NMREQLVR  E+IP+ + VRN AAGS++KRL IPEG  LP +L+E+
Sbjct: 61  LSHIGIPTHFIRRLNMREQLVRQCEIIPIEVVVRNVAAGSISKRLGIPEGEPLPHTLIEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  DS    L++EEHI  FNWA+  E++++ +++IRINDFM G+F  I+I+LVDF+++ 
Sbjct: 121 YYKDDSLGDPLIAEEHIACFNWASPEEMQDIASMAIRINDFMAGMFAAIDIRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D D  R++LADEI PD CRLWD++  E+ DK RF +      E Y EVARRLG+  
Sbjct: 181 GRIYDGDFSRVILADEISPDGCRLWDMNSGEKLDKDRFRRDLGGESEAYQEVARRLGLLD 240

Query: 241 K 241
           +
Sbjct: 241 E 241


>gi|23501729|ref|NP_697856.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           suis 1330]
 gi|148558854|ref|YP_001258817.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           ovis ATCC 25840]
 gi|161618806|ref|YP_001592693.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           canis ATCC 23365]
 gi|163843115|ref|YP_001627519.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           suis ATCC 23445]
 gi|225627334|ref|ZP_03785371.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           ceti str. Cudo]
 gi|239831726|ref|ZP_04680055.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Ochrobactrum intermedium LMG 3301]
 gi|254704154|ref|ZP_05165982.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           suis bv. 3 str. 686]
 gi|254706946|ref|ZP_05168774.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           pinnipedialis M163/99/10]
 gi|254709947|ref|ZP_05171758.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           pinnipedialis B2/94]
 gi|254713947|ref|ZP_05175758.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           ceti M644/93/1]
 gi|254716995|ref|ZP_05178806.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           ceti M13/05/1]
 gi|254718948|ref|ZP_05180759.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           sp. 83/13]
 gi|256031440|ref|ZP_05445054.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           pinnipedialis M292/94/1]
 gi|256060949|ref|ZP_05451107.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           neotomae 5K33]
 gi|256159561|ref|ZP_05457328.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           ceti M490/95/1]
 gi|256254847|ref|ZP_05460383.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           ceti B1/94]
 gi|256369272|ref|YP_003106780.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           microti CCM 4915]
 gi|260168574|ref|ZP_05755385.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           sp. F5/99]
 gi|260566598|ref|ZP_05837068.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           suis bv. 4 str. 40]
 gi|261218800|ref|ZP_05933081.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           ceti M13/05/1]
 gi|261222029|ref|ZP_05936310.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           ceti B1/94]
 gi|261314410|ref|ZP_05953607.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           pinnipedialis M163/99/10]
 gi|261317494|ref|ZP_05956691.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           pinnipedialis B2/94]
 gi|261321701|ref|ZP_05960898.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           ceti M644/93/1]
 gi|261324951|ref|ZP_05964148.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           neotomae 5K33]
 gi|261754821|ref|ZP_05998530.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           suis bv. 3 str. 686]
 gi|261758047|ref|ZP_06001756.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           sp. F5/99]
 gi|265983938|ref|ZP_06096673.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           sp. 83/13]
 gi|265988529|ref|ZP_06101086.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           pinnipedialis M292/94/1]
 gi|265997993|ref|ZP_06110550.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           ceti M490/95/1]
 gi|294852196|ref|ZP_06792869.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           sp. NVSL 07-0026]
 gi|306838821|ref|ZP_07471652.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           sp. NF 2653]
 gi|306844063|ref|ZP_07476658.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           sp. BO1]
 gi|38258162|sp|Q8G178|PUR7_BRUSU RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|166229531|sp|A5VQ20|PUR7_BRUO2 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|189038238|sp|B0CLG9|PUR7_BRUSI RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|189038239|sp|A9MAL9|PUR7_BRUC2 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|23347655|gb|AAN29771.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           suis 1330]
 gi|148370111|gb|ABQ60090.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           ovis ATCC 25840]
 gi|161335617|gb|ABX61922.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           canis ATCC 23365]
 gi|163673838|gb|ABY37949.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           suis ATCC 23445]
 gi|225617339|gb|EEH14384.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           ceti str. Cudo]
 gi|239823993|gb|EEQ95561.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Ochrobactrum intermedium LMG 3301]
 gi|255999432|gb|ACU47831.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           microti CCM 4915]
 gi|260156116|gb|EEW91196.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           suis bv. 4 str. 40]
 gi|260920613|gb|EEX87266.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           ceti B1/94]
 gi|260923889|gb|EEX90457.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           ceti M13/05/1]
 gi|261294391|gb|EEX97887.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           ceti M644/93/1]
 gi|261296717|gb|EEY00214.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           pinnipedialis B2/94]
 gi|261300931|gb|EEY04428.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           neotomae 5K33]
 gi|261303436|gb|EEY06933.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           pinnipedialis M163/99/10]
 gi|261738031|gb|EEY26027.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           sp. F5/99]
 gi|261744574|gb|EEY32500.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           suis bv. 3 str. 686]
 gi|262552461|gb|EEZ08451.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           ceti M490/95/1]
 gi|264660726|gb|EEZ30987.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           pinnipedialis M292/94/1]
 gi|264662530|gb|EEZ32791.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           sp. 83/13]
 gi|294820785|gb|EFG37784.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           sp. NVSL 07-0026]
 gi|306275818|gb|EFM57542.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           sp. BO1]
 gi|306406105|gb|EFM62353.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Brucella
           sp. NF 2653]
          Length = 254

 Score =  281 bits (720), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 145/254 (57%), Positives = 192/254 (75%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTL+QFFKDD    N  +   ++GKGVLNNRISE++FTQ
Sbjct: 1   MNRRRRIYEGKAKILYEGPEPGTLVQFFKDDATAFNAKKHEVIDGKGVLNNRISEHIFTQ 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IGIP +FIRR+NMREQL+++VE+IPL + VRN AAGSLAKRL + EG  LPRS++EF
Sbjct: 61  LNRIGIPTHFIRRLNMREQLIKEVEIIPLEVVVRNVAAGSLAKRLGLEEGTILPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  +V+EEHITAF WA+  E++++ AL+IR+NDF+TGLFLGI IQLVDF+++C
Sbjct: 121 YYKADALDDPMVTEEHITAFGWASPQEIDDIMALAIRVNDFLTGLFLGIGIQLVDFKMEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RIV+ADEI PD  RLWD++  ++ DK RF +    L+E Y EVARRLGI  
Sbjct: 181 GRLWEGDMMRIVVADEISPDSARLWDITTNDKLDKDRFRRDMGGLVEAYQEVARRLGIMN 240

Query: 241 KNEPALKENLILNR 254
           +N+        L +
Sbjct: 241 ENDTPRPSGPTLVK 254


>gi|294677692|ref|YP_003578307.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacter capsulatus SB 1003]
 gi|294476512|gb|ADE85900.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacter capsulatus SB 1003]
          Length = 253

 Score =  281 bits (720), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 128/249 (51%), Positives = 181/249 (72%)

Query: 3   PRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLG 62
            R  +YE K KI+YEG EPGTL+Q+FKDD    N  + AT+ GKGVLNNR+SE+  T L 
Sbjct: 4   RRKKIYEGKAKILYEGPEPGTLVQYFKDDATAFNAQKKATIEGKGVLNNRLSEFFMTGLT 63

Query: 63  KIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYY 122
            +GIP++FIRR+NMREQL+R VE++PL + VRN AAGS++KRL I EG +LPR +VE+ Y
Sbjct: 64  NVGIPNHFIRRLNMREQLIRQVEVVPLEVIVRNFAAGSISKRLGIEEGTALPRPIVEYSY 123

Query: 123 LPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGR 182
             D+    LV EE+I AF WANQ +++++ +L++R+NDF++G+F G+ I+L+DF+I+ GR
Sbjct: 124 KNDALGDPLVPEEYIIAFGWANQQDLDDIVSLALRVNDFLSGVFFGVGIKLIDFKIEIGR 183

Query: 183 LLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKKN 242
           + D D +R+++ADEI PD CRLWD+   ++ DK  F +    L + Y+EVARRLG+   N
Sbjct: 184 IWDGDFMRLIVADEISPDSCRLWDVKTGQKLDKDVFRRDLGSLTDAYTEVARRLGVMPAN 243

Query: 243 EPALKENLI 251
              +K  LI
Sbjct: 244 ATPMKPTLI 252


>gi|319898860|ref|YP_004158953.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Bartonella
           clarridgeiae 73]
 gi|319402824|emb|CBI76375.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Bartonella
           clarridgeiae 73]
          Length = 254

 Score =  281 bits (720), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 141/254 (55%), Positives = 187/254 (73%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R+ +YE K KI+YEG EPGT IQFFKDD    N  +   ++GKGVLNNRISEY+FTQ
Sbjct: 1   MNRRHRIYEGKAKILYEGPEPGTYIQFFKDDATAFNAKKHEIIDGKGVLNNRISEYIFTQ 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG++GIP +FI+RINMREQL++ VE+IPL I VRN  AGSL+KRL + EG +LP+S++EF
Sbjct: 61  LGRLGIPTHFIKRINMREQLIKAVEIIPLEIVVRNIVAGSLSKRLGLEEGTALPQSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  +V+EEHI AF WA   EVE++  LS RINDF++GLF G+ IQLVDF+++ 
Sbjct: 121 YYKNDALDDPMVTEEHIVAFGWATPQEVEDIMQLSFRINDFLSGLFTGVGIQLVDFKMEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL   +++R+VLADEI PD  RLWD+  +E+ DK RF +    L++ Y +VARRLGI  
Sbjct: 181 GRLWIGEMMRVVLADEISPDSSRLWDMQTQEKLDKDRFRRDMGGLIDAYQDVARRLGIMN 240

Query: 241 KNEPALKENLILNR 254
           +NEP      +L +
Sbjct: 241 ENEPPRPSGPVLVK 254


>gi|119385586|ref|YP_916641.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Paracoccus denitrificans PD1222]
 gi|119376181|gb|ABL70945.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Paracoccus denitrificans PD1222]
          Length = 254

 Score =  281 bits (720), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 129/251 (51%), Positives = 180/251 (71%)

Query: 3   PRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLG 62
            R  +YE K KI+YEG EPGTLIQ+FKDD    N  + AT+ GKGVLNNR+SE+  T L 
Sbjct: 4   RRKKIYEGKAKILYEGTEPGTLIQYFKDDATAFNAQKKATIEGKGVLNNRLSEFFMTGLT 63

Query: 63  KIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYY 122
            IG+P++FIRRINMREQLVR VE+IPL + VRN AAGS++KRL + EG  LPR +VE+ +
Sbjct: 64  NIGVPNHFIRRINMREQLVRQVEIIPLEVIVRNFAAGSISKRLGMEEGTPLPRPIVEYSF 123

Query: 123 LPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGR 182
             D      VSEE+I AF WA Q +++++ +L++R+NDF++G+F G+ I+L+DF+I+ GR
Sbjct: 124 KNDELGDPFVSEEYIIAFGWAAQQDLDDIVSLALRVNDFLSGVFFGVGIKLIDFKIEVGR 183

Query: 183 LLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKKN 242
           + D D +R+V+ADEI PD CRLWD+   ++ DK  F +    L + Y+EVARRLG+   N
Sbjct: 184 IWDGDFMRLVVADEISPDSCRLWDVKTGQKLDKDVFRRDLGNLTDAYTEVARRLGLMPAN 243

Query: 243 EPALKENLILN 253
             +L +  ++N
Sbjct: 244 TTSLTKPTLIN 254


>gi|328543201|ref|YP_004303310.1| phosphoribosylaminoimidazole-succinocarboxamide synthase A
           [polymorphum gilvum SL003B-26A1]
 gi|326412947|gb|ADZ70010.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase A
           [Polymorphum gilvum SL003B-26A1]
          Length = 254

 Score =  281 bits (720), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 145/254 (57%), Positives = 186/254 (73%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQ FKDD    N  +   ++GKGVLNNRISE++F Q
Sbjct: 1   MNRRRRIYEGKGKILYEGPEPGTLIQHFKDDATAFNAKKHEIVDGKGVLNNRISEFIFNQ 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  +GIP +FIRR+NMREQL+R+VE+IPL + VRN AAGSL+KRL + EG  LPRS++EF
Sbjct: 61  LNGMGIPTHFIRRMNMREQLIREVEIIPLEVVVRNVAAGSLSKRLGLEEGTQLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA   E++++ AL+IR+NDF++GLFLG+ I+LVDF+I+C
Sbjct: 121 YYKNDELGDPMVSEEHITAFGWATPQELDDIMALAIRVNDFLSGLFLGVGIRLVDFKIEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RIV+ADEI PD CRLWD++  E+ DK RF +    LLE Y EVARRLGI  
Sbjct: 181 GRLFEGDMMRIVVADEISPDSCRLWDIATNEKMDKDRFRRDMGGLLEAYQEVARRLGILN 240

Query: 241 KNEPALKENLILNR 254
            N+        L +
Sbjct: 241 DNDRPTGSGPTLVK 254


>gi|323137164|ref|ZP_08072243.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylocystis sp. ATCC 49242]
 gi|322397522|gb|EFY00045.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylocystis sp. ATCC 49242]
          Length = 264

 Score =  281 bits (720), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 140/244 (57%), Positives = 186/244 (76%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   ++GKGVLNNRISEY+F  
Sbjct: 11  MNRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHEVIDGKGVLNNRISEYIFQH 70

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE+IPL + VRN AAGSLAKRL + EG  LPRS++EF
Sbjct: 71  LNNIGVPTHFIRRLNMREQLIREVEIIPLEVVVRNVAAGSLAKRLGLEEGTQLPRSIIEF 130

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  +VSEEHITAF WA   E++++ AL+IR+NDF++GLFLG+ I+LVDF+++C
Sbjct: 131 YYKNDALDDPMVSEEHITAFGWATPQEIDDIMALAIRVNDFLSGLFLGVGIRLVDFKMEC 190

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RIV+ADEI PD CRLWD+   ++ DK RF +    L+E Y+EVARRLG+ +
Sbjct: 191 GRLWEGDMMRIVVADEISPDSCRLWDIKSNDKLDKDRFRRDMGGLVEAYTEVARRLGVMQ 250

Query: 241 KNEP 244
           + E 
Sbjct: 251 EGET 254


>gi|148259410|ref|YP_001233537.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidiphilium cryptum JF-5]
 gi|326402636|ref|YP_004282717.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidiphilium multivorum AIU301]
 gi|166229527|sp|A5FVI6|PUR7_ACICJ RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|146401091|gb|ABQ29618.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidiphilium cryptum JF-5]
 gi|325049497|dbj|BAJ79835.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidiphilium multivorum AIU301]
          Length = 254

 Score =  281 bits (719), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 134/244 (54%), Positives = 181/244 (74%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI++EG EPGTL+Q+FKDD    N  +   + GKGVLNNRISE++  +
Sbjct: 1   MARRRQLYEGKAKILFEGPEPGTLVQYFKDDATAFNAQKKGVITGKGVLNNRISEFLMQR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+IGIP +F+RR+NMREQLVR+VE+IP+ + +RN AAGS++ RL IPEG  LPRS++E+
Sbjct: 61  LGEIGIPTHFVRRLNMREQLVREVEIIPIEVVIRNVAAGSMSTRLGIPEGTRLPRSIIEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    +VSE+HITAF WA+  +++++  LS+RINDF+TGLFLG+ I LVDF+I+ 
Sbjct: 121 YYKNDALNDPMVSEDHITAFGWASTQDMDDIVHLSLRINDFLTGLFLGVGIVLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL ++D +RIVLADEI PD CRLWD    E+ DK RF +   ++ E Y EVA+RLGI  
Sbjct: 181 GRLWENDDMRIVLADEISPDNCRLWDAKTNEKMDKDRFRRDLGRVEEAYQEVAKRLGILP 240

Query: 241 KNEP 244
           +   
Sbjct: 241 EAGT 244


>gi|159043625|ref|YP_001532419.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Dinoroseobacter shibae DFL 12]
 gi|189038233|sp|A8LSK4|PUR7_DINSH RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|157911385|gb|ABV92818.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Dinoroseobacter shibae DFL 12]
          Length = 253

 Score =  281 bits (719), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 134/253 (52%), Positives = 185/253 (73%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGT++Q+FKDD    N  + AT++GKGVLNNR+SE+  T 
Sbjct: 1   MARRKKIYEGKAKILYEGPEPGTIVQYFKDDATAFNAEKRATIDGKGVLNNRLSEFFMTG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FI+R+NMREQLVR VE+IP+ I VRNTAAGS++KRL IPEG +LPR +VEF
Sbjct: 61  LNGIGVPTHFIKRLNMREQLVRAVEIIPIEIVVRNTAAGSISKRLGIPEGTALPRPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHI AF WA+Q ++++M AL++R+NDFM+G+ L + I+LVDF+I+ 
Sbjct: 121 YYKDDDLGDPIVSEEHIIAFQWASQQDLDDMVALALRVNDFMSGVMLSVGIKLVDFKIEV 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ + D  R+++ADEI PD CRLWD+   E+ DK  F +    L + Y+EVA+RLG+  
Sbjct: 181 GRVFEGDYQRLIVADEISPDSCRLWDIKTGEKLDKDVFRRDLGNLADAYTEVAQRLGVLP 240

Query: 241 KNEPALKENLILN 253
           KN   + +  ++N
Sbjct: 241 KNATPMTKPTLIN 253


>gi|188579830|ref|YP_001923275.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylobacterium populi BJ001]
 gi|179343328|gb|ACB78740.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylobacterium populi BJ001]
          Length = 264

 Score =  281 bits (719), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 139/243 (57%), Positives = 183/243 (75%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   ++GKGVLNNRISE++F  
Sbjct: 11  MNRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHEVIDGKGVLNNRISEFVFQH 70

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE+IPL + VRN AAGSLA+RL + EG  LPRS++EF
Sbjct: 71  LNDIGVPTHFIRRLNMREQLIREVEIIPLEVVVRNVAAGSLAQRLGLEEGTQLPRSIIEF 130

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA   E++++ AL+IR+NDF++GLFLG+ I+LVDF+++ 
Sbjct: 131 YYKNDQLNDPMVSEEHITAFGWATPQEIDDIMALAIRVNDFLSGLFLGVGIRLVDFKMET 190

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RIV+ADEI PD CRLWD+   ++ DK RF K    L+E Y+EVA+RLGI  
Sbjct: 191 GRLWEGDLMRIVVADEISPDSCRLWDIKSSDKLDKDRFRKDLGGLIEAYTEVAKRLGIMS 250

Query: 241 KNE 243
           +NE
Sbjct: 251 ENE 253


>gi|170749887|ref|YP_001756147.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylobacterium radiotolerans JCM 2831]
 gi|170656409|gb|ACB25464.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylobacterium radiotolerans JCM 2831]
          Length = 264

 Score =  281 bits (719), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 139/243 (57%), Positives = 183/243 (75%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   ++GKGVLNNRISE++F  
Sbjct: 11  MNRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHEVIDGKGVLNNRISEFVFQH 70

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE+IPL + VRN AAGSLA RL + EG  LPRS++EF
Sbjct: 71  LNDIGVPTHFIRRLNMREQLIREVEIIPLEVVVRNVAAGSLATRLGLEEGTQLPRSIIEF 130

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    +VSEEHITAF WA   E++++ AL+IR+NDF++GLFLG+ I+LVDF+++ 
Sbjct: 131 YYKNDALNDPMVSEEHITAFGWATPQEIDDIMALAIRVNDFLSGLFLGVGIRLVDFKMET 190

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RIV+ADEI PD CRLWD+   ++ DK RF K    L+E Y+EVA+RLGI  
Sbjct: 191 GRLWEGDMMRIVVADEISPDSCRLWDIKSSDKLDKDRFRKDLGGLIEAYTEVAKRLGIMS 250

Query: 241 KNE 243
           +NE
Sbjct: 251 ENE 253


>gi|260433836|ref|ZP_05787807.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417664|gb|EEX10923.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Silicibacter lacuscaerulensis ITI-1157]
          Length = 251

 Score =  281 bits (719), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 128/253 (50%), Positives = 179/253 (70%), Gaps = 2/253 (0%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGT++Q+FKDD    N  +   + GKGVLNNR+SE+  T 
Sbjct: 1   MARRKKIYEGKAKILYEGPEPGTIVQYFKDDATAFNAEKKDVIEGKGVLNNRLSEFFMTG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IG+P +FIRR+NMREQLVR  E+IPL + VRN AAGSL+KRL I EG  LPR +VE+
Sbjct: 61  LSQIGVPTHFIRRLNMREQLVRSCEIIPLEVIVRNYAAGSLSKRLGIAEGTQLPRPIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  DS    LV+EEHI AF WA+Q +++++ +L++R+NDFM+G+ L + I+LVDF+I+ 
Sbjct: 121 CYKDDSLGDPLVTEEHIAAFGWASQQDMDDILSLALRVNDFMSGVMLAVGIRLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ + D  R+++ADEI PD CRLWD+   ++ DK  F +    L + YSEVARRLG+  
Sbjct: 181 GRVYEGDFQRLIVADEISPDSCRLWDIETGQKLDKDVFRRDLGSLTDAYSEVARRLGVLP 240

Query: 241 KNEPALKENLILN 253
           K+   + +  ++N
Sbjct: 241 KS--NVTKPTLIN 251


>gi|114798983|ref|YP_761294.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Hyphomonas neptunium ATCC 15444]
 gi|122942214|sp|Q0BYZ9|PUR7_HYPNA RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|114739157|gb|ABI77282.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Hyphomonas neptunium ATCC 15444]
          Length = 259

 Score =  281 bits (719), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 139/248 (56%), Positives = 178/248 (71%), Gaps = 2/248 (0%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQ+FKDD    +  + A L+GKGVLNNRISE++ T 
Sbjct: 1   MNKRRVIYEGKAKILYEGPEPGTLIQYFKDDTTAFDATKKAVLDGKGVLNNRISEFIMTH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  +G+P++FIRR+NMREQLVR V++IPL + VRN AAGSL+ RL IPEG SLPR LVEF
Sbjct: 61  LTSVGVPNHFIRRLNMREQLVRKVDIIPLEVVVRNIAAGSLSTRLGIPEGQSLPRPLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D+    +VSEEHI AF WA   E +++ AL++R+NDFM+GLF G  I+LVDF+I+ 
Sbjct: 121 YFKNDALHDPMVSEEHIAAFGWATAQEYDDIIALALRVNDFMSGLFAGAGIRLVDFKIEF 180

Query: 181 GRLL--DDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR    D D+ RI+LADEI PD CRLWD    E+ DK RF +    + E Y+EVARRLGI
Sbjct: 181 GRWFENDHDMPRILLADEISPDSCRLWDAKTGEKMDKDRFRRDMGGVTEAYAEVARRLGI 240

Query: 239 FKKNEPAL 246
            +++    
Sbjct: 241 IRESGEET 248


>gi|240850730|ref|YP_002972130.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Bartonella
           grahamii as4aup]
 gi|240267853|gb|ACS51441.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Bartonella
           grahamii as4aup]
          Length = 254

 Score =  281 bits (719), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 142/254 (55%), Positives = 189/254 (74%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R+ +YE K KI+YEG EPGT IQFFKDD    N  +   ++GKGVLNNRISE++F+ 
Sbjct: 1   MNRRHRIYEGKAKILYEGPEPGTYIQFFKDDATAFNAKKHEIIDGKGVLNNRISEHIFSH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG++GIP +FI+RINMREQL++ VE+IPL + VRN AAGSLAKRL + EG  LP+S++EF
Sbjct: 61  LGRLGIPTHFIKRINMREQLIKAVEIIPLEVVVRNVAAGSLAKRLGLEEGTPLPQSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  DS +  +V+EEHITAF WA   E+E++  LSIR+NDF++GLF G+NIQL+DF+++ 
Sbjct: 121 YYKNDSLDDPMVTEEHITAFGWAVPQEIEDIMQLSIRVNDFLSGLFAGVNIQLIDFKMEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL +D+ +RIVLADEI PD  RLWD+  +E+ DK RF +    L+  Y EVA+RLGI  
Sbjct: 181 GRLWEDETMRIVLADEISPDSARLWDMHTQEKMDKDRFRRDMGGLINAYQEVAKRLGIMN 240

Query: 241 KNEPALKENLILNR 254
           +NEP      +L +
Sbjct: 241 ENEPTRPSGPVLVK 254


>gi|163850029|ref|YP_001638072.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylobacterium extorquens PA1]
 gi|218528632|ref|YP_002419448.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylobacterium chloromethanicum CM4]
 gi|254559175|ref|YP_003066270.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Methylobacterium extorquens DM4]
 gi|163661634|gb|ABY29001.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylobacterium extorquens PA1]
 gi|218520935|gb|ACK81520.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylobacterium chloromethanicum CM4]
 gi|254266453|emb|CAX22217.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase (SAICAR
           synthetase) [Methylobacterium extorquens DM4]
          Length = 264

 Score =  281 bits (719), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 139/243 (57%), Positives = 182/243 (74%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    N  +   ++GKGVLNNRISE++F  
Sbjct: 11  MNRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHEVIDGKGVLNNRISEFVFQH 70

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R+VE+IPL + VRN AAGSLA RL + EG  LPRS++EF
Sbjct: 71  LNDIGVPTHFIRRLNMREQLIREVEIIPLEVVVRNVAAGSLATRLGLEEGTQLPRSIIEF 130

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA   E++++ AL+IR+NDF++GLFLG+ I+LVDF+++ 
Sbjct: 131 YYKNDQLNDPMVSEEHITAFGWATPQEIDDIMALAIRVNDFLSGLFLGVGIRLVDFKMET 190

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RIV+ADEI PD CRLWD+   ++ DK RF K    L+E Y+EVA+RLGI  
Sbjct: 191 GRLWEGDLMRIVVADEISPDSCRLWDIKSSDKLDKDRFRKDLGGLIEAYTEVAKRLGIMS 250

Query: 241 KNE 243
           +NE
Sbjct: 251 ENE 253


>gi|83951577|ref|ZP_00960309.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseovarius nubinhibens ISM]
 gi|83836583|gb|EAP75880.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseovarius nubinhibens ISM]
          Length = 253

 Score =  281 bits (719), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 118/253 (46%), Positives = 173/253 (68%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +YEG EPGT++Q+FKDD    N  +   + GKGVLNN +SEY  T 
Sbjct: 1   MARRKKIYEGKAKTLYEGPEPGTIVQYFKDDATAFNAEKKDVIEGKGVLNNILSEYFMTG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FI+R+NMREQLVR  E++PL + VRN AAG++AKRL + EG  LPR +VE+
Sbjct: 61  LNNIGVPTHFIKRLNMREQLVRACEIVPLEVIVRNYAAGTMAKRLGMDEGTQLPRPIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
               D     LV+EEHI AF WA+Q +++++ +L++R+NDF+ G+  G+ I+L+DF+I+ 
Sbjct: 121 CLKDDKLGDPLVTEEHIAAFGWASQQDMDDILSLALRVNDFLAGVMYGVGIKLIDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D D +R+++ADEI PD CRLWD+   ++ DK  F +    L + Y+EVA+RLG+  
Sbjct: 181 GRVYDGDFMRLIVADEISPDSCRLWDIETGQKLDKDVFRRDLGSLTDAYTEVAKRLGVLP 240

Query: 241 KNEPALKENLILN 253
           K    + +  ++N
Sbjct: 241 KGATPMAKPTLIN 253


>gi|163868498|ref|YP_001609707.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bartonella tribocorum CIP 105476]
 gi|189038240|sp|A9IVH1|PUR7_BART1 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|161018154|emb|CAK01712.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Bartonella
           tribocorum CIP 105476]
          Length = 254

 Score =  281 bits (718), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 143/254 (56%), Positives = 189/254 (74%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R+ +YE K KI+YEG EPGT IQFFKDD    N  +   ++GKGVLNNRISE++F+ 
Sbjct: 1   MNRRHRIYEGKAKILYEGPEPGTYIQFFKDDATAFNAKKHEIIDGKGVLNNRISEHIFSH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG++GIP +FI+RINMREQL++ VE+IPL + VRN AAGSLAKRL + EG  LP+S++EF
Sbjct: 61  LGRLGIPTHFIKRINMREQLIKAVEIIPLEVVVRNVAAGSLAKRLGLEEGAPLPQSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  DS +  +V+EEHITAF WA   E+E++  LSIRINDF++GLF G+NIQL+DF+++ 
Sbjct: 121 YYKNDSLDDPMVTEEHITAFGWAVPQEIEDIMQLSIRINDFLSGLFAGVNIQLIDFKMEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL +D+ +RIVLADEI PD  RLWD+  +E+ DK RF +    L+  Y EVA+RLGI  
Sbjct: 181 GRLWEDETMRIVLADEISPDSARLWDMQTREKMDKDRFRRDMGGLINAYQEVAKRLGIMN 240

Query: 241 KNEPALKENLILNR 254
           +NEP      +L +
Sbjct: 241 ENEPIRPSGPVLVK 254


>gi|319407193|emb|CBI80832.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Bartonella
           sp. 1-1C]
          Length = 254

 Score =  280 bits (717), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 141/254 (55%), Positives = 185/254 (72%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R+ +YE K KI+YEG E GT IQFFKDD    N  +   ++GKGVLNNRISEY+FTQ
Sbjct: 1   MNRRHRIYEGKAKILYEGPELGTYIQFFKDDATAFNAKKHEIIDGKGVLNNRISEYIFTQ 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG++GIP +FI+RINMREQL++ VE+IPL + VRN  AGSL+KRL + EG +LP+S++EF
Sbjct: 61  LGRLGIPTHFIKRINMREQLIKAVEIIPLEVVVRNIVAGSLSKRLGLEEGTALPQSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  +V+EEHI AF WA   EVE++  LS RINDF++GLF G+ IQLVDF+++ 
Sbjct: 121 YYKNDALDDPMVTEEHIVAFGWAAPQEVEDIMQLSFRINDFLSGLFAGVGIQLVDFKVEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL   + +RIVLADEI PD  RLWD+  KE+ DK RF +    L++ Y +VARRLGI  
Sbjct: 181 GRLWTGETMRIVLADEISPDSSRLWDIQTKEKLDKDRFRRDMGGLIDAYQDVARRLGIMN 240

Query: 241 KNEPALKENLILNR 254
           +NEP      +L +
Sbjct: 241 ENEPPRPSGPVLVK 254


>gi|310815573|ref|YP_003963537.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Ketogulonicigenium vulgare Y25]
 gi|308754308|gb|ADO42237.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Ketogulonicigenium vulgare Y25]
          Length = 253

 Score =  280 bits (717), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 127/253 (50%), Positives = 176/253 (69%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTL+Q+FKDD    N  + A + GKGVLNNR+SE+    
Sbjct: 1   MARRKKIYEGKAKILYEGPEPGTLVQYFKDDATAFNAQKKAVIEGKGVLNNRLSEFFMLG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  +GIP +FI+R+NMREQLVR VE++PL + VRN AAGS+AKRL + EG+ LPR +VEF
Sbjct: 61  LQGVGIPTHFIKRLNMREQLVRQVEIVPLEVIVRNFAAGSMAKRLGLEEGMPLPRPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    LV EE+I AF WA Q E++++ AL++R+NDF++G+F G+ I+L+DF+I+ 
Sbjct: 121 SYKNDALGDPLVPEEYIIAFGWAQQQELDDIVALALRVNDFLSGVFHGVGIRLIDFKIEM 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ ++D  R+V+ADEI PD CRLWD+    + DK  F +    L + Y+EVARRLG+  
Sbjct: 181 GRIWENDFPRLVIADEISPDSCRLWDIETGRKLDKDVFRQDLGSLSDAYTEVARRLGVLP 240

Query: 241 KNEPALKENLILN 253
            N        ++N
Sbjct: 241 SNVTHNANGTMIN 253


>gi|296532424|ref|ZP_06895151.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Roseomonas cervicalis ATCC 49957]
 gi|296267267|gb|EFH13165.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Roseomonas cervicalis ATCC 49957]
          Length = 281

 Score =  280 bits (717), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 138/254 (54%), Positives = 189/254 (74%), Gaps = 1/254 (0%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K+++EG EPGTL+Q+FKDD    N  +   + GKGVLNNRISEY+ T+
Sbjct: 28  MARRRQLYEGKAKVLFEGPEPGTLVQYFKDDASAGNGAKKGIITGKGVLNNRISEYLMTR 87

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+IG+P +FIRR+NMREQL+R+VE+IPL + VRN AAGSLA RL + EG  LPRS+VE+
Sbjct: 88  LGEIGVPTHFIRRLNMREQLIREVEIIPLELVVRNVAAGSLATRLGLQEGTRLPRSIVEY 147

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  +VSEEHIT F WA+  ++++M AL++R+NDF++GLFLG+ I LVDF+++ 
Sbjct: 148 YYKNDALQDPMVSEEHITCFGWASTQDLDDMVALALRVNDFLSGLFLGVGIVLVDFKLEF 207

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL ++D +RIVLADEI PD CRLWD++  E+ DK RF +   ++ EGY EVARRLGI  
Sbjct: 208 GRLYENDEMRIVLADEISPDNCRLWDVNTGEKMDKDRFRRDLGKVEEGYQEVARRLGILP 267

Query: 241 KNEP-ALKENLILN 253
           +     +K   ++ 
Sbjct: 268 EAGIRDMKGPEVMQ 281


>gi|254470554|ref|ZP_05083958.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudovibrio sp. JE062]
 gi|211960865|gb|EEA96061.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudovibrio sp. JE062]
          Length = 254

 Score =  280 bits (717), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 141/254 (55%), Positives = 183/254 (72%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQ FKDD    NN +   ++GKGVLNNRISEY+F  
Sbjct: 1   MNRRRRIYEGKAKILYEGPEPGTLIQHFKDDATAFNNEKHEVVDGKGVLNNRISEYIFNN 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  +GIP +FIRR+NMREQL+R VE+IP+ + +RN AAGSL KRL + EG  LPRS++EF
Sbjct: 61  LNNMGIPTHFIRRLNMREQLIRQVEIIPIEVVIRNVAAGSLCKRLGLEEGTQLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     LVSEEHITAF WA   E++++ AL+IRINDF++GLF+ + I+LVDF+I+ 
Sbjct: 121 YYKNDELGDPLVSEEHITAFGWAAPQELDDIMALAIRINDFLSGLFMSVGIRLVDFKIEL 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR ++ D++RIVLADEI PD CRLWD S  ++ DK RF ++   ++E Y EVARRLGI  
Sbjct: 181 GRQIEGDMMRIVLADEISPDSCRLWDTSTNDKMDKDRFRQNMGGMVEAYQEVARRLGILI 240

Query: 241 KNEPALKENLILNR 254
            N+       +L +
Sbjct: 241 DNDRPGHSGPVLVK 254


>gi|116252352|ref|YP_768190.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|241204855|ref|YP_002975951.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|115257000|emb|CAK08094.1| putative phosphoribosylaminoimidazole-succinocarboxamide synthase
           (ec 6.3.2.6) (saicar synthetase) [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|240858745|gb|ACS56412.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 254

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 157/254 (61%), Positives = 195/254 (76%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQFFKDD    N  +   ++GKGVLNNRI EY+F+ 
Sbjct: 1   MNRRRRIYEGKAKILYEGPEPGTLIQFFKDDATAFNKKKHEVIDGKGVLNNRICEYIFSH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L KIGIP +FIRR+NMREQL+++VEMIPL I VRN AAGSLAKRL I EG+ LPRS++EF
Sbjct: 61  LNKIGIPTHFIRRLNMREQLIKEVEMIPLEIVVRNVAAGSLAKRLGIDEGVVLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  +VSEEHITAF WAN +E++++ AL+IR+NDFMTGLFLG+ IQLVDF+I+C
Sbjct: 121 YYKSDALDDPMVSEEHITAFGWANPAELDDIMALAIRVNDFMTGLFLGVGIQLVDFKIEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RI+LADEI PD CRLWD+   E+ DK RF +    LLE YSEVARRLGI  
Sbjct: 181 GRLFEGDMMRIILADEISPDSCRLWDIETHEKMDKDRFRRDLGGLLEAYSEVARRLGIIN 240

Query: 241 KNEPALKENLILNR 254
           +NEP      +L +
Sbjct: 241 ENEPVRGTGPVLVK 254


>gi|326388970|ref|ZP_08210552.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Novosphingobium nitrogenifigens DSM 19370]
 gi|326206570|gb|EGD57405.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Novosphingobium nitrogenifigens DSM 19370]
          Length = 261

 Score =  280 bits (716), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 137/256 (53%), Positives = 185/256 (72%), Gaps = 1/256 (0%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQ+FKDD    N  +  T+NGKGV+NNRISEY+FT+
Sbjct: 1   MSRRRQIYEGKAKILYEGPEPGTLIQYFKDDATAFNAQKRGTINGKGVINNRISEYVFTR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IGIP +FIRR+NMREQLVR VE+IP+ + VRN AAGS++KRL IPEG  LP +L+E+
Sbjct: 61  LAHIGIPTHFIRRLNMREQLVRQVEIIPIEVVVRNVAAGSISKRLGIPEGEPLPHTLIEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    +V+EEHI  F WAN  E++++++++IR+NDFM G+F  I I+L+DF+++ 
Sbjct: 121 YYKDDALGDPMVAEEHIACFGWANNEEMQDISSMAIRVNDFMCGMFATIGIRLIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF- 239
           GR+ D D  R++LADEI PD CRLWD++  E+ DK RF +      E Y EVARRLG+  
Sbjct: 181 GRIWDGDYSRVILADEISPDGCRLWDMATGEKLDKDRFRRDLGGEEEAYQEVARRLGLLD 240

Query: 240 KKNEPALKENLILNRK 255
            +  P+   +L  +RK
Sbjct: 241 NEGGPSEVLDLGAHRK 256


>gi|89069861|ref|ZP_01157195.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oceanicola granulosus HTCC2516]
 gi|89044537|gb|EAR50656.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oceanicola granulosus HTCC2516]
          Length = 253

 Score =  280 bits (716), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 130/253 (51%), Positives = 179/253 (70%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTL+Q+FKDD    N  + A + GKGVLNNR+SE+  T 
Sbjct: 1   MARRKKIYEGKAKILYEGPEPGTLVQYFKDDATANNAEKQAVIEGKGVLNNRLSEFFMTG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG +GIP +FIRR+NMREQLVR VE+IPL + VRN AAGS+AKRL + EG +LPR ++EF
Sbjct: 61  LGNVGIPTHFIRRLNMREQLVRQVEIIPLEVIVRNFAAGSMAKRLGLEEGTALPRPIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     LV EE++ AF WA Q +++++ AL++R+NDFM+G+  G+ I+LVDF+I+ 
Sbjct: 121 SYKDDKLGDPLVPEEYVIAFGWATQQDLDDIVALALRVNDFMSGVMFGVGIKLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D+D  R+V+ADEI PD CRLWD+   ++ DK  F +    L + Y+EVARRLG+  
Sbjct: 181 GRIWDNDYQRLVVADEISPDSCRLWDMETGQKLDKDVFRRDLGSLTDAYTEVARRLGVMP 240

Query: 241 KNEPALKENLILN 253
            N   + +  ++N
Sbjct: 241 SNATHMPKPTLIN 253


>gi|222086131|ref|YP_002544663.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Agrobacterium radiobacter K84]
 gi|221723579|gb|ACM26735.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Agrobacterium radiobacter K84]
          Length = 254

 Score =  280 bits (716), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 157/254 (61%), Positives = 195/254 (76%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQFFKDD    N  +   ++GKGVLNNRI EY+F+ 
Sbjct: 1   MNRRRRIYEGKAKILYEGPEPGTLIQFFKDDATAFNKKKHEVIDGKGVLNNRICEYIFSH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L KIGIP +FIRR+NMREQL+++VEMIPL I VRN AAGSLAKRL I EG+ LPRS++EF
Sbjct: 61  LNKIGIPTHFIRRLNMREQLIKEVEMIPLEIVVRNVAAGSLAKRLGIEEGVVLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ E  +VSEEHITAF WAN +E++++ AL+IR+NDFMTGLFLG+ IQLVDF+I+C
Sbjct: 121 YYKSDALEDPMVSEEHITAFGWANPAELDDIMALAIRVNDFMTGLFLGVGIQLVDFKIEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RI+LADEI PD CRLWD+   E+ DK RF +    L+E YSEVARRLGI  
Sbjct: 181 GRLFEGDMMRIILADEISPDSCRLWDIETHEKMDKDRFRRDMGGLVEAYSEVARRLGIIN 240

Query: 241 KNEPALKENLILNR 254
           +NEP      +L +
Sbjct: 241 ENEPVRGTGPVLVK 254


>gi|114569583|ref|YP_756263.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Maricaulis maris MCS10]
 gi|122316369|sp|Q0AQW2|PUR7_MARMM RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|114340045|gb|ABI65325.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Maricaulis maris MCS10]
          Length = 258

 Score =  280 bits (716), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 138/243 (56%), Positives = 180/243 (74%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGT++Q+FKDD    NN + ATL GKGVLNNRISE++   
Sbjct: 1   MSRRKMIYEGKAKILYEGPEPGTIVQYFKDDATAFNNQKKATLEGKGVLNNRISEHIMLG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+IGIP +F++R+NMREQLVR VE+IPL +  RN AAGS++ RL +PEG  LPRS+VEF
Sbjct: 61  LGRIGIPTHFLKRLNMREQLVRQVEIIPLEVVCRNVAAGSISTRLGVPEGDQLPRSIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     ++SEEHITAFNWA   E+++M A+++R+NDF+ GLF G  I+LVDF+++ 
Sbjct: 121 YYKKDELGDPMISEEHITAFNWATHQEIDDMMAMTLRVNDFLCGLFTGAGIRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR  + D++R VLADEI PD CRLWDL   E+ DK RF +    + E Y+EVARRLGI K
Sbjct: 181 GRHYEGDMVRTVLADEISPDSCRLWDLETNEKMDKDRFRRDMGNVTEAYAEVARRLGIMK 240

Query: 241 KNE 243
           ++ 
Sbjct: 241 ESG 243


>gi|114707064|ref|ZP_01439963.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fulvimarina pelagi HTCC2506]
 gi|114537614|gb|EAU40739.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fulvimarina pelagi HTCC2506]
          Length = 254

 Score =  280 bits (716), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 146/254 (57%), Positives = 192/254 (75%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTL+QFFKDD    N  +   ++GKGVLNNRISEY+F  
Sbjct: 1   MTRRRRIYEGKGKILYEGPEPGTLVQFFKDDATAFNKKKHEIVDGKGVLNNRISEYIFGH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K+GIP +FI+R+NMREQL+++VE+IPL + VRN AAGSLAKRL I EG  LPRS++EF
Sbjct: 61  LNKMGIPTHFIKRLNMREQLIKEVEIIPLEVVVRNIAAGSLAKRLGIEEGTVLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D  +  +VSEEHITAF WA+  E++++ AL+IR+NDF++GLFLG+ IQL+DF+I+ 
Sbjct: 121 YYKADQLDDPMVSEEHITAFGWASPQEIDDIMALAIRVNDFLSGLFLGVGIQLIDFKIET 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RIV+ADEI PD CRLWD++ +E+ DK RF +    L+E Y EVARRLGI  
Sbjct: 181 GRLFEGDMMRIVVADEISPDSCRLWDINTQEKMDKDRFRRDMGGLVEAYQEVARRLGIMN 240

Query: 241 KNEPALKENLILNR 254
           +NEP      +L +
Sbjct: 241 ENEPPRPSGPVLVK 254


>gi|87199063|ref|YP_496320.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Novosphingobium aromaticivorans DSM 12444]
 gi|123490129|sp|Q2G9I7|PUR7_NOVAD RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|87134744|gb|ABD25486.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Novosphingobium aromaticivorans DSM 12444]
          Length = 261

 Score =  280 bits (715), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 134/256 (52%), Positives = 182/256 (71%), Gaps = 1/256 (0%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQ+FKDD    N  +  T+NGKGV+NNRISEY+FT+
Sbjct: 1   MSRRRQIYEGKAKILYEGPEPGTLIQYFKDDATAFNAQKRGTINGKGVINNRISEYVFTR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IGIP +FIRR+NMREQLVR  E+IP+ + VRN AAGS++KRL I EG  LP +L+E+
Sbjct: 61  LAHIGIPTHFIRRLNMREQLVRQAEIIPIEVVVRNIAAGSISKRLGIEEGEPLPHTLIEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    +++EEHI  F WA+  E++++++++IR+NDF+ G+F  INI LVDF+++ 
Sbjct: 121 YYKDDALGDPMIAEEHIACFGWASNEEMQDISSMAIRVNDFLCGMFAAINISLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF- 239
           GR+ D D  R++LADEI PD CRLWD++  E+ DK RF +      E Y EVARRLG+  
Sbjct: 181 GRIWDGDYSRVILADEISPDGCRLWDMTTGEKLDKDRFRRDLGGEEEAYQEVARRLGLLE 240

Query: 240 KKNEPALKENLILNRK 255
               P+   +L  +RK
Sbjct: 241 NDGGPSEVFDLGAHRK 256


>gi|49474334|ref|YP_032376.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bartonella quintana str. Toulouse]
 gi|81827608|sp|Q6FZJ2|PUR7_BARQU RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|49239838|emb|CAF26231.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bartonella quintana str. Toulouse]
          Length = 254

 Score =  280 bits (715), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 140/254 (55%), Positives = 187/254 (73%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R+ +YE K KI+YEG EPGT IQFFKDD    N  +   ++GKGVLNNRISE++F+ 
Sbjct: 1   MNRRHRIYEGKAKILYEGPEPGTYIQFFKDDATAFNAKKHEVIDGKGVLNNRISEHIFSH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG++GIP +FI+RINMREQL++ VE+IPL + VRN AAGSL+KRL + EG  L +S++EF
Sbjct: 61  LGRLGIPTHFIKRINMREQLIKAVEIIPLEVVVRNVAAGSLSKRLGLEEGTVLSQSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  DS +  +V+EEHITAF WA   E+E++  LSIRINDF++GLF   NIQL+DF+++ 
Sbjct: 121 YYKNDSLDDPMVTEEHITAFGWAVPQEIEDIMQLSIRINDFLSGLFAAANIQLIDFKMEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL +D+ +RIVLADEI PD  RLWD+  +E+ DK RF ++   L+  Y EVA+RLGI  
Sbjct: 181 GRLWEDEAMRIVLADEISPDSARLWDMQTREKMDKDRFRRNMGGLINAYQEVAKRLGIIN 240

Query: 241 KNEPALKENLILNR 254
           +NEP      +L +
Sbjct: 241 ENEPPRPSGPVLVK 254


>gi|298292123|ref|YP_003694062.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Starkeya
           novella DSM 506]
 gi|296928634|gb|ADH89443.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Starkeya
           novella DSM 506]
          Length = 269

 Score =  280 bits (715), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 143/254 (56%), Positives = 190/254 (74%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ FKDD    NN +   ++GKGVLNNRISEY+F +
Sbjct: 11  MSRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNNKKHDVIDGKGVLNNRISEYVFLK 70

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IG+P +FI+R+NMREQL+R+VE+IPL + VRN AAGSL+ RL I EG  LPRS++EF
Sbjct: 71  LNEIGVPTHFIKRLNMREQLIREVEIIPLEVVVRNVAAGSLSSRLGIEEGTQLPRSIIEF 130

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSEEHITAF WA   E++++ AL+IR+NDF++GLFLG+ I+LVDF+++C
Sbjct: 131 YYKNDQLGDPMVSEEHITAFGWATTQEIDDIIALAIRVNDFLSGLFLGVGIRLVDFKMEC 190

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL ++D++RIV+ADEI PD CRLWD+   ++ DK RF +    L+E YSEVARRLGI  
Sbjct: 191 GRLWENDMMRIVVADEISPDSCRLWDIKSNDKLDKDRFRRDMGGLVEAYSEVARRLGIMS 250

Query: 241 KNEPALKENLILNR 254
           +NE       +L +
Sbjct: 251 ENERLQSSGPVLVK 264


>gi|254509994|ref|ZP_05122061.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacteraceae bacterium KLH11]
 gi|221533705|gb|EEE36693.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacteraceae bacterium KLH11]
          Length = 251

 Score =  279 bits (714), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 125/253 (49%), Positives = 180/253 (71%), Gaps = 2/253 (0%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGT++Q+FKDD    N  +   ++GKGVLNNR+SE+    
Sbjct: 1   MARRKKIYEGKAKILYEGPEPGTIVQYFKDDATAFNAEKKDVIDGKGVLNNRLSEFFMNG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IG+P +FIRR+NMREQLVR+ E+IPL + VRN AAGS++KRL I EG  LPR +VE+
Sbjct: 61  LAQIGVPTHFIRRLNMREQLVRNCEIIPLEVIVRNYAAGSMSKRLGIAEGTQLPRPIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    LV+EEHI AF WA+Q +++++ +L++R+NDFM+G+ L + I+LVDF+I+ 
Sbjct: 121 CYKDDALGDPLVTEEHIAAFGWASQQDMDDILSLALRVNDFMSGVMLAVGIRLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ + D  R+++ADEI PD CRLWD+   ++ DK  F +    L + YSEVARRLG+  
Sbjct: 181 GRVYEGDFQRLLVADEISPDSCRLWDIETGQKLDKDVFRRDLGSLTDAYSEVARRLGVLP 240

Query: 241 KNEPALKENLILN 253
           K+   + +  ++N
Sbjct: 241 KS--NVTKPTLIN 251


>gi|15889145|ref|NP_354826.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Agrobacterium tumefaciens str. C58]
 gi|22001849|sp|Q8UEB7|PUR71_AGRT5 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase 1; AltName: Full=SAICAR synthetase 1
 gi|15156957|gb|AAK87611.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Agrobacterium tumefaciens str. C58]
          Length = 254

 Score =  279 bits (714), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 153/254 (60%), Positives = 194/254 (76%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQFFKDD    N  +   ++GKGVLNNRI EY+FT 
Sbjct: 1   MNRRRRIYEGKAKILYEGPEPGTLIQFFKDDATAFNKKKHEVIDGKGVLNNRICEYVFTH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L KIGIP +FIRR+NMREQL+++VEMIPL I VRN AAGSL+KRL I EG+ LPRS++EF
Sbjct: 61  LNKIGIPTHFIRRLNMREQLIKEVEMIPLEIVVRNVAAGSLSKRLGIEEGVVLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D  E  +VSEEHITAF WAN +E++++ AL+IR+NDF++GLFLG+ IQLVDF+I+C
Sbjct: 121 YYKSDELEDPMVSEEHITAFGWANPAELDDIMALAIRVNDFLSGLFLGVGIQLVDFKIEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RI+LADEI PD CRLWD+  +++ DK  F +    L+E YSEVARRLGI  
Sbjct: 181 GRLFEGDMMRIILADEISPDSCRLWDIETQKKMDKDLFRRDLGGLVEAYSEVARRLGIIN 240

Query: 241 KNEPALKENLILNR 254
           +NEP      +L +
Sbjct: 241 ENEPIRGTGPVLVK 254


>gi|319408636|emb|CBI82291.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Bartonella
           schoenbuchensis R1]
          Length = 254

 Score =  278 bits (712), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 142/254 (55%), Positives = 188/254 (74%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R+ +YE K KI+YEG EPGT IQFFKDD    N  +   ++GKGVLNNRISEY+FTQ
Sbjct: 1   MNRRHRIYEGKAKILYEGPEPGTYIQFFKDDATAFNAKKHEIIDGKGVLNNRISEYIFTQ 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG++GIP +FI+RINMREQL++ VE+IPL + VRN AAGSL+KRL + EG  LP+S++EF
Sbjct: 61  LGRLGIPTHFIKRINMREQLIKAVEIIPLEVVVRNVAAGSLSKRLGLEEGTVLPQSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  DS +  +V+EEHITAF W+   E+EE+  LSIRINDF++GLF G+ IQL+DF+I+ 
Sbjct: 121 YYKNDSLDDPMVTEEHITAFGWSAPQEIEEIMQLSIRINDFLSGLFAGVGIQLIDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + + +RIVLADEI PD  RLWD+  +E+ DK RF +    L+  Y +VA+RLGI  
Sbjct: 181 GRLWEGETMRIVLADEISPDSARLWDMQTREKMDKDRFRRDMGGLINAYQDVAKRLGIMN 240

Query: 241 KNEPALKENLILNR 254
           +N+P      +L +
Sbjct: 241 ENDPQRPSGPVLVK 254


>gi|49475721|ref|YP_033762.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bartonella henselae str. Houston-1]
 gi|81827708|sp|Q6G338|PUR7_BARHE RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|49238528|emb|CAF27764.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bartonella henselae str. Houston-1]
          Length = 254

 Score =  278 bits (712), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 142/254 (55%), Positives = 189/254 (74%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R+ +YE K KI+YEG EPGT IQFFKDD    N  +   ++GKGVLNNRISE++F+ 
Sbjct: 1   MNRRHRIYEGKAKILYEGPEPGTYIQFFKDDATAFNAKKHEIIDGKGVLNNRISEHIFSH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG++GIP +FI+RINMREQL++ VE+IPL + VRN AAGSL+KRL + EG  L +S++EF
Sbjct: 61  LGRLGIPTHFIKRINMREQLIKAVEIIPLEVVVRNVAAGSLSKRLGLEEGTPLSQSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  DS +  +VSEEHITAF WA   E+E++  LSIRINDF++GLF G+NIQL+DF+++ 
Sbjct: 121 YYKNDSLDDPMVSEEHITAFGWAVPQEIEDIMQLSIRINDFLSGLFAGVNIQLIDFKMEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL +D+ +RIVLADEI PD  RLWD+  +E+ DK RF +    L+  Y EVA+RLGI  
Sbjct: 181 GRLWEDEAMRIVLADEISPDSARLWDIQTQEKMDKDRFRRDMGGLINAYQEVAKRLGIIN 240

Query: 241 KNEPALKENLILNR 254
           +NEP+     +L +
Sbjct: 241 ENEPSRPNGPVLVK 254


>gi|85707920|ref|ZP_01038986.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Erythrobacter sp. NAP1]
 gi|85689454|gb|EAQ29457.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Erythrobacter sp. NAP1]
          Length = 267

 Score =  278 bits (712), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 135/248 (54%), Positives = 182/248 (73%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R+ +YE K KI+YEG EPGTLIQ+FKDD    N  +  T+NGKGV+NNRISE++FT+
Sbjct: 1   MSRRSKIYEGKAKILYEGPEPGTLIQYFKDDATAFNAEKKGTINGKGVINNRISEHVFTR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IGIP +FIRR+NMREQLVR VE+IP+ + +RN AAGS++KRL I EG  LP +L+E+
Sbjct: 61  LSHIGIPTHFIRRLNMREQLVRQVEIIPIEVVLRNVAAGSISKRLGIEEGEPLPHTLIEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  DS    LV+EEHI  FNWA+  E+ ++++++IRINDF+ G+F  I+I+LVDF+++ 
Sbjct: 121 YYKDDSLGDPLVAEEHIACFNWASNEEMHDISSMAIRINDFLCGMFAAIDIRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL D D  R++LADEI PD CRLWD++  E+ DK RF +      E Y EVARRLG+ +
Sbjct: 181 GRLYDGDYSRVILADEISPDGCRLWDMASGEKLDKDRFRRDLGGEEEAYREVARRLGLLQ 240

Query: 241 KNEPALKE 248
           + +    E
Sbjct: 241 QEDNGPGE 248


>gi|329113463|ref|ZP_08242244.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acetobacter pomorum DM001]
 gi|326697288|gb|EGE48948.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acetobacter pomorum DM001]
          Length = 275

 Score =  278 bits (712), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 134/243 (55%), Positives = 178/243 (73%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI++EG EPGTL+Q+FKDD    N  +   + GKGVLNNRISE++  +
Sbjct: 21  MARRRQLYEGKAKILFEGPEPGTLVQYFKDDATAGNGAKSGVITGKGVLNNRISEFLMLR 80

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IGIP +FIRRINMREQLV++VE+IPL + VRN AAGS++KR +IPEG  LPR +VEF
Sbjct: 81  LQEIGIPTHFIRRINMREQLVKEVEIIPLEVVVRNIAAGSISKRFDIPEGERLPRPIVEF 140

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    LVSE+HI AF WA   ++EE+T +++R+NDF+ GLF GI IQLVDF+++ 
Sbjct: 141 YYKNDALGDPLVSEDHIIAFGWACPHDMEEITGMAMRVNDFLCGLFSGIGIQLVDFKLEF 200

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ + + ++IVLADEI PD CRLWD+   E+ DK RF +    + E Y EVARR+GI  
Sbjct: 201 GRIWEGEDMQIVLADEISPDNCRLWDMHTNEKLDKDRFRRDMGNVKEAYQEVARRMGILP 260

Query: 241 KNE 243
           +N 
Sbjct: 261 ENG 263


>gi|89055036|ref|YP_510487.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Jannaschia sp. CCS1]
 gi|122498396|sp|Q28PA0|PUR7_JANSC RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|88864585|gb|ABD55462.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Jannaschia sp. CCS1]
          Length = 253

 Score =  278 bits (712), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 127/253 (50%), Positives = 176/253 (69%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  VYE K K +YEG EPGTL+Q+FKDD    N  +   ++GKGVLNNR+SE+    
Sbjct: 1   MARRKLVYEGKAKTLYEGPEPGTLVQYFKDDATAGNGEKRDVIDGKGVLNNRLSEFFMKG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG IG+P +FI+R+NMREQL+R VE+IPL + VRNTAAGS+  RL I EG  +PR +VEF
Sbjct: 61  LGNIGVPTHFIKRLNMREQLIRAVEIIPLEVVVRNTAAGSICSRLGIEEGTPMPRPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D     +VSEEHI AF WA Q ++++M +L++R+NDF++GL LG+ I+LVDF+I+ 
Sbjct: 121 YFKNDDLNDPIVSEEHIIAFGWAAQQDLDDMVSLALRVNDFLSGLMLGVGIKLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D D +R+++ADEI PD CRLWD+    + DK  F +    L + Y+EVA+RLGI  
Sbjct: 181 GRIWDGDFMRLIVADEISPDSCRLWDIETGRKLDKDVFRRDLGDLADAYTEVAKRLGIMP 240

Query: 241 KNEPALKENLILN 253
           +      +  ++N
Sbjct: 241 QGPVGAIKPTLIN 253


>gi|260427070|ref|ZP_05781049.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Citreicella sp. SE45]
 gi|260421562|gb|EEX14813.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Citreicella sp. SE45]
          Length = 253

 Score =  278 bits (711), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 123/253 (48%), Positives = 175/253 (69%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGT++Q+FKDD    N  +   + GKGVLNNR+SE+  T 
Sbjct: 1   MARRKKIYEGKAKILYEGPEPGTIVQYFKDDATAFNAQKKDVIEGKGVLNNRLSEFFMTG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +F++R+NMREQLVR  E+IPL I VRN AAGSLAKRL + EG  LPR +VE+
Sbjct: 61  LNNIGVPTHFLKRLNMREQLVRACEIIPLEIIVRNFAAGSLAKRLGLEEGTPLPRPIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     LV+EEHI AF WA+Q +++++ +L++R+ND+++GL  G+ I+LVDF+I+ 
Sbjct: 121 CYKDDKLGDPLVTEEHIAAFGWASQQDMDDVLSLALRVNDYLSGLMYGVGIRLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D D  R+++ADEI PD  RLWD+   ++ DK  F +    L + Y+EVA+RLG+  
Sbjct: 181 GRVYDGDYQRLIVADEISPDSMRLWDIETGKKLDKDVFRRDLGSLTDAYTEVAQRLGVMP 240

Query: 241 KNEPALKENLILN 253
           K    + +  ++N
Sbjct: 241 KQATHMAKPKLIN 253


>gi|222148416|ref|YP_002549373.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Agrobacterium vitis S4]
 gi|221735404|gb|ACM36367.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Agrobacterium vitis S4]
          Length = 254

 Score =  278 bits (711), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 155/254 (61%), Positives = 193/254 (75%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQFFKDD    N  +   ++GKGVLNNRI EY++T 
Sbjct: 1   MNRRRRIYEGKAKILYEGPEPGTLIQFFKDDATAFNKKKHDVIDGKGVLNNRICEYVYTH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L KIGIP +FIRR+NMREQL+++VE+IPL I VRN AAGSL+KRL I EG+ LPRS++EF
Sbjct: 61  LNKIGIPTHFIRRLNMREQLIKEVEIIPLEIVVRNVAAGSLSKRLGIEEGVVLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ E  +VSEEHITAF WAN +E++++ AL+IR+NDF++GLFLGI IQLVDF+I+C
Sbjct: 121 YYKSDALEDPIVSEEHITAFGWANPAELDDIMALAIRVNDFLSGLFLGIGIQLVDFKIEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RIVLADEI PD CRLWD+   E+ DK RF      LLE Y EVARRLGI  
Sbjct: 181 GRLYEGDMMRIVLADEISPDSCRLWDVETHEKLDKDRFRHDMGGLLEAYQEVARRLGIIN 240

Query: 241 KNEPALKENLILNR 254
           +NEP      +L +
Sbjct: 241 ENEPVRGTGPVLVK 254


>gi|84500974|ref|ZP_00999209.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oceanicola batsensis HTCC2597]
 gi|84391041|gb|EAQ03459.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oceanicola batsensis HTCC2597]
          Length = 252

 Score =  278 bits (710), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 127/251 (50%), Positives = 175/251 (69%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGT++Q+FKDD    N  + AT+ GKGVLNNR+SE+  T 
Sbjct: 1   MARRKKIYEGKAKILYEGPEPGTIVQYFKDDATAFNAEKMATIEGKGVLNNRLSEFFMTG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  +G+P +F+RR+NMREQLVR  E++PL I VRN AAGSL+KRL I EG +LPR +VE+
Sbjct: 61  LNNVGVPTHFMRRLNMREQLVRACEIVPLEIIVRNFAAGSLSKRLGIEEGTALPRPIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     LV+EEHI AF WA+Q +++++ +L++R+ND+++GL  G+ I+L+DF+I+ 
Sbjct: 121 CYKDDKLGDPLVTEEHIAAFGWASQQDMDDILSLALRVNDYLSGLMYGVGIKLIDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D D  R+++ADEI PD CRLWD+      DK  F +    L + Y+EVARRLG+  
Sbjct: 181 GRVYDGDFQRLIVADEISPDSCRLWDMETGAHLDKDVFRRDLGSLTDAYTEVARRLGVLP 240

Query: 241 KNEPALKENLI 251
           K     K  LI
Sbjct: 241 KTNGHTKPTLI 251


>gi|254503848|ref|ZP_05115999.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Labrenzia
           alexandrii DFL-11]
 gi|222439919|gb|EEE46598.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Labrenzia
           alexandrii DFL-11]
          Length = 254

 Score =  277 bits (709), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 145/254 (57%), Positives = 187/254 (73%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTL+Q FKDD    NN +   ++GKGVLNNRISEY+F  
Sbjct: 1   MNRRRRIYEGKAKILYEGPEPGTLVQHFKDDATAFNNKKHEIVDGKGVLNNRISEYIFNN 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IGIP +FIRR+NMREQL+R+VE+IPL + VRN AAGS+AKRL + EG  LPRS++EF
Sbjct: 61  LNAIGIPTHFIRRMNMREQLIREVEIIPLEVVVRNVAAGSIAKRLGLEEGTQLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D  +  +VSEEHITAF WA   E+++M AL+IR+NDF++GLFLG+ I+LVDF+I+C
Sbjct: 121 YYKNDELDDPMVSEEHITAFGWATPQELDDMMALAIRVNDFLSGLFLGVGIRLVDFKIEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RIV+ADEI PD CRLWD    E+ DK RF +    +LE Y EVA+RLG+  
Sbjct: 181 GRLFEGDLMRIVVADEISPDSCRLWDTETNEKMDKDRFRREMGGMLEAYQEVAKRLGLVT 240

Query: 241 KNEPALKENLILNR 254
           +NE  +     L +
Sbjct: 241 QNERPVGSGPTLVQ 254


>gi|149914996|ref|ZP_01903525.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseobacter sp. AzwK-3b]
 gi|149811184|gb|EDM71021.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseobacter sp. AzwK-3b]
          Length = 253

 Score =  277 bits (709), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 119/253 (47%), Positives = 172/253 (67%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +YEG EPGT++Q+FKDD    N  + A + GKGVLNN +SEY    
Sbjct: 1   MARRKKIYEGKAKTLYEGPEPGTIVQYFKDDATAFNAEKRAVIEGKGVLNNLLSEYFMLG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IGIP++F++R+NMREQLVR  E++PL I VRN AAG++AKRL + EG  LPR +VE+
Sbjct: 61  LSNIGIPNHFLKRLNMREQLVRACEIVPLEIIVRNYAAGTMAKRLGMDEGTQLPRPIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
               D     LV+EEHI AF WA+Q +++++ +L++R+NDF++G+  G+ I+LVDF+I+ 
Sbjct: 121 CLKDDKLGDPLVTEEHIAAFGWASQQDMDDILSLALRVNDFLSGVMYGVGIRLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ + D  R+++ADEI PD CRLWD+   ++ DK  F +    L + Y+EVA RLG+  
Sbjct: 181 GRVYEGDFQRLIVADEISPDSCRLWDIETGQKLDKDVFRRDLGSLTDAYTEVANRLGVMP 240

Query: 241 KNEPALKENLILN 253
           K    +    ++N
Sbjct: 241 KGATPMNRPTLIN 253


>gi|149202491|ref|ZP_01879463.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseovarius sp. TM1035]
 gi|149143773|gb|EDM31807.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseovarius sp. TM1035]
          Length = 253

 Score =  277 bits (708), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 124/253 (49%), Positives = 172/253 (67%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +YEG EPGT+IQ+FKDD    N  + A + GKGVLNN +SEY  T 
Sbjct: 1   MARRKKIYEGKAKTLYEGPEPGTIIQYFKDDATAFNAEKKAVIEGKGVLNNMLSEYFMTG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FI+R+NMREQLVR VE+IPL + VRN AAG++AKRL I EG  LPR +VE+
Sbjct: 61  LNTIGVPTHFIKRLNMREQLVRAVEIIPLEVIVRNYAAGTMAKRLGIEEGTQLPRPIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
               D     LV+EEHI AF WA+Q +++++ +L++R+NDFM G+  G+ I+L+DF+I+ 
Sbjct: 121 CLKDDKLGDPLVTEEHIAAFGWASQQDMDDILSLALRVNDFMAGVMYGVGIKLIDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D D  R+++ADEI PD CRLWD++   + DK  F +    L + Y+EVA RLG+  
Sbjct: 181 GRVYDGDFQRLIVADEISPDSCRLWDIASGRKLDKDVFRRDLGSLTDAYTEVATRLGVMP 240

Query: 241 KNEPALKENLILN 253
           K    +    ++N
Sbjct: 241 KGSTPMARPKLIN 253


>gi|258542300|ref|YP_003187733.1| phosphoribosyl amidoimidazole succinocarboxamide synthase
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256633378|dbj|BAH99353.1| phosphoribosyl amidoimidazole succinocarboxamide synthase
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256636437|dbj|BAI02406.1| phosphoribosyl amidoimidazole succinocarboxamide synthase
           [Acetobacter pasteurianus IFO 3283-03]
 gi|256639490|dbj|BAI05452.1| phosphoribosyl amidoimidazole succinocarboxamide synthase
           [Acetobacter pasteurianus IFO 3283-07]
 gi|256642546|dbj|BAI08501.1| phosphoribosyl amidoimidazole succinocarboxamide synthase
           [Acetobacter pasteurianus IFO 3283-22]
 gi|256645601|dbj|BAI11549.1| phosphoribosyl amidoimidazole succinocarboxamide synthase
           [Acetobacter pasteurianus IFO 3283-26]
 gi|256648654|dbj|BAI14595.1| phosphoribosyl amidoimidazole succinocarboxamide synthase
           [Acetobacter pasteurianus IFO 3283-32]
 gi|256651707|dbj|BAI17641.1| phosphoribosyl amidoimidazole succinocarboxamide synthase
           [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654698|dbj|BAI20625.1| phosphoribosyl amidoimidazole succinocarboxamide synthase
           [Acetobacter pasteurianus IFO 3283-12]
          Length = 255

 Score =  277 bits (708), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 134/243 (55%), Positives = 178/243 (73%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI++EG EPGTL+Q+FKDD    N  +   + GKGVLNNRISE++  +
Sbjct: 1   MARRRQLYEGKAKILFEGPEPGTLVQYFKDDATAGNGAKSGVITGKGVLNNRISEFLMLR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IGIP +FIRRINMREQLV++VE+IPL + VRN AAGS++KR +IPEG  LPR +VEF
Sbjct: 61  LQEIGIPTHFIRRINMREQLVKEVEIIPLEVVVRNIAAGSISKRFDIPEGERLPRPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    LVSE+HI AF WA   ++EE+T +++R+NDF+ GLF GI IQLVDF+++ 
Sbjct: 121 YYKNDALGDPLVSEDHIIAFGWACPHDMEEITGMAMRVNDFLCGLFSGIGIQLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ + + ++IVLADEI PD CRLWD+   E+ DK RF +    + E Y EVARR+GI  
Sbjct: 181 GRIWEGEEMQIVLADEISPDNCRLWDMHTNEKLDKDRFRRDMGNVKEAYQEVARRMGILP 240

Query: 241 KNE 243
           +N 
Sbjct: 241 ENG 243


>gi|163793610|ref|ZP_02187585.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase [alpha
           proteobacterium BAL199]
 gi|159181412|gb|EDP65927.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase [alpha
           proteobacterium BAL199]
          Length = 255

 Score =  277 bits (708), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 135/255 (52%), Positives = 183/255 (71%), Gaps = 2/255 (0%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGTLIQ+FKDD    NN +  T+ GKGVLNNRISEY+ T+
Sbjct: 1   MARRRKLYEGKAKVLYEGPEPGTLIQYFKDDATAFNNQKKGTITGKGVLNNRISEYLMTR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GIP +F+RR+NMREQLVR++E+IP+ + VRN AAGS+AKR  + EG  LPRS++E+
Sbjct: 61  LTEVGIPTHFMRRLNMREQLVRELEIIPIGVVVRNIAAGSIAKRFGLEEGTVLPRSIIEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     +V+EEHITAF WA   ++++M ALS+R+NDF+TGLFLGI ++LVDF+++ 
Sbjct: 121 SYKSDELGDPMVTEEHITAFGWAGPQDLDDMVALSLRVNDFLTGLFLGIGLRLVDFKLEF 180

Query: 181 GRLLDDDIL-RIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
           GRL ++    ++V+ADEI PD CRLWDL   E+ DK RF      + E Y EVARRLG+ 
Sbjct: 181 GRLYNEHDEVQVVIADEISPDNCRLWDLRTNEKMDKDRFRCDLGGVEEAYQEVARRLGVL 240

Query: 240 KKNEP-ALKENLILN 253
            +  P  LK   ++ 
Sbjct: 241 PEAGPMDLKGPQLMQ 255


>gi|114768876|ref|ZP_01446502.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [alpha
           proteobacterium HTCC2255]
 gi|114549793|gb|EAU52674.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [alpha
           proteobacterium HTCC2255]
          Length = 252

 Score =  276 bits (707), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 127/251 (50%), Positives = 165/251 (65%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +YEG EPGT+IQ+FKDD    N  +  TL GKG LNN + E+    
Sbjct: 1   MARGKKIYEGKAKTLYEGPEPGTIIQYFKDDATAFNAVKKDTLEGKGALNNLLCEHFMIG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FI+R+N+REQLV  VE++PL I VRN AAGS +K  NI EG  LPR +VEF
Sbjct: 61  LNTIGLPTHFIKRLNVREQLVHKVEIVPLEIIVRNVAAGSFSKMFNIEEGTPLPRPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
               DS    LVSEEHI A NWA   E+++M  +++R+NDF+ GL  GI I+LVDF+I+ 
Sbjct: 121 CLKDDSLGDPLVSEEHILAMNWATSHEIDDMREIALRVNDFLAGLMYGIGIKLVDFKIEV 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR  +DD+ R++LADEI PD CRLWD+   ++ DK  F +    L + YSEVARRLGI  
Sbjct: 181 GRQFEDDMQRLILADEISPDSCRLWDVETNQKLDKDVFRRDLGSLTDAYSEVARRLGILP 240

Query: 241 KNEPALKENLI 251
           KN  +    L+
Sbjct: 241 KNGGSAGPKLV 251


>gi|56696763|ref|YP_167124.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ruegeria
           pomeroyi DSS-3]
 gi|81820045|sp|Q5LS81|PUR7_SILPO RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|56678500|gb|AAV95166.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ruegeria
           pomeroyi DSS-3]
          Length = 251

 Score =  276 bits (707), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 123/253 (48%), Positives = 178/253 (70%), Gaps = 2/253 (0%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGT++Q+FKDD    N  +   + GKGVLNNR+SEY  T 
Sbjct: 1   MARRTKIYEGKAKILYEGPEPGTIVQYFKDDATAFNAQKKDVIEGKGVLNNRLSEYFMTG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IG+P +FIRR+NMREQLVR  E++PL + VRN AAG+++KRL I EG  LPR +VE+
Sbjct: 61  LAQIGVPTHFIRRLNMREQLVRACEIVPLEVIVRNFAAGTMSKRLGIEEGTQLPRPIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
               D     LV+EEHI AF WA+Q +++++ +L++R+ND+++GL  G+ I+LVDF+I+ 
Sbjct: 121 CLKNDELGDPLVTEEHIAAFGWASQQDMDDILSLALRVNDYLSGLMYGVGIKLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ ++D  R+++ADEI PD CRLWD++  ++ DK  F +    L + YSEVARRLG+  
Sbjct: 181 GRVYENDYPRLIIADEISPDSCRLWDIATGQKLDKDVFRRDLGSLTDAYSEVARRLGVIP 240

Query: 241 KNEPALKENLILN 253
           K    + +  ++N
Sbjct: 241 KT--QIAKPTLIN 251


>gi|296116197|ref|ZP_06834815.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295977303|gb|EFG84063.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 254

 Score =  276 bits (707), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 136/254 (53%), Positives = 180/254 (70%), Gaps = 1/254 (0%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI++EG EPGTL+Q+FKDD    N  +   + GKGVLNNRISE++  +
Sbjct: 1   MGRRRQLYEGKAKILFEGPEPGTLVQYFKDDASAGNGAKKGVITGKGVLNNRISEHLMLR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IGIP +FIRR+NMREQL+R+VE+IPL + +RN AAGSL+KRL I EG  LP  +VEF
Sbjct: 61  LHEIGIPTHFIRRLNMREQLIREVEIIPLEVVIRNVAAGSLSKRLGIKEGTRLPHPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  DS    +VSEEHITAF WA   ++E++ +LS+RINDF+ GLF+GI I LVDF+++ 
Sbjct: 121 YYKNDSLNDPMVSEEHITAFGWACAHDLEDIVSLSMRINDFLCGLFVGIGITLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL ++D +RIVLADEI PD CRLWD    ++ DK RF +   ++ E Y EVA RLGI  
Sbjct: 181 GRLWENDNMRIVLADEISPDNCRLWDSKTSQKLDKDRFRQDMGKVEEAYQEVAMRLGILP 240

Query: 241 K-NEPALKENLILN 253
           +     +K   ++ 
Sbjct: 241 EATNSDMKGPEVMQ 254


>gi|325293243|ref|YP_004279107.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Agrobacterium sp. H13-3]
 gi|325061096|gb|ADY64787.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Agrobacterium sp. H13-3]
          Length = 254

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 153/254 (60%), Positives = 194/254 (76%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQFFKDD    N  +   ++GKGVLNNRI EY+FT 
Sbjct: 1   MNRRRRIYEGKAKILYEGPEPGTLIQFFKDDATAFNKKKHEVIDGKGVLNNRICEYVFTH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L KIGIP +FIRR+NMREQL+++VEMIPL I VRN AAGSL+KRL I EG+ LPRS++EF
Sbjct: 61  LNKIGIPTHFIRRLNMREQLIKEVEMIPLEIVVRNVAAGSLSKRLGIDEGVVLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D  E  +VSEEHITAF WAN +E++++ AL+IR+NDF++GLFLG+ IQLVDF+I+C
Sbjct: 121 YYKSDELEDPMVSEEHITAFGWANPAELDDIMALAIRVNDFLSGLFLGVGIQLVDFKIEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RI+LADEI PD CRLWD+  +++ DK  F +    L+E YSEVARRLGI  
Sbjct: 181 GRLFEGDMMRIILADEISPDSCRLWDIETQKKMDKDLFRRDMGGLVEAYSEVARRLGIIN 240

Query: 241 KNEPALKENLILNR 254
           +NEP      +L +
Sbjct: 241 ENEPIRGTGPVLVK 254


>gi|197104482|ref|YP_002129859.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Phenylobacterium zucineum HLK1]
 gi|229564408|sp|B4RHH0|PUR7_PHEZH RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|196477902|gb|ACG77430.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Phenylobacterium zucineum HLK1]
          Length = 251

 Score =  276 bits (706), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 135/241 (56%), Positives = 181/241 (75%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQ+FKDD    +  + A L GKGV+NNRISEY+ T+
Sbjct: 1   MTRRKKIYEGKAKILYEGPEPGTLIQYFKDDTTAFDATKKAVLEGKGVINNRISEYIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+ ++FI+R+N+REQL+R+VE+IPL +  RN AAGSL+KR  +PEG +LPRS++EF
Sbjct: 61  LNSIGVQNHFIKRLNLREQLIREVEIIPLEVVCRNVAAGSLSKRFGLPEGQALPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y   D     +V+EEHITAFNWA+  E+++M AL++R+NDF+TGLF G+ I LVDF+I+ 
Sbjct: 121 YLKDDKLHDPMVAEEHITAFNWASTQEIDDMMALTLRVNDFLTGLFSGVGITLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ ++D  RI+LADEI PD CRLWD    E+ DK RF +    ++E Y+EVARRLGI K
Sbjct: 181 GRIWENDFSRIILADEISPDSCRLWDSQTNEKLDKDRFRRDLGNVIESYTEVARRLGIMK 240

Query: 241 K 241
           +
Sbjct: 241 E 241


>gi|85702978|ref|ZP_01034082.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseovarius sp. 217]
 gi|85671906|gb|EAQ26763.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseovarius sp. 217]
          Length = 253

 Score =  276 bits (706), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 124/253 (49%), Positives = 171/253 (67%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +YEG EPGT+IQ+FKDD    N  + A + GKGVLNN +SEY    
Sbjct: 1   MARRKKIYEGKAKTLYEGPEPGTIIQYFKDDATAFNAEKKAVIEGKGVLNNMLSEYFMVG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FI+RINMREQLVR VE+IPL + VRN AAG++AKRL I EG  LPR +VE+
Sbjct: 61  LNAIGVPTHFIKRINMREQLVRAVEIIPLEVIVRNYAAGTMAKRLGIDEGTQLPRPIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
               D     LV+EEHI AF WA+Q +++++ +L++R+NDF+TG+  G+ I+L+DF+I+ 
Sbjct: 121 CLKDDKLGDPLVTEEHIAAFGWASQQDMDDILSLALRVNDFLTGVMYGVGIKLIDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D D  R+++ADEI PD CRLWD+    + DK  F +    L + Y+EVA RLG+  
Sbjct: 181 GRVYDGDFQRLIVADEISPDSCRLWDIETGRKLDKDVFRRDLGSLTDAYTEVATRLGVMP 240

Query: 241 KNEPALKENLILN 253
           K    +    ++N
Sbjct: 241 KGSTPMARPKLIN 253


>gi|304321640|ref|YP_003855283.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Parvularcula bermudensis HTCC2503]
 gi|303300542|gb|ADM10141.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Parvularcula bermudensis HTCC2503]
          Length = 262

 Score =  276 bits (706), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 139/241 (57%), Positives = 183/241 (75%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M    P+YE K KI+YEG EPGTLIQFFKDD    NN + A L GKGVLNNRISE++  +
Sbjct: 1   MARGKPIYEGKAKILYEGPEPGTLIQFFKDDATAFNNQKHAVLEGKGVLNNRISEFVMQE 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++G+P +FIRR+NMREQL+R VE+IPL + VRN AAGS+AKRL I EG +LPRS+VEF
Sbjct: 61  LERVGVPTHFIRRLNMREQLIRHVEIIPLEVVVRNVAAGSIAKRLGISEGDALPRSIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    LV+E+HITAFNWA+  E+++M A ++R+NDF++GLF  + I+L+DF+++ 
Sbjct: 121 YYKDDALGDPLVAEDHITAFNWASPQEIDDMMAYALRVNDFLSGLFAAVGIRLIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR  + D++R++LADEI PD CRLWD+  KE  DK RF K    ++EGY EVARRLGI +
Sbjct: 181 GRQYEGDMMRVILADEISPDSCRLWDVQTKESMDKDRFRKDLGGVVEGYREVARRLGIIR 240

Query: 241 K 241
            
Sbjct: 241 D 241


>gi|83858767|ref|ZP_00952289.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oceanicaulis alexandrii HTCC2633]
 gi|83853590|gb|EAP91442.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oceanicaulis alexandrii HTCC2633]
          Length = 253

 Score =  276 bits (705), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 132/250 (52%), Positives = 184/250 (73%), Gaps = 1/250 (0%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGT++ +FKDD    N  + A L GKGVLNNRISE++   
Sbjct: 1   MSRRKMLYEGKAKILYEGPEPGTVVAYFKDDATAFNAQKKAVLEGKGVLNNRISEFVMEN 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG++GIP +FI+R+NMREQL+R+VE+IPL + VRN AAGS+AKR  + EG  LPRS+VEF
Sbjct: 61  LGRMGIPTHFIKRLNMREQLLREVEIIPLEVVVRNVAAGSIAKRFGLTEGDPLPRSIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ E  +V+EEHITAFNWA   +++EM A+++R+ND+++G+F+ + I+L+DF+++ 
Sbjct: 121 YYKNDALEDPMVAEEHITAFNWATTQDMDEMIAMALRVNDYLSGMFMAVGIRLIDFKLEF 180

Query: 181 GRLLDDDIL-RIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
           GR+ D + + R++LADEI PD CRLWD    E+ DK RF +    + E Y+EVARRLGI 
Sbjct: 181 GRVYDQNDMPRVILADEISPDSCRLWDAHTNEKLDKDRFRRDLGNVTEAYAEVARRLGIM 240

Query: 240 KKNEPALKEN 249
           K+N    +E 
Sbjct: 241 KENGSVTEEG 250


>gi|118588556|ref|ZP_01545964.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Stappia
           aggregata IAM 12614]
 gi|118438542|gb|EAV45175.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Stappia
           aggregata IAM 12614]
          Length = 254

 Score =  275 bits (704), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 142/254 (55%), Positives = 183/254 (72%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTL+Q FKDD    NN +   ++GKGVLNNRISEY+F  
Sbjct: 1   MNRRRRIYEGKGKILYEGPEPGTLVQHFKDDATAFNNKKHEIVDGKGVLNNRISEYIFNH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IGIP +FIRR+NMREQL+R+VE+IPL + VRN AAGS+A RL + EG  LPRS++EF
Sbjct: 61  LNAIGIPTHFIRRLNMREQLIREVEIIPLEVVVRNVAAGSIATRLGLEEGTQLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +V+EEHITAF WA   E+++M AL+IR+NDF+ GLFLG+ I+LVDF+I+C
Sbjct: 121 YYKNDELNDPMVAEEHITAFGWATPQELDDMMALAIRVNDFLCGLFLGVGIRLVDFKIEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RIV+ADEI PD CRLWD+   ++ DK RF +    +LE Y EVA+RLGI  
Sbjct: 181 GRLFEGDMMRIVVADEISPDSCRLWDIETNDKMDKDRFRRDMGGMLEAYQEVAKRLGIMI 240

Query: 241 KNEPALKENLILNR 254
            +E        L +
Sbjct: 241 TSERPAGSGPTLVK 254


>gi|295688643|ref|YP_003592336.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caulobacter segnis ATCC 21756]
 gi|295430546|gb|ADG09718.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caulobacter segnis ATCC 21756]
          Length = 252

 Score =  275 bits (704), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 133/240 (55%), Positives = 179/240 (74%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             R  +YE K KI+YEG EPGTLIQ+FKDD    N  + A L GKGV+NNRISEY+ T+L
Sbjct: 3   TRRKKIYEGKAKILYEGPEPGTLIQYFKDDATAFNAQKKAVLEGKGVINNRISEYIMTRL 62

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
             IG+ ++FIRR+N+REQL+++VE++PL + VRN AAGS+A RL + EG  LPRS++EFY
Sbjct: 63  NSIGVQNHFIRRLNLREQLIKEVEIVPLEVVVRNIAAGSIATRLGLTEGQPLPRSIIEFY 122

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     +VSEEHITAFNWA   E+++M A+++R+ND+++GLF G+ I LVDF+I+ G
Sbjct: 123 YKDDKLGDPMVSEEHITAFNWAATQEIDDMMAMALRVNDYLSGLFSGVGITLVDFKIEFG 182

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKK 241
           R+ + D  RI+LADEI PD CRLWD +  E+ DK RF +    ++E Y+EVARRLGI K+
Sbjct: 183 RIYEGDFSRIILADEISPDSCRLWDAATNEKLDKDRFRRDLGNVIESYTEVARRLGIMKE 242


>gi|126735800|ref|ZP_01751545.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseobacter sp. CCS2]
 gi|126714987|gb|EBA11853.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseobacter sp. CCS2]
          Length = 254

 Score =  275 bits (704), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 123/254 (48%), Positives = 178/254 (70%), Gaps = 1/254 (0%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++YEG EPGT +Q+FKDD    N  +   + GKGVLNNR+SE+  T 
Sbjct: 1   MARRKKIYEGKAKVLYEGPEPGTFVQYFKDDATAFNAEKKEVIEGKGVLNNRLSEFFMTG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG++GIP +FI+R+NMREQL+R  E+IPL + VRN AAG++AKR+ + EG +LPR +VEF
Sbjct: 61  LGQLGIPTHFIKRLNMREQLIRQAEIIPLEVIVRNFAAGTMAKRMGMEEGTALPRPVVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  DS    LV EE+I AF WA+Q E++++ +L++R+ND+M+G+  G+ I+LVDF+I+ 
Sbjct: 121 SYKDDSLGDPLVPEEYIIAFGWASQQEMDDIVSLALRVNDWMSGVMYGVGIKLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D+D  R++LADEI PD CRLWD+   ++ DK  F +    L + Y+EVA+RLG+  
Sbjct: 181 GRVWDNDFQRLILADEISPDSCRLWDIETGQKLDKDVFRRDLGNLTDAYTEVAKRLGVMP 240

Query: 241 KNEPALK-ENLILN 253
            N      +  ++N
Sbjct: 241 SNVTHTNTKPTLIN 254


>gi|254420382|ref|ZP_05034106.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Brevundimonas sp. BAL3]
 gi|196186559|gb|EDX81535.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Brevundimonas sp. BAL3]
          Length = 252

 Score =  275 bits (703), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 124/239 (51%), Positives = 178/239 (74%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             R  +YE K KI+YEG EPGTLIQ+FKDD    N  + A L GKGV+NN+ISE++ ++L
Sbjct: 3   SKRKKIYEGKAKILYEGPEPGTLIQYFKDDATAFNAQKKAVLEGKGVVNNQISEFIMSRL 62

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
             IG+ ++FI+R+N+REQL+R+VE+IPL +  RN  AGS+++RL I EG  LPRS++EFY
Sbjct: 63  NGIGVTNHFIKRLNLREQLIREVEIIPLEVVCRNIVAGSMSQRLGIEEGTPLPRSIIEFY 122

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     +V+EEHITAFNWA+  E++++ A+++R+ND+++G+F  + I LVDF+I+ G
Sbjct: 123 YKKDELNDPMVTEEHITAFNWASTQELDDILAMTVRVNDYLSGMFGAVGITLVDFKIEFG 182

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           R+ ++D  R++LADEI PD CRLWD +  E+ DK RF +    ++E Y+EVARRLGI K
Sbjct: 183 RIWENDFSRVILADEISPDSCRLWDATTGEKMDKDRFRRDLGNVIESYTEVARRLGIMK 241


>gi|312113228|ref|YP_004010824.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311218357|gb|ADP69725.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 258

 Score =  275 bits (703), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 144/254 (56%), Positives = 181/254 (71%), Gaps = 1/254 (0%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             R  +YE K K++YEG EPGTLIQ FKDD    N  +     GKGVLNNRISEY+F++L
Sbjct: 3   NRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAQKHERFEGKGVLNNRISEYIFSRL 62

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            +IG+P +FIRR+NMREQL+R+VE+IPL + VRN  AGSL  RL + EG+ LPRS++EFY
Sbjct: 63  NEIGVPTHFIRRLNMREQLIREVEIIPLEVVVRNVVAGSLGTRLGLEEGMQLPRSIIEFY 122

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     +V+EEHITAF WA   E++EM AL++RINDF++GLFLGI I+LVDF+++ G
Sbjct: 123 YKADKLNDPMVTEEHITAFGWAAPQEIDEMMALALRINDFLSGLFLGIGIRLVDFKVEFG 182

Query: 182 RLLDDDIL-RIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           R+ D D   RIVLADEI PDCCRLWD+  K+  DK RF +    LLE YSEVARRLGI  
Sbjct: 183 RIYDPDGQVRIVLADEISPDCCRLWDIETKDRLDKDRFRRDMGGLLEAYSEVARRLGILV 242

Query: 241 KNEPALKENLILNR 254
            N        +L +
Sbjct: 243 DNPAPKPSGPVLVQ 256


>gi|162147740|ref|YP_001602201.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542365|ref|YP_002274594.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|189038230|sp|A9HJF3|PUR7_GLUDA RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|161786317|emb|CAP55899.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530042|gb|ACI49979.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 254

 Score =  275 bits (703), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 137/254 (53%), Positives = 181/254 (71%), Gaps = 1/254 (0%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI++EG EPGTL+Q+FKDD    N  +   + GKGVLNNRISE++  +
Sbjct: 1   MARRRQLYEGKAKILFEGPEPGTLVQYFKDDATAGNGAKKGIITGKGVLNNRISEHLMLR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IGIP +FIRR+NMREQL+R+VE+IPL + VRN AAGSLAKRL IPEG  LPR+++E+
Sbjct: 61  LHDIGIPTHFIRRLNMREQLIREVEIIPLEVVVRNVAAGSLAKRLGIPEGTRLPRTIIEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  DS    +VSEEHITAF WA   ++++M AL++R NDF++GLF+GI I LVDF+++ 
Sbjct: 121 YYKNDSLNDPMVSEEHITAFGWACTHDLDDMVALTMRTNDFLSGLFVGIGITLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + + +RIVLADEI PD CRLWD    E+ DK RF +   ++ E Y EVA RLGI  
Sbjct: 181 GRLWEGEDMRIVLADEISPDNCRLWDAKTSEKLDKDRFRRDMGRVEEAYQEVAWRLGILP 240

Query: 241 K-NEPALKENLILN 253
           +     +K   ++ 
Sbjct: 241 EATNSDMKGPEVMQ 254


>gi|329890450|ref|ZP_08268793.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Brevundimonas diminuta ATCC 11568]
 gi|328845751|gb|EGF95315.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Brevundimonas diminuta ATCC 11568]
          Length = 252

 Score =  275 bits (702), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 127/240 (52%), Positives = 176/240 (73%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             R  +YE K KI+YEG EPGTLIQ+FKDD    N  + ATL GKGV+NNRISE++ ++L
Sbjct: 3   TKRKKLYEGKAKILYEGPEPGTLIQYFKDDATAFNAQKKATLEGKGVINNRISEFIMSRL 62

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
             IG+ ++FI+R+N+REQL+R+VE+IPL +  RN  AGSLA+RL   EG  LPRS++EFY
Sbjct: 63  NSIGVTNHFIKRLNLREQLIREVEIIPLEVVCRNVVAGSLAQRLGQEEGTPLPRSIIEFY 122

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     +V+EEHITAFNWA   E++++ A+++R+ND++ G+F  + I LVDF+I+ G
Sbjct: 123 YKKDELNDPMVTEEHITAFNWATTQELDDILAMTVRVNDYLCGMFGAVGITLVDFKIEFG 182

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKK 241
           R+ ++D  R++LADEI PD CRLWD +  E+ DK RF +    ++E Y+EVARRLGI K 
Sbjct: 183 RVWENDFARVILADEISPDSCRLWDSTTGEKLDKDRFRRDMGDVIESYTEVARRLGIMKD 242


>gi|126737539|ref|ZP_01753269.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseobacter sp. SK209-2-6]
 gi|126720932|gb|EBA17636.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseobacter sp. SK209-2-6]
          Length = 253

 Score =  275 bits (702), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 124/253 (49%), Positives = 178/253 (70%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +YEG EPGT++Q+FKDD    N  +   ++GKGVLNN +SE+    
Sbjct: 1   MSRRKKIYEGKAKTLYEGPEPGTIVQYFKDDATAFNAEKKDVIDGKGVLNNILSEFFMQG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+IG+P +F++R+NMREQLVR  E++PL + VRN AAGS++KRL I EG  LPR +VE+
Sbjct: 61  LGQIGVPTHFLKRLNMREQLVRSCEIVPLEVIVRNYAAGSMSKRLGIEEGTQLPRPIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    LV+EEHI AF WA+Q +++++ +L++R+NDF++G+ L + I+LVDF+I+ 
Sbjct: 121 CYKDDALGDPLVTEEHIAAFGWASQQDMDDILSLALRVNDFLSGVMLAVGIRLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D D  R+V+ADEI PD CRLWD+   E+ DK  F +    L + YSEVARRLG+  
Sbjct: 181 GRIYDGDFQRLVVADEISPDSCRLWDIESGEKLDKDVFRRDLGSLTDAYSEVARRLGVLP 240

Query: 241 KNEPALKENLILN 253
            N P+  +  ++N
Sbjct: 241 NNPPSPSKPTLVN 253


>gi|330994568|ref|ZP_08318491.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Gluconacetobacter sp. SXCC-1]
 gi|329758209|gb|EGG74730.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Gluconacetobacter sp. SXCC-1]
          Length = 254

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 139/254 (54%), Positives = 179/254 (70%), Gaps = 1/254 (0%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI++EG EPGTL+Q+FKDD    N  +   + GKGVLNNRISE++  +
Sbjct: 1   MGRRRQLYEGKAKILFEGPEPGTLVQYFKDDASAGNGAKKGIITGKGVLNNRISEHLMLR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IGIP +FIRR+NMREQL+R+VE+IPL + VRN AAGSL+KRL I EG  LPR ++EF
Sbjct: 61  LHDIGIPTHFIRRLNMREQLIREVEIIPLEVVVRNVAAGSLSKRLGIQEGTRLPRPIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    +VSEEHITAF WA   ++E++ ALS+RINDF+ GLF+GI I LVDF+++ 
Sbjct: 121 YYKNDALNDPMVSEEHITAFGWACPHDMEDIVALSMRINDFLCGLFMGIGIILVDFKLEY 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D +RIVLADEI PD CRLWD    E+ DK RF K   ++ E Y EVA RLGI  
Sbjct: 181 GRLFEGDNMRIVLADEISPDNCRLWDAKTSEKLDKDRFRKDMGKVEEAYQEVAMRLGILP 240

Query: 241 K-NEPALKENLILN 253
           +     +K   ++ 
Sbjct: 241 EATNSDMKGPEVMQ 254


>gi|307945587|ref|ZP_07660923.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Roseibium
           sp. TrichSKD4]
 gi|307771460|gb|EFO30685.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Roseibium
           sp. TrichSKD4]
          Length = 254

 Score =  273 bits (699), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 146/254 (57%), Positives = 187/254 (73%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQ FKDD    NN +   ++GKGVLNNRISEY+F  
Sbjct: 1   MNRRRRIYEGKAKILYEGPEPGTLIQHFKDDATAFNNKKHEIVDGKGVLNNRISEYIFNN 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IGIP +FIRR+NMREQL+R+VE+IPL I VRN AAGS+AKRL + EG  LPRS++EF
Sbjct: 61  LNTIGIPTHFIRRMNMREQLIREVEIIPLEIIVRNVAAGSIAKRLGLEEGTQLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D  +  +V+EEHITAF WA   E+++M AL+IR+NDF+TGLFLG+ I+LVDF+I+C
Sbjct: 121 CYKNDELDDPMVAEEHITAFGWATPQELDDMMALAIRVNDFLTGLFLGVGIRLVDFKIEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL + D++RIV+ADEI PD CRLWD++  ++ DK RF +    +LE Y EVA+RLGI  
Sbjct: 181 GRLFEGDMMRIVVADEISPDSCRLWDINTNDKLDKDRFRREMGGMLEAYQEVAKRLGILM 240

Query: 241 KNEPALKENLILNR 254
           +NE        L +
Sbjct: 241 ENERPTVTGPTLVQ 254


>gi|83942492|ref|ZP_00954953.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sulfitobacter sp. EE-36]
 gi|83953711|ref|ZP_00962432.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sulfitobacter sp. NAS-14.1]
 gi|83841656|gb|EAP80825.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sulfitobacter sp. NAS-14.1]
 gi|83846585|gb|EAP84461.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sulfitobacter sp. EE-36]
          Length = 253

 Score =  273 bits (699), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 121/253 (47%), Positives = 174/253 (68%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE   KI+YEG EPGT++Q FKDD    N  + A + GKGVLNNR+SE+  T 
Sbjct: 1   MARRTKIYEGTAKILYEGPEPGTIVQHFKDDTTAFNAEKKAVIEGKGVLNNRLSEFFMTG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FI+R+NMREQL+R  E+IPL I VRN AAG L+ RL I EG+ LPR +VE+
Sbjct: 61  LNNIGVPTHFIKRLNMREQLIRQAEIIPLEIVVRNYAAGDLSTRLGIDEGMQLPRPIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           ++  +     LV+EEHI AF WA Q ++E++ +LS+R+NDFM+G+ + + I+LVDF+++ 
Sbjct: 121 HFKNNDLGDPLVTEEHIAAFGWAGQQDMEDILSLSLRVNDFMSGVMMAVGIRLVDFKLEV 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ + D  R+++ADEI PD CRLWD+   ++ DK  F +    L + Y+EVARRLG+  
Sbjct: 181 GRIYEGDFQRLIVADEISPDSCRLWDIETGQKLDKDVFRRDLGSLTDAYTEVARRLGVMP 240

Query: 241 KNEPALKENLILN 253
           K    + +  ++N
Sbjct: 241 KTSTPMMKPTLIN 253


>gi|254292982|ref|YP_003059005.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Hirschia
           baltica ATCC 49814]
 gi|254041513|gb|ACT58308.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Hirschia
           baltica ATCC 49814]
          Length = 258

 Score =  273 bits (697), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 142/252 (56%), Positives = 178/252 (70%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K KI+YEG EPGTLIQ+FKDD    N  + A L+GKGVLNNRISE +FT+
Sbjct: 1   MARGRKIYEGKAKILYEGPEPGTLIQYFKDDATANNAEKRAVLDGKGVLNNRISELVFTR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG IGIP +FI+RINMREQL++ VE+IPL +  RN AAGS+AKRL + EG  LPRSLVEF
Sbjct: 61  LGGIGIPTHFIKRINMREQLIKQVEVIPLEVVCRNVAAGSIAKRLGLEEGTQLPRSLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     LVSEEHI AF WA   E+++M +L++R+NDFM G+F  I I+LVDF+++ 
Sbjct: 121 YYKKDELGDPLVSEEHIGAFGWATAQEIDDMVSLALRVNDFMAGMFAAIGIRLVDFKVEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR  + D  R +LADEI PD CRLWD+   E+ DK RF +    + E Y+EVARRLGI K
Sbjct: 181 GRHYEGDSFRTILADEISPDSCRLWDMETNEKLDKDRFRRDMGGVTEAYAEVARRLGIIK 240

Query: 241 KNEPALKENLIL 252
           +NE       I+
Sbjct: 241 ENENGSGGAEIV 252


>gi|167647405|ref|YP_001685068.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caulobacter sp. K31]
 gi|167349835|gb|ABZ72570.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caulobacter sp. K31]
          Length = 252

 Score =  273 bits (697), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 133/240 (55%), Positives = 178/240 (74%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             R  +YE K KI+YEG EPGTLIQ+FKDD    N  + A L GKGV+NNRISEYM T+L
Sbjct: 3   TRRKKIYEGKAKILYEGPEPGTLIQYFKDDATAFNAQKKAVLEGKGVINNRISEYMMTRL 62

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
             IG+ ++FIRR+++REQL+++VE+IPL + VRN AAGS+A RL + EG  LPRS++EFY
Sbjct: 63  NAIGVQNHFIRRLSLREQLIKEVEIIPLEVVVRNIAAGSIATRLGLTEGTPLPRSIIEFY 122

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     +VSEEHITAFNWA   E+++M A+++R+ND+M+GLF  + I LVDF+I+ G
Sbjct: 123 YKDDKLGDPMVSEEHITAFNWAATQEIDDMMAMALRVNDYMSGLFSAVGITLVDFKIEFG 182

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKK 241
           R+ + D  R++LADEI PD CRLWD +  E+ DK RF +    ++E Y+EVARRLGI K+
Sbjct: 183 RIYEGDFSRVILADEISPDSCRLWDSTTNEKMDKDRFRRDLGNVIESYTEVARRLGIMKE 242


>gi|56551948|ref|YP_162787.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Zymomonas
           mobilis subsp. mobilis ZM4]
 gi|241761965|ref|ZP_04760050.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Zymomonas
           mobilis subsp. mobilis ATCC 10988]
 gi|260752503|ref|YP_003225396.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
 gi|81820886|sp|Q5NNN4|PUR7_ZYMMO RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|56543522|gb|AAV89676.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Zymomonas
           mobilis subsp. mobilis ZM4]
 gi|241373645|gb|EER63217.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Zymomonas
           mobilis subsp. mobilis ATCC 10988]
 gi|258551866|gb|ACV74812.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
          Length = 259

 Score =  273 bits (697), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 129/255 (50%), Positives = 180/255 (70%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGT+IQ+FKDD    N  +   ++GKGV+NNR+SE++FT 
Sbjct: 1   MSRRRQIYEGKAKILYEGPEPGTIIQYFKDDATAFNAQKKGMISGKGVINNRVSEHIFTL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IGIP +FIRR+NMREQLV+ VE+IP+ + +RN AAGSL+KRL I EG  LPR+++E+
Sbjct: 61  LAGIGIPTHFIRRLNMREQLVKQVEIIPIEVVIRNVAAGSLSKRLGIEEGTPLPRTIIEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    +V++EHI  F WA Q E+ ++  ++IR+NDFM+GLF  INI+LVDF+++ 
Sbjct: 121 YYKDDALNDPMVADEHIACFGWATQEEMHDIADMAIRVNDFMSGLFAAINIRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ ++D  R++LADEI PD CRLWD+   E+ DK RF +     +E Y E+ARRLG+  
Sbjct: 181 GRVWENDYSRVLLADEISPDGCRLWDMVTNEKLDKDRFRQDLGGEVEAYQEIARRLGLLP 240

Query: 241 KNEPALKENLILNRK 255
                   +L  +RK
Sbjct: 241 VEPDTEVLDLESHRK 255


>gi|58040725|ref|YP_192689.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Gluconobacter oxydans 621H]
 gi|81819010|sp|Q5FNL4|PUR7_GLUOX RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|58003139|gb|AAW62033.1| Phosphoribosylamidoimidazole-succinocarboxamide synthase PurS
           [Gluconobacter oxydans 621H]
          Length = 254

 Score =  272 bits (696), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 127/243 (52%), Positives = 175/243 (72%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K+++EG EPGTL+Q+FKDD    N  +   + GKGVLNNRISEY+  +
Sbjct: 1   MARRRQLYEGKAKVLFEGPEPGTLVQYFKDDATAGNGAKSGIITGKGVLNNRISEYLMLK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +I IP +FIRR+NMREQL+R+VE+IPL + VRN AAGSL+KRL IPEG  LPR+++E+
Sbjct: 61  LHEINIPTHFIRRLNMREQLIREVEIIPLEVVVRNVAAGSLSKRLGIPEGTRLPRTIIEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    +VSEEHI AFNWA   ++++M  L++R NDF+ G+F  + I LVDF+++ 
Sbjct: 121 YYKNDALGDPMVSEEHIAAFNWAAPQDMDDMNQLALRTNDFLMGMFTAVGITLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ + + +RI+LADEI PD CRLWD    E+ DK RF +   ++ E Y EVA+RLGI  
Sbjct: 181 GRIWEGEEMRILLADEISPDNCRLWDSKTNEKMDKDRFRRDMGRVEEAYQEVAKRLGILP 240

Query: 241 KNE 243
           ++ 
Sbjct: 241 ESG 243


>gi|16126730|ref|NP_421294.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caulobacter crescentus CB15]
 gi|221235512|ref|YP_002517949.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caulobacter crescentus NA1000]
 gi|22001869|sp|Q9A5F9|PUR71_CAUCR RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase 1; AltName: Full=SAICAR synthetase 1
 gi|13424046|gb|AAK24462.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caulobacter crescentus CB15]
 gi|220964685|gb|ACL96041.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Caulobacter crescentus NA1000]
          Length = 252

 Score =  272 bits (695), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 130/240 (54%), Positives = 178/240 (74%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             R  +YE K KI+YEG EPGTLIQ+FKDD    N  + A L GKGV+NNRISEY+ T+L
Sbjct: 3   TRRKKIYEGKAKILYEGPEPGTLIQYFKDDATAFNAQKKAILEGKGVINNRISEYIMTRL 62

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
             IG+ ++FIRR+N+REQL+++VE++PL + VRN AAGS+A RL + EG  LPRS++EFY
Sbjct: 63  NGIGVQNHFIRRLNLREQLIKEVEIVPLEVVVRNIAAGSIATRLGLTEGQPLPRSIIEFY 122

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     +V+EEHITAFNWA   E+++M A+++R+ND+++GLF G+ I LVDF+++ G
Sbjct: 123 YKDDKLGDPMVTEEHITAFNWAATQEIDDMMAMALRVNDYLSGLFAGVGITLVDFKVEFG 182

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKK 241
           R+ + D  R++LADEI PD CRLWD    E+ DK RF +    ++E Y+EVARRLGI K+
Sbjct: 183 RVYEGDFSRVILADEISPDSCRLWDTVTNEKLDKDRFRRDLGNVIESYTEVARRLGIMKE 242


>gi|302382426|ref|YP_003818249.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Brevundimonas subvibrioides ATCC 15264]
 gi|302193054|gb|ADL00626.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 253

 Score =  272 bits (695), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 129/240 (53%), Positives = 176/240 (73%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             R  +YE K KI+YEG EPGTLIQ+FKDD    N  + ATL GKGV+NNRISE++ ++L
Sbjct: 4   SKRKKIYEGKAKILYEGPEPGTLIQYFKDDATAFNAQKKATLEGKGVINNRISEFVMSRL 63

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
             IG+ ++FI+R+N+REQL+R+VE+IPL +  RN  AGSLA RL   EG  LPRS++EFY
Sbjct: 64  NGIGVTNHFIKRLNLREQLIREVEIIPLEVVCRNIVAGSLATRLGQEEGTPLPRSIIEFY 123

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     +V+EEHITAFNWAN  E++++ A ++R+ND++ G+F  + I LVDF+I+ G
Sbjct: 124 YKKDELNDPMVTEEHITAFNWANTQEIDDILATTVRVNDYLCGMFGAVGITLVDFKIEFG 183

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKK 241
           R+ ++D  R++LADEI PD CRLWD +  E+ DK RF +   Q++E Y+EVARRLGI K 
Sbjct: 184 RVWENDFSRVILADEISPDSCRLWDTATGEKMDKDRFRRDLGQVIENYTEVARRLGIMKD 243


>gi|315500051|ref|YP_004088854.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Asticcacaulis excentricus CB 48]
 gi|315418063|gb|ADU14703.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Asticcacaulis excentricus CB 48]
          Length = 252

 Score =  271 bits (694), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 125/240 (52%), Positives = 176/240 (73%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             R  +YE K KI+YEG EPGTL+Q+FKDD    N  + A L GKGV+NNRISE++ T+L
Sbjct: 3   TRRKKIYEGKAKILYEGPEPGTLVQYFKDDATAFNGEKKAQLEGKGVINNRISEFVMTRL 62

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            +IG+ ++FI+R+++REQL+R+VE+IPL +  RN  AGS+AKR N+PEG  LPRS++EFY
Sbjct: 63  TQIGVQNHFIKRLSLREQLIREVEIIPLEVVCRNVVAGSMAKRFNLPEGQQLPRSIIEFY 122

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     +++EEHITAFNWA   E++++ A+++R+NDF+ G+F  + I LVDF+I+ G
Sbjct: 123 YKNDEMGDPMITEEHITAFNWATTQEIDDILAMTLRVNDFLCGMFAAVGITLVDFKIEFG 182

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKK 241
           RL + +  R++LADEI PD CRLWD    E+ DK RF +    ++E Y+EVA+RLGI K 
Sbjct: 183 RLFEGEFARVILADEISPDSCRLWDTQSGEKLDKDRFRRDLGDVIESYTEVAKRLGIMKD 242


>gi|218460296|ref|ZP_03500387.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium
           etli Kim 5]
          Length = 237

 Score =  271 bits (694), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 153/237 (64%), Positives = 189/237 (79%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQFFKDD    N  +   ++GKGVLNNRISEY+F+ 
Sbjct: 1   MNRRRRIYEGKAKILYEGPEPGTLIQFFKDDATAFNKKKHEVIDGKGVLNNRISEYIFSH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L KIGIP +FIRR+NMREQL+++VEMIPL I VRN AAGSLAKRL I EG+ LPRS++EF
Sbjct: 61  LNKIGIPTHFIRRLNMREQLIKEVEMIPLEIVVRNVAAGSLAKRLGIEEGVVLPRSIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  +VSEEHITAF WAN +E++++ AL+IR+NDFMTGLFLG+ IQLVDF+I+C
Sbjct: 121 YYKSDALDDPMVSEEHITAFGWANPAELDDIMALAIRVNDFMTGLFLGVGIQLVDFKIEC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           GRL + D++RI+LADEI PD CRLWD+  +E+ DK RF +    LLE YSEVARRLG
Sbjct: 181 GRLFEGDMMRIILADEISPDSCRLWDIETREKMDKDRFRRDLGGLLEAYSEVARRLG 237


>gi|332186878|ref|ZP_08388620.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sphingomonas sp. S17]
 gi|332013211|gb|EGI55274.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sphingomonas sp. S17]
          Length = 259

 Score =  271 bits (694), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 134/255 (52%), Positives = 184/255 (72%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQ+FKDD    N  +  T+NGKGVLNNRISE++FT 
Sbjct: 1   MARRRQIYEGKAKILYEGPEPGTLIQYFKDDATAFNAQKKGTINGKGVLNNRISEHVFTM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQL+R VE++P+ + VRN AAGSL+KRL I EG+ LPR+++E+
Sbjct: 61  LDHIGVPTHFIRRLNMREQLIRQVEIVPIEVVVRNVAAGSLSKRLGIEEGVKLPRTIIEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    +V++EHI  F WA+Q E+ ++  L+IR+NDF++G+F  I I+LVDF+++ 
Sbjct: 121 YYKDDALGDPMVTDEHIACFGWASQEEMHDIADLAIRVNDFLSGMFAAIGIRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D+D  RI+LADEI PD CRLWD++  E+ DK RF +     +E Y EVARRLG+  
Sbjct: 181 GRIWDNDFGRIILADEISPDGCRLWDMTTNEKLDKDRFRRDLGGEVEAYQEVARRLGLLP 240

Query: 241 KNEPALKENLILNRK 255
           +       +L  +RK
Sbjct: 241 EGGDTAVLDLEEHRK 255


>gi|254486421|ref|ZP_05099626.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseobacter sp. GAI101]
 gi|214043290|gb|EEB83928.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseobacter sp. GAI101]
          Length = 255

 Score =  271 bits (694), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 125/253 (49%), Positives = 176/253 (69%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE   KI+YEG EPGT++Q+FKDD     + + AT+ GKGVLNNR+SE+  T 
Sbjct: 3   MARRTKIYEGTAKILYEGPEPGTIVQYFKDDTTAFQSEKRATIEGKGVLNNRLSEFFMTG 62

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FI+R+NMREQLVR  E++PL I VRN AAGS A RL I EG+ LPR +VE+
Sbjct: 63  LNNIGVPTHFIKRLNMREQLVRQAEIVPLEIVVRNYAAGSFASRLGIEEGIQLPRPIVEY 122

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           ++  +     LV+EEHI AF WA Q ++E++ +LS+R+NDFM+G+ + + I+LVDFRI+ 
Sbjct: 123 HFKNNDLGDPLVTEEHIAAFGWAGQQDMEDILSLSLRVNDFMSGVMMAVGIRLVDFRIEV 182

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D D  R+++ADEI PD CRLWD+   ++ DK  F +    L + Y+EVARRLG+  
Sbjct: 183 GRVYDGDFQRLIIADEISPDSCRLWDIETGQKLDKDVFRRDLGSLTDAYTEVARRLGVMP 242

Query: 241 KNEPALKENLILN 253
           K    + +  ++N
Sbjct: 243 KTSTPMMKPTLIN 255


>gi|149185945|ref|ZP_01864260.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Erythrobacter sp. SD-21]
 gi|148830506|gb|EDL48942.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Erythrobacter sp. SD-21]
          Length = 268

 Score =  271 bits (692), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 132/248 (53%), Positives = 175/248 (70%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGT+IQ+FKDD    N  +  T+NGKGV+NNRISEY+FT+
Sbjct: 1   MARRRQIYEGKAKILYEGPEPGTIIQYFKDDATAFNAEKKGTINGKGVINNRISEYVFTR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IGIP +FIRR+NMREQLVR VE+IPL + VRN AAGSL+KRL + EG  LP +L+E+
Sbjct: 61  LSHIGIPTHFIRRLNMREQLVRQVEIIPLEVVVRNVAAGSLSKRLGVEEGELLPHTLIEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
               D+     VSEE I  FNW +  E+++M++++IRINDF+ G+F  I+I+LVDF+++ 
Sbjct: 121 CLKDDALGDPKVSEEEIACFNWCSHEEMQDMSSMAIRINDFLCGMFAAIDIRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ D D  R +LADEI PD CRLWD++  E+ DK RF +      E Y EVARRLG+ +
Sbjct: 181 GRIWDGDYSRTILADEISPDGCRLWDINTGEKLDKDRFRRDMGGESEAYQEVARRLGLLQ 240

Query: 241 KNEPALKE 248
             +    E
Sbjct: 241 NEDNGPGE 248


>gi|307295591|ref|ZP_07575427.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sphingobium chlorophenolicum L-1]
 gi|306878630|gb|EFN09850.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sphingobium chlorophenolicum L-1]
          Length = 260

 Score =  270 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 138/255 (54%), Positives = 182/255 (71%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGT+IQ+FKDD    N  +  T++GKGVLNNRISE++FT 
Sbjct: 1   MARRRQIYEGKAKILYEGPEPGTIIQYFKDDATAFNAQKKGTISGKGVLNNRISEHIFTL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+IG+P +FIRR+NMREQLVR VE++P+ + VRN AAGSL+K+L I EG  LPR+L+E+
Sbjct: 61  LGQIGVPTHFIRRLNMREQLVRQVEIVPIEVVVRNVAAGSLSKKLGIEEGTQLPRTLIEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    LVSEEHI  F WA Q E+ ++  ++IRINDFM GLF GI I+L+DF+++ 
Sbjct: 121 CYKDDALGDPLVSEEHIACFGWATQEEMHDIADMAIRINDFMCGLFAGIGIRLIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL D D  R++LADEI PD CRLWD++  E+ DK RF +     +E Y EVARRLG+  
Sbjct: 181 GRLWDGDYSRVILADEISPDGCRLWDMATGEKLDKDRFRRDLGGEVEAYQEVARRLGLMP 240

Query: 241 KNEPALKENLILNRK 255
           +       +L  +RK
Sbjct: 241 EGADTTVLDLDTHRK 255


>gi|332970018|gb|EGK09016.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Desmospora sp. 8437]
          Length = 243

 Score =  269 bits (688), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 92/237 (38%), Positives = 131/237 (55%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K I+   +P  +   +KDD    N  +   + GKG LNNRIS + F  
Sbjct: 5   MSREELLYEGKAKKIFSTEDPDQVRVEYKDDATAFNGEKQGQIPGKGELNNRISAFFFEY 64

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+ GIPH+F+  ++ REQLV+ V ++P+ + VRN AAGSLA RL + EG    R +VEF
Sbjct: 65  LGRKGIPHHFLGTLSPREQLVKHVTILPVEVVVRNRAAGSLASRLGLEEGRVFSRPVVEF 124

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y   D     L++E+HI     A   +V  M   ++R+N+ ++ L     I LVDF+++ 
Sbjct: 125 YLKDDELGDPLINEDHIALLQLATGEQVTGMRETALRVNEHLSALMAEKGIILVDFKLEF 184

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G         ++LADEI PD CR WD    E+ DK RF +    + E Y E+  RLG
Sbjct: 185 GVD---SGGELLLADEISPDTCRFWDRETDEKLDKDRFRRDLGHVEEAYREIWHRLG 238


>gi|294011456|ref|YP_003544916.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sphingobium japonicum UT26S]
 gi|292674786|dbj|BAI96304.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sphingobium japonicum UT26S]
          Length = 260

 Score =  268 bits (684), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 138/255 (54%), Positives = 183/255 (71%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGT+IQ+FKDD    N  +  T++GKGVLNNRISE++FT 
Sbjct: 1   MARRRQIYEGKAKILYEGPEPGTIIQYFKDDATAFNAQKKGTISGKGVLNNRISEHIFTL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+IG+P +FIRR+NMREQLVR VE++P+ + VRN AAGSL+K+L I EG  LPR+L+E+
Sbjct: 61  LGQIGVPTHFIRRLNMREQLVRQVEIVPIEVVVRNVAAGSLSKKLGIEEGTQLPRTLIEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    LVSEEHI  F WA+Q E+ ++  ++IRINDFM GLF GI I+L+DF+++ 
Sbjct: 121 CYKDDALGDPLVSEEHIACFGWASQDEMHDIADMAIRINDFMCGLFAGIGIRLIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL D D  R++LADEI PD CRLWD++  E+ DK RF +     +E Y EVARRLG+  
Sbjct: 181 GRLWDGDYSRVILADEISPDGCRLWDMATGEKLDKDRFRRDLGGEVEAYQEVARRLGLMP 240

Query: 241 KNEPALKENLILNRK 255
           +       +L  +RK
Sbjct: 241 EGVDTTVLDLDTHRK 255


>gi|295695474|ref|YP_003588712.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           tusciae DSM 2912]
 gi|295411076|gb|ADG05568.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           tusciae DSM 2912]
          Length = 236

 Score =  268 bits (684), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 96/237 (40%), Positives = 140/237 (59%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R+ +YE K K +++  +P   +  +KDD    N  +   + GKG LNN+IS   F  
Sbjct: 1   MEKRDMLYEGKAKKVFKTDDPDLYVIEYKDDATAFNGQKRDQIAGKGELNNKISALFFEL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+  ++++R++ REQLVR V +IPL + VRN AAGSLAKRL   EG  LPR +VEF
Sbjct: 61  LRSKGLESHYVKRLSDREQLVRRVTIIPLEVVVRNIAAGSLAKRLGWEEGRELPRPVVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     L++E HI     A   +++++T  +++IN+ +T      NI LVDF+++ 
Sbjct: 121 YYKSDELGDPLINESHIAVLGVATPEQLDDITTQALKINEILTAYLRARNILLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G   +    R++LADEI PD CR WD + +E+ DK RF +    + E Y EV  RLG
Sbjct: 181 GLDAE---GRVLLADEISPDTCRFWDATTREKLDKDRFRRDLGGVEEAYEEVLHRLG 234


>gi|332654363|ref|ZP_08420107.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Ruminococcaceae bacterium D16]
 gi|332517449|gb|EGJ47054.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Ruminococcaceae bacterium D16]
          Length = 236

 Score =  267 bits (682), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 79/236 (33%), Positives = 124/236 (52%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +Y   +P  +I  +KDD    +  +  T+ GKG +NN+++ Y+  Q
Sbjct: 1   MNKLEQLYEGKAKKVYSTEDPNVVIVSYKDDATAFDGAKKGTITGKGAINNQMTNYLMQQ 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+P +F+  ++ RE  V+ V ++PL + VRN +AG  A    + EG+      +EF
Sbjct: 61  LETAGVPTHFVEELSERETAVKKVSIVPLEVIVRNISAGHFASNYGVKEGIVFDEPTIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A   A   E++ +   + ++NDF+        + LVDF+++ 
Sbjct: 121 SYKNDDLHDPLINDYHAVALKLATWDEIDLIKKYAFQVNDFLKKTLAECGVTLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+  D     IVLADEI PD CR WD    E+ DK RF +    +   Y E+ARRL
Sbjct: 181 GKTAD---GTIVLADEISPDTCRFWDSKTGEKLDKDRFRRDLGNVEGAYQEMARRL 233


>gi|329851330|ref|ZP_08266087.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Asticcacaulis biprosthecum C19]
 gi|328840176|gb|EGF89748.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Asticcacaulis biprosthecum C19]
          Length = 252

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 128/240 (53%), Positives = 177/240 (73%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             R  +YE K KI+YEG EPGTLIQ+FKDD    N  + A L GKGV+NNRISE++ T+L
Sbjct: 3   TRRKKIYEGKAKILYEGPEPGTLIQYFKDDATAFNAQKKAVLEGKGVINNRISEFVMTKL 62

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
             IG+ ++FI+R+N+REQL+R+VE+IPL +  RN  AGS+AKR  +PEG  LPRS++EFY
Sbjct: 63  TNIGVQNHFIKRLNLREQLIREVEIIPLEVVCRNVVAGSMAKRFGLPEGQQLPRSIIEFY 122

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D+ E  +V+EEH+TAFNWAN  E++++ A ++R+NDF++G+F  + I LVDF+I+ G
Sbjct: 123 YKNDALEDPMVTEEHVTAFNWANTQEIDDILATTLRVNDFLSGMFAAVGITLVDFKIEYG 182

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKK 241
           RL + D  R++LADEI PD CRLWD +  E+ DK RF +    ++E Y+EVA+RLGI   
Sbjct: 183 RLFEGDFSRVILADEISPDSCRLWDAATNEKLDKDRFRRDMGNVIESYTEVAKRLGIMGD 242


>gi|126725292|ref|ZP_01741134.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacterales bacterium HTCC2150]
 gi|126704496|gb|EBA03587.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacterales bacterium HTCC2150]
          Length = 253

 Score =  265 bits (677), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 119/253 (47%), Positives = 177/253 (69%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  RN +YE KTK++Y+G E GT +Q+FKDD    N  + A ++GKGVLNNR+SEY    
Sbjct: 1   MARRNKLYEGKTKVLYDGPEAGTFVQYFKDDTTAFNAEKQAVIDGKGVLNNRLSEYFMNG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P++F++R+NMREQL+R  EMIPL + VRN +AGS +KRL I EG  LPR +VEF
Sbjct: 61  LTTIGVPNHFLKRLNMREQLIRSAEMIPLELIVRNVSAGSFSKRLGIEEGTPLPRPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY        LV+EEHI A  WA+Q ++++M A+++R+NDF +G+  G+ I+L+DF+++ 
Sbjct: 121 YYKDKKLGNPLVAEEHIVALGWASQQDLDDMVAIALRVNDFTSGILFGVGIKLIDFKLEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ +++  R+++ADEI PD CRLWD+   E+ DK  F      + + Y+EVARRLG+ +
Sbjct: 181 GRIWENEYQRLIVADEISPDTCRLWDMETGEKLDKDVFRHDIGNVADAYTEVARRLGVLQ 240

Query: 241 KNEPALKENLILN 253
           +N   + +  ++N
Sbjct: 241 QNNQPVTKPTLIN 253


>gi|225574976|ref|ZP_03783586.1| hypothetical protein RUMHYD_03055 [Blautia hydrogenotrophica DSM
           10507]
 gi|225037823|gb|EEG48069.1| hypothetical protein RUMHYD_03055 [Blautia hydrogenotrophica DSM
           10507]
          Length = 235

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 84/238 (35%), Positives = 137/238 (57%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K ++   +P  +I  +KDD    N  +  T+ GKG +NNR++ ++F  
Sbjct: 1   MEKREQLYEGKAKKVFATDDPDVVIVSYKDDATAFNGEKKGTIVGKGAINNRMTNHVFKL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
             K G+P + I  +N RE  V+ V+++PL + +RN AAGS +KR+ + EG  L   ++EF
Sbjct: 61  FEKAGVPTHLIEELNDRETAVKKVDIVPLEVIIRNVAAGSFSKRMGVEEGRELLCPILEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D      +++++  A   A + E+ ++   ++++N+ M   FL  N++L+DF+I+ 
Sbjct: 121 SYKNDDLGDPFINDDYALALGLATKDELAKIREYTLKVNEIMKEYFLQANLKLIDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR        I+LADE+ PD CRLWD    E+ DK RF +    + E Y EV +RLG+
Sbjct: 181 GRFH----GEILLADEVSPDTCRLWDKDTNEKLDKDRFRRDLGNVEEAYQEVFKRLGL 234


>gi|239623699|ref|ZP_04666730.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridiales bacterium 1_7_47_FAA]
 gi|239521730|gb|EEQ61596.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridiales bacterium 1_7_47FAA]
          Length = 235

 Score =  263 bits (671), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 89/238 (37%), Positives = 138/238 (57%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K +Y   +P  LI  +KDD    N  +  T+ GKG +NNR++ ++F +
Sbjct: 1   MEKKEMLYEGKAKKVYTTEDPDVLIVSYKDDATAFNGLKKGTIVGKGAINNRMTNFIFKK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+P + +  +N RE  VR VE++PL + VRN +AGS AK++ + EG+      +EF
Sbjct: 61  LEEKGVPTHLVEELNDRETAVRKVEIVPLEVIVRNYSAGSFAKKMGMEEGIRFKCPTLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D      ++  +  A   A Q E++++T  + ++N+ +   F G+NI L+DF+I+ 
Sbjct: 121 SYKNDDLGDPFINSYYALALGLATQEEIDDITKYTFKVNEVLQEYFDGLNIDLIDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR       +I+LADEI PD CRLWD    E+ DK RF +    + + Y EV RRLGI
Sbjct: 181 GRYH----GKIILADEISPDTCRLWDKDTHEKLDKDRFRRDLGNVEDAYEEVFRRLGI 234


>gi|258510408|ref|YP_003183842.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
 gi|257477134|gb|ACV57453.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
          Length = 239

 Score =  262 bits (670), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 96/236 (40%), Positives = 136/236 (57%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K ++   +PG +   +KDD    N  +  T+ GKG +NN++S  +F  
Sbjct: 1   MAEETLLYEGKAKKVFATSDPGVVRVLYKDDATAFNGEKRGTIAGKGAINNQMSNLLFRY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+P +F+  I+ RE LVR VE+IPL + VRN AAGS +KR  I EG  L R LVEF
Sbjct: 61  LEEHGVPTHFVEEISERETLVRKVEIIPLEVVVRNIAAGSFSKRFGIEEGTPLERPLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    LV+++H    + A   ++ E+  L++ +ND +   F    + LVDF+++ 
Sbjct: 121 YYKNDALGDPLVTDDHALILHLATADDLAELRRLALAVNDLLVRRFREAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GRL       IVLADEI PD CRLWD   +E+ DK RF +    + E Y EV  RL
Sbjct: 181 GRLP---SGEIVLADEISPDTCRLWDERTREKLDKDRFRRDLGGVEEAYQEVWARL 233


>gi|266620473|ref|ZP_06113408.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium hathewayi DSM 13479]
 gi|288867925|gb|EFD00224.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium hathewayi DSM 13479]
          Length = 235

 Score =  262 bits (669), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 89/238 (37%), Positives = 137/238 (57%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K +Y   +P  LI  +KDD    N  +  T+ GKG +NNR++ ++F +
Sbjct: 1   MEKKELLYEGKAKKVYTTEDPDVLIVDYKDDATAFNGLKKGTIVGKGAINNRMTNHIFKK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+P +FI  ++ RE  V+ VE++PL + VRN +AGS AK++ + EG+      +EF
Sbjct: 61  LEAEGVPTHFIEELSDRETAVKKVEIVPLEVIVRNFSAGSFAKKMGMEEGIKFACPTLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D      ++  +  A N A Q E++ +T  + ++ND M   F  + I+L+DF+I+ 
Sbjct: 121 SYKNDDLGDPFINSYYALALNLATQEEIDAITKYTFKVNDVMREYFDSLGIELIDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR       +I+LADE+ PD CRLWD    E+ DK RF +    + + Y EV RRLGI
Sbjct: 181 GRYH----GQIILADEVSPDTCRLWDKETHEKLDKDRFRRDLGNVEDAYEEVFRRLGI 234


>gi|332982200|ref|YP_004463641.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Mahella
           australiensis 50-1 BON]
 gi|332699878|gb|AEE96819.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Mahella
           australiensis 50-1 BON]
          Length = 236

 Score =  261 bits (668), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 87/236 (36%), Positives = 143/236 (60%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K +Y   +P  +I  +KDD    N  +  T+ GKGV+NN++S ++F  
Sbjct: 1   MKKLEQLYEGKAKKVYATDDPDYVIVEYKDDATAFNGVKRGTIVGKGVVNNKVSNHLFKM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP +F+  ++ RE LV+ V+++P+ + VRN AAGS+++RL IPEG  L  +++E+
Sbjct: 61  LEGHGIPTHFVEELSDRETLVKKVDIVPVEVIVRNIAAGSISQRLGIPEGTVLKHTVLEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     +++  H+ A   A   E++ +  ++ ++ND ++     +NI+LVDF+++ 
Sbjct: 121 SYKNDELGDPMINAYHVYAMGLATPEEMKTIDDMAFKVNDILSDYLKDMNIRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR       +I+LADEI PD CR WD++  E+ DK RF +  D + E Y E+ RRL
Sbjct: 181 GRFH----GQIILADEISPDTCRFWDMTTNEKLDKDRFRRDLDHVEEAYQEILRRL 232


>gi|295110940|emb|CBL27690.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Synergistetes bacterium SGP1]
          Length = 234

 Score =  261 bits (667), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 90/236 (38%), Positives = 134/236 (56%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K ++   +P   +  +KDD    N  +  T+ GKGV+NNR+S  +F  
Sbjct: 1   MEKREQLYEGKAKKVFATDDPKRYVVEYKDDATAFNGEKRGTIAGKGVVNNRMSNILFRM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+P +F+  ++ RE LVR VE++PL + VRN AAGS +KR  + EG  L    +EF
Sbjct: 61  LEANGVPTHFVEELSDRETLVRAVEIVPLEVIVRNVAAGSFSKRYGVEEGRVLRNPTLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
               DS    L+++ HI A   A + E+  M  ++ ++ND +   FL I ++L+DF+I+ 
Sbjct: 121 SLKDDSLGDPLINDSHILALGLATEEELRTMHEMAFKVNDLLKDYFLKIGVKLIDFKIEL 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR       RIVLADEI PD CR WD    E+ DK RF +    + + Y E+ +R+
Sbjct: 181 GRC----DGRIVLADEISPDTCRFWDARTNEKLDKDRFRRDLGHVEDAYQEMFKRV 232


>gi|218288252|ref|ZP_03492551.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Alicyclobacillus acidocaldarius LAA1]
 gi|218241611|gb|EED08784.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Alicyclobacillus acidocaldarius LAA1]
          Length = 239

 Score =  261 bits (667), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 95/236 (40%), Positives = 136/236 (57%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K ++   +PG +   +KDD    N  +  T+ GKG +NN++S  +F  
Sbjct: 1   MAEETLLYEGKAKKVFATSDPGVVRVLYKDDATAFNGEKRGTIAGKGAINNQMSNLLFRY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+P +F+  I+ RE LVR VE+IPL + VRN AAGS +KR  I EG  L R L+EF
Sbjct: 61  LEEHGVPTHFVEEISERETLVRKVEIIPLEVVVRNIAAGSFSKRFGIEEGTPLERPLIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    LV+++H    + A   ++ E+  L++ +ND +   F    + LVDF+++ 
Sbjct: 121 YYKNDALGDPLVTDDHALILHLATVDDLAELRRLALAVNDLLVRRFREAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GRL       IVLADEI PD CRLWD   +E+ DK RF +    + E Y EV  RL
Sbjct: 181 GRLP---SGEIVLADEISPDTCRLWDERTREKLDKDRFRRDLGGVEEAYQEVWARL 233


>gi|148553030|ref|YP_001260612.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sphingomonas wittichii RW1]
 gi|166230843|sp|A5V2F8|PUR7_SPHWW RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|148498220|gb|ABQ66474.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sphingomonas wittichii RW1]
          Length = 258

 Score =  261 bits (667), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 132/243 (54%), Positives = 176/243 (72%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+YEG EPGTLIQ+FKDD    N  +  T+NGKGVLNNRISE++FT 
Sbjct: 1   MTRRRQIYEGKAKILYEGPEPGTLIQYFKDDATAFNAQKKGTINGKGVLNNRISEHIFTM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG IG+  +FIRR+NMREQL+R VE++P+ + VRN AAGSL KRL I EG  LPR+++E+
Sbjct: 61  LGTIGVATHFIRRLNMREQLIRQVEIVPIEVVVRNVAAGSLTKRLGIEEGTQLPRTIIEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    +V++EHI  F WA+Q E+ ++  ++IR+NDFM GLF GI I+LVDF+++ 
Sbjct: 121 YYKDDALGDPMVADEHIACFGWASQEEMHDIADMAIRVNDFMCGLFAGIGIRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR  D+D  R++LADEI PD CRLWD++  E+ DK RF +     +E Y E+ARRLG+  
Sbjct: 181 GRFWDNDYSRVILADEISPDGCRLWDMATGEKLDKDRFRQDLGGEVEAYQEIARRLGLMP 240

Query: 241 KNE 243
             E
Sbjct: 241 DGE 243


>gi|160939268|ref|ZP_02086619.1| hypothetical protein CLOBOL_04162 [Clostridium bolteae ATCC
           BAA-613]
 gi|158438231|gb|EDP15991.1| hypothetical protein CLOBOL_04162 [Clostridium bolteae ATCC
           BAA-613]
          Length = 235

 Score =  261 bits (667), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 86/238 (36%), Positives = 138/238 (57%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K +Y   +P  LI  +KDD    N  +  T+ GKG +NNR++ ++F +
Sbjct: 1   MEKKEMLYEGKAKKVYTTEDPDVLIVSYKDDATAFNGLKKGTIVGKGAINNRMTNFIFKK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+P + +  +N RE  V+ VE++PL + +RN +AGS AK++ + EG+      +EF
Sbjct: 61  LEEKGVPTHLVEELNDRETAVKKVEIVPLEVIIRNYSAGSFAKKMGMEEGIKFKCPTLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D      ++  +  A   A Q E++++T  + ++N+ +   F G+NI L+DF+I+ 
Sbjct: 121 SYKNDDLGDPFINSYYALALGLATQEEIDDITEYAFKVNEVLQEYFGGLNIDLIDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR       +++LADEI PD CRLWD    E+ DK RF +    + + Y EV RRLGI
Sbjct: 181 GRYH----GKVILADEISPDTCRLWDKDTHEKLDKDRFRRDLGNVEDAYEEVFRRLGI 234


>gi|291296667|ref|YP_003508065.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Meiothermus ruber DSM 1279]
 gi|290471626|gb|ADD29045.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Meiothermus ruber DSM 1279]
          Length = 238

 Score =  261 bits (666), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 95/241 (39%), Positives = 142/241 (58%), Gaps = 5/241 (2%)

Query: 1   MR--PRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMF 58
           M       +YE K KIIY   E G +  +FKDD    N  + A + GKG +NN+I+  +F
Sbjct: 1   MEEVRMEKLYEGKAKIIYPSSEAGMVRVYFKDDATAFNGQKRAQIAGKGAVNNQIASALF 60

Query: 59  TQLGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLV 118
             L + GIP +F+R+++ RE LVR V+++PL + VRN  AG+ A+R  + EG  LP+ L+
Sbjct: 61  GYLEEHGIPTHFVRQLSEREMLVRQVQIVPLEVIVRNRTAGTFARRYGVEEGRVLPKPLL 120

Query: 119 EFYYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRI 178
           EF Y  D+    L+  E   A    +++E+E + AL+++IN  +   F   N++LVDF++
Sbjct: 121 EFSYKNDALGDPLIYPEAALALGLLSEAELERIRALALQINTLLKDYFAQRNLELVDFKL 180

Query: 179 KCGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           + GRL D    R+VLADEI PD  RLW++   E+ DK RF +    + E Y EV RR+  
Sbjct: 181 EFGRLAD---GRLVLADEISPDTMRLWEMGSGEKMDKDRFRRDLGGVEEAYQEVLRRVQG 237

Query: 239 F 239
            
Sbjct: 238 L 238


>gi|198284092|ref|YP_002220413.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218665512|ref|YP_002426746.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|226723533|sp|B7J6C1|PUR7_ACIF2 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229485662|sp|B5ELM2|PUR7_ACIF5 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|198248613|gb|ACH84206.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218517725|gb|ACK78311.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 240

 Score =  260 bits (665), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 98/238 (41%), Positives = 135/238 (56%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+Y    P  L+  FKDD    +  +   L  KG +NN  + ++   
Sbjct: 1   MNERIALYEGKAKIVYASESPDELVLHFKDDTSAFDGEKVEQLAHKGEINNAFNAFIMEY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+P +FIRR+N RE LVR +EMIP+   VRN AAGSL+KRL I EG  L    +EF
Sbjct: 61  LQGEGVPTHFIRRLNARESLVRRLEMIPVECVVRNRAAGSLSKRLGIEEGRVLEPPTLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +++  HI  F WA   EVE M   ++R+N  ++ LF   N+ LVDF+++ 
Sbjct: 121 FLKNDALHDPMINTSHIRTFGWATAEEVEAMRRWTMRVNMLLSALFAKANLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR        + L DE  PD CRLWD    E+ DK RF +    ++E Y+EVARRLG+
Sbjct: 181 GRF----DGELYLGDEFSPDGCRLWDALSLEKMDKDRFRRGLGGVVEAYAEVARRLGV 234


>gi|262277066|ref|ZP_06054859.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [alpha
           proteobacterium HIMB114]
 gi|262224169|gb|EEY74628.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [alpha
           proteobacterium HIMB114]
          Length = 260

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 119/240 (49%), Positives = 165/240 (68%)

Query: 3   PRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLG 62
            R  +YE K KI+YEG E  TL+Q+FKDD    NN + A + GKGVLNNRISE++ +QL 
Sbjct: 2   RRKKIYEGKAKILYEGPERNTLVQYFKDDATAFNNKKKAVIEGKGVLNNRISEFLLSQLN 61

Query: 63  KIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYY 122
            IGI  + I+R+NMREQL+++ E++P+   VRN AAGSL+ RL I EG  L R ++E+YY
Sbjct: 62  DIGIETHLIKRLNMREQLIKNCEILPIEFVVRNIAAGSLSARLGIAEGTMLKRPIIEYYY 121

Query: 123 LPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGR 182
             D  +  LV+EEHI    WA+  E+ + +  + RINDF+ GLF G+ I+LVDF+++ GR
Sbjct: 122 KNDDLDDPLVTEEHIEVNGWASTLEIAQASETAFRINDFLIGLFRGVGIKLVDFKLEFGR 181

Query: 183 LLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKKN 242
           + + D  R++LADEI PD CRLWD   +++ DK RF K    L+E Y+EVA+RLGI  + 
Sbjct: 182 VWNADESRVILADEISPDTCRLWDTKDEKKLDKDRFRKGLGGLVEAYTEVAKRLGIMPEG 241


>gi|291520978|emb|CBK79271.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Coprococcus catus GD/7]
          Length = 235

 Score =  260 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 89/238 (37%), Positives = 137/238 (57%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K +Y    P  LI  +KDD    N  +  T+ GKGV+NNR++ ++F  
Sbjct: 1   MEKKELLYEGKAKKVYTTENPDVLIVDYKDDATAFNGVKKGTIVGKGVVNNRMTNHIFKM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP +FI  ++ RE  V+ VE++PL + VRN AAGS +K+L I EG  L    +EF
Sbjct: 61  LEEKGIPTHFIEELSDRETAVKKVEIVPLEVIVRNVAAGSFSKKLGIEEGFRLLSPTLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     ++++ +  A   A + E++++T L  +IN+ +   F  I + L+DF+++ 
Sbjct: 121 SYKNDELGDPMINDYYAVAIGAATREEIDKITELVFKINEILVDYFKSIKVDLIDFKVEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR       +I+LADEI PD CR WD    E+ DK RF +    + E Y E+ RR+G+
Sbjct: 181 GRY----KGQIILADEISPDTCRFWDSETHEKLDKDRFRRDLGHVEEAYEEIYRRIGL 234


>gi|302385975|ref|YP_003821797.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium saccharolyticum WM1]
 gi|302196603|gb|ADL04174.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium saccharolyticum WM1]
          Length = 235

 Score =  259 bits (661), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 86/238 (36%), Positives = 138/238 (57%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K +Y   +P  LI  +KDD    N  +  T+ GKG +NNR++ ++F +
Sbjct: 1   MEKKELLYEGKAKKVYTTEDPDVLIVSYKDDATAFNGLKKGTIVGKGAVNNRMTNFIFKK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+P + +  +N RE +V+ VE+IPL + +RN +AGS AK++ + EG+      +EF
Sbjct: 61  LEAKGVPTHLVEELNDRETVVKKVEIIPLEVIIRNYSAGSFAKKMGMEEGIKFACPTLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D      ++  +  A   A Q E++++T  + ++N+ +   F  +NI L+DF+I+ 
Sbjct: 121 SYKNDDLGDPFINSYYALALELATQDEIDKITEYAFKVNEVLKEYFDRLNIDLIDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR  +    +++LADEI PD CRLWD    E+ DK RF +    + + Y EV RRLGI
Sbjct: 181 GRYHN----QVILADEISPDTCRLWDKDTHEKLDKDRFRRDLGGVEDAYEEVFRRLGI 234


>gi|260892224|ref|YP_003238321.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ammonifex
           degensii KC4]
 gi|260864365|gb|ACX51471.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ammonifex
           degensii KC4]
          Length = 241

 Score =  259 bits (661), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 95/236 (40%), Positives = 134/236 (56%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K IY   +PG  +  FKD+    +  +   + GKGV NN IS Y F  
Sbjct: 1   MSKKEFLYEGKAKRIYRTDDPGKYLVEFKDEATAFDGKKRGIIEGKGVYNNLISAYFFKL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GIP +++  I+ RE LVR V ++PL + VRN  AGSL+KRL +PEG +LP  +VEF
Sbjct: 61  LEKEGIPTHYLETISDREMLVRAVTIVPLEVVVRNVVAGSLSKRLGLPEGTALPAPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +++  HI     A + E++ M  L++R N+ +        + LVDF+++ 
Sbjct: 121 YYKRDDLGDPMLNCSHIQVLGLATEEELKTMRELALRTNEVLRRHLEEKGLLLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR  +     I+LADEI PD CR WD +  E  DK RF +    + E Y+EV RRL
Sbjct: 181 GRTAE---GTIILADEISPDTCRFWDRATTERLDKDRFRRDLGGVAEAYAEVWRRL 233


>gi|210610316|ref|ZP_03288345.1| hypothetical protein CLONEX_00535 [Clostridium nexile DSM 1787]
 gi|210152546|gb|EEA83552.1| hypothetical protein CLONEX_00535 [Clostridium nexile DSM 1787]
          Length = 237

 Score =  258 bits (660), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 90/237 (37%), Positives = 132/237 (55%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K +++  EP  LI  +KDD    N  +  T+ GKGV+NN++S  +  +
Sbjct: 1   MQKAEQLYEGKAKKVFKTEEPEVLIVSYKDDATAFNGLKKGTIVGKGVINNKMSNLLMQR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GIP +FI  IN RE LV+ V ++PL + +RN AAGS +KR  + EGL      +EF
Sbjct: 61  LEKAGIPTHFIEEINDRETLVKKVSIVPLEVIIRNIAAGSFSKRYGVEEGLVFESPTIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L++  H  A   A + E+E +   +  +N+ +   +    + LVDF+++ 
Sbjct: 121 SYKNDDLGDPLLNTYHALAMKLATKEEIETIEKYAFGVNEQLKAFWKECGVTLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           GRL D     IVLADEI PD CRLWD    E+ DK RF +    + + Y E+ +RL 
Sbjct: 181 GRLSD---GTIVLADEISPDTCRLWDSKTGEKLDKDRFRRDLGGVEDAYQEIMKRLN 234


>gi|206896219|ref|YP_002246561.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Coprothermobacter proteolyticus DSM 5265]
 gi|229564387|sp|B5Y714|PUR7_COPPD RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|206738836|gb|ACI17914.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Coprothermobacter proteolyticus DSM 5265]
          Length = 236

 Score =  258 bits (660), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 93/237 (39%), Positives = 139/237 (58%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M   + +YE K K +Y+  +P   I  +KD+    +  +   + GKG +NN++S   F  
Sbjct: 1   MEKLDLLYEGKAKRVYKTDDPRYYIIEYKDEATAFDGKKKGIIQGKGTVNNKVSAVFFQL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+P +F+  ++  E LV+ VE+IPL + VRN AAGS+++RL + EG+   + +VEF
Sbjct: 61  LEENGVPTHFVELLSPTEMLVKRVEIIPLEVIVRNYAAGSISRRLGLEEGIKFDQPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     +V+  HI A   AN+ E+  +T  ++RIN  ++   LG NI LVDF+++ 
Sbjct: 121 CYKNDELGDPMVNNYHILAMKLANEEEINALTQQALRINQILSQFLLGKNIILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           GR    D   IVLADEI PD CR WD +  E+ DK RF +    + E Y E+ARRLG
Sbjct: 181 GRT---DEGDIVLADEISPDTCRFWDSATMEKLDKDRFRRDMGGVEEAYMEIARRLG 234


>gi|294084237|ref|YP_003550995.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292663810|gb|ADE38911.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 253

 Score =  258 bits (659), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 110/237 (46%), Positives = 158/237 (66%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             R  +YE K K+I+EG + GTLIQ+FKDD    N  +   + GKGVLNN ISE++   +
Sbjct: 7   NTRTMLYEGKAKVIFEGPDDGTLIQYFKDDATAFNAQKKDVIKGKGVLNNYISEHIMQAV 66

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
           G +GIP +F+ RIN REQL+R +E++P+ + VRN AAGS+  RL + EG  LP++L+EF 
Sbjct: 67  GAMGIPTHFLARINDREQLIRQLEIVPIEVIVRNVAAGSICSRLGLEEGEELPQTLIEFC 126

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
              D+    +++ EHI  F WA+  E+E +   ++RINDF+TGLF  I ++L+DF+++ G
Sbjct: 127 LKDDALGDPVIAPEHIFTFGWASPEELETICEDTLRINDFLTGLFHAIGVRLIDFKLEFG 186

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           R+  D  + I+LADEI PD CRLWD+   E+ DK RF +    L+E Y E+A RL I
Sbjct: 187 RIEIDGDIEIILADEISPDNCRLWDIHTNEKMDKDRFRRDLGGLIEAYQEIASRLNI 243


>gi|117923811|ref|YP_864428.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Magnetococcus sp. MC-1]
 gi|166229552|sp|A0L4X9|PUR7_MAGSM RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|117607567|gb|ABK43022.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Magnetococcus sp. MC-1]
          Length = 242

 Score =  258 bits (659), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 104/238 (43%), Positives = 147/238 (61%), Gaps = 1/238 (0%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K+++   +P  LIQ+FKDD    N  +  T+  KGV+N+ IS  ++  
Sbjct: 1   MQKGEKLYEGKAKVLFATDDPNMLIQYFKDDATAFNGIKKGTIADKGVVNSLISTRIYHI 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K+GIP +    ++ REQLV  VE++P+ + +RN  AGSLA+RL I EG  L R LVEF
Sbjct: 61  LEKVGIPTHLEELLSPREQLVHKVEILPIEVVIRNRVAGSLARRLGIEEGTELARPLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D  +  +V+ +H   F WA   E+EEM  +S+RIND + G F  I I L+D++++ 
Sbjct: 121 YYKNDELDDPMVTIDHAEVFGWAKHREIEEMIEMSLRINDILIGFFANIGIDLIDYKLEY 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GRL       +VLADEI PD CRLWD+   E+ DK RF +    + E Y EVARR+G+
Sbjct: 181 GRLA-VSPSTLVLADEISPDGCRLWDMETGEKLDKDRFRRDLGGVEEAYQEVARRMGL 237


>gi|85711709|ref|ZP_01042766.1| Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [Idiomarina baltica OS145]
 gi|85694569|gb|EAQ32510.1| Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [Idiomarina baltica OS145]
          Length = 237

 Score =  258 bits (658), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 88/238 (36%), Positives = 136/238 (57%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  RN +Y  K K +Y   +P  L+  F++D    +  +   L  KG++NNR + ++ TQ
Sbjct: 1   MEKRNELYRGKAKTVYTTDDPSRLVLEFRNDTSAFDGEKVEQLEDKGMVNNRFNHFIMTQ 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GIP      ++  E LV+ ++MIP+   VRN AAGSL +RL + EG +L     EF
Sbjct: 61  LEKAGIPTQLDELLSDTESLVKKLDMIPVECVVRNVAAGSLVRRLGVEEGKTLNPPTFEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E HI AF WA + ++E+M AL+ ++N  +  LF    + LVD++++ 
Sbjct: 121 FLKNDALHDPMVNEYHIEAFGWATKEQIEQMKALTFKVNSVLKSLFEQAGLLLVDYKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        ++VL DE  PD CRLWD   +E+ DK RF +    ++E Y EV +RLG+
Sbjct: 181 GVF----DGQLVLGDEFTPDGCRLWDAKTREKLDKDRFRQGLGGVVEAYKEVGQRLGV 234


>gi|167746351|ref|ZP_02418478.1| hypothetical protein ANACAC_01060 [Anaerostipes caccae DSM 14662]
 gi|317470760|ref|ZP_07930144.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Anaerostipes sp. 3_2_56FAA]
 gi|167654344|gb|EDR98473.1| hypothetical protein ANACAC_01060 [Anaerostipes caccae DSM 14662]
 gi|316901749|gb|EFV23679.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Anaerostipes sp. 3_2_56FAA]
          Length = 234

 Score =  257 bits (656), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 97/238 (40%), Positives = 142/238 (59%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K ++   +P  LI  +KDD    N  +  T+ GKGV+NNR+S YMF  
Sbjct: 1   MEKQELLYEGKAKKVFTTEDPDLLIVDYKDDATAFNGEKKGTIIGKGVVNNRMSNYMFKM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+P ++++ ++ RE +V+ VE++PL + +RN AAGS +KRL I EG  L    +EF
Sbjct: 61  LEEKGVPTHYVQELSDRETVVKKVEIVPLEVIIRNVAAGSFSKRLGIEEGFELLEPTLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L++E    A   +N+ EVE +T  + ++N+ +   F  I I+LVDF+I+ 
Sbjct: 121 SYKDDDLGDPLINEYFAYAIGISNRKEVERITEYAFKVNEALIEEFKKIGIKLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR  D     I+LADEI PD CRLWDL   ++ DK RF +    + E Y EV RRLG+
Sbjct: 181 GRYKD----EIILADEISPDTCRLWDLETNQKLDKDRFRRDLGDVEEAYEEVYRRLGL 234


>gi|56460566|ref|YP_155847.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Idiomarina loihiensis L2TR]
 gi|81821622|sp|Q5QU05|PUR7_IDILO RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|56179576|gb|AAV82298.1| Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [Idiomarina loihiensis L2TR]
          Length = 237

 Score =  257 bits (656), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 85/241 (35%), Positives = 136/241 (56%), Gaps = 4/241 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R+ +Y  K K +Y   +P  L+  F++D    +  +   L+ KG++NN+ + ++ ++
Sbjct: 1   MEKRSELYRGKAKTVYHTDDPNRLVLEFRNDTSAFDGEKVEQLDDKGMVNNKFNHFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP     R++  E LV+ ++MIP+   VRN AAGSL +RL + EG  L     EF
Sbjct: 61  LEEAGIPTQLDERLSDTESLVKKLDMIPVECVVRNVAAGSLVRRLGVEEGKELNPPTFEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E HI AF WA   ++E+M  L+ ++ND +  LF    + LVD++++ 
Sbjct: 121 FLKNDALHDPMVNEYHIQAFGWATAEQIEKMKELTFKVNDVLKALFADAGLLLVDYKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           G         I+L DE  PD CRLWD   +E+ DK RF +    ++E Y EVA+RLG+  
Sbjct: 181 GVF----DGEIMLGDEFTPDGCRLWDAETREKLDKDRFRQGLGGVVEAYREVAKRLGVTL 236

Query: 241 K 241
            
Sbjct: 237 D 237


>gi|71083825|ref|YP_266545.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Pelagibacter ubique HTCC1062]
 gi|91763139|ref|ZP_01265103.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Pelagibacter ubique HTCC1002]
 gi|123646407|sp|Q4FLJ7|PUR7_PELUB RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|71062938|gb|AAZ21941.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|91717552|gb|EAS84203.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Pelagibacter ubique HTCC1002]
          Length = 260

 Score =  257 bits (656), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 111/241 (46%), Positives = 164/241 (68%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K KIIY   +   +IQ+FKDD    NN + +T+ GKGVLNNRISE++ + 
Sbjct: 1   MKKGKKLYEGKAKIIYATSDKNLVIQYFKDDATAFNNLKKSTIEGKGVLNNRISEHILSN 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IGI ++ ++R+NMREQ+++ VE+IP+   VRN A GS+ KRL I +G  L + L+E+
Sbjct: 61  LTQIGIKNHLVKRLNMREQIIKLVEIIPIEFIVRNVATGSITKRLGIEDGTVLKQPLLEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
               D     L++EEHI AF+WA +SE+E++  + +RINDFM G+F G+ I+L+DF+++ 
Sbjct: 121 CLKDDKLGDPLIAEEHILAFDWATKSELEKVKKMILRINDFMIGMFRGVGIKLIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL ++    ++LADEI PD CRLWD    ++ DK RF K    L+  Y+EVA+RLGI  
Sbjct: 181 GRLKENGKNEVILADEISPDTCRLWDSITDKKLDKDRFRKDLGDLIPAYTEVAKRLGILH 240

Query: 241 K 241
           +
Sbjct: 241 E 241


>gi|225389206|ref|ZP_03758930.1| hypothetical protein CLOSTASPAR_02952 [Clostridium asparagiforme
           DSM 15981]
 gi|225044721|gb|EEG54967.1| hypothetical protein CLOSTASPAR_02952 [Clostridium asparagiforme
           DSM 15981]
          Length = 246

 Score =  256 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 85/238 (35%), Positives = 136/238 (57%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K +Y   +P  LI  +KDD    N  +  T+ GKG +NNR++ ++F +
Sbjct: 12  MEKKEMLYEGKAKKVYTTEDPDVLIVSYKDDATAFNGLKKGTIVGKGAINNRMTNFIFKK 71

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+P + +  +N RE  V+ VE++PL + +RN +AGS AK++ + EG+      +EF
Sbjct: 72  LEAQGVPTHLVEELNDRETAVKKVEIVPLEVIIRNYSAGSFAKKMGMEEGVKFKCPTLEF 131

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D      ++  +  A   A Q E++++T  + ++N+ +   F  +NI L+DF+I+ 
Sbjct: 132 SYKNDDLGDPFINSYYALALELATQEEIDDITKYAFKVNEVLQQYFDALNIDLIDFKIEF 191

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR       +++LADEI PD CRLWD    E+ DK RF +    + + Y EV RRLGI
Sbjct: 192 GRYH----GKVILADEISPDTCRLWDKDTHEKLDKDRFRRDLGGVEDAYEEVFRRLGI 245


>gi|226310184|ref|YP_002770078.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Brevibacillus brevis NBRC 100599]
 gi|254783939|sp|C0ZKC3|PUR7_BREBN RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|226093132|dbj|BAH41574.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Brevibacillus brevis NBRC 100599]
          Length = 239

 Score =  256 bits (654), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 97/237 (40%), Positives = 135/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K IY    P      +KDD    N  + A + GKG LNNRI+   FT 
Sbjct: 1   MEKQEQLYEGKAKRIYRTSLPDQYWVEYKDDATAFNGEKRAQITGKGELNNRITAIFFTM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI ++F+R ++  EQ+VR VE+IPL + VRN AAGSLAKRL + EG  LP+ +VEF
Sbjct: 61  LKERGIDNHFVRLLSATEQVVRKVEIIPLEVVVRNIAAGSLAKRLGMEEGTVLPQPVVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    LV+  HI     A++S+   +  + + +N+ +       NI LVDF+++ 
Sbjct: 121 YYKDDALGDPLVNASHIKVLGIASESDQATLERMGLAVNEVLVPYLRERNITLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G+  D     I+LADEI PD CR WD    E+ DK RF +    + E Y E+  RLG
Sbjct: 181 GKTAD---GEILLADEISPDTCRFWDSVTNEKLDKDRFRRDLGNVEEAYKEMLTRLG 234


>gi|312879924|ref|ZP_07739724.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Aminomonas paucivorans DSM 12260]
 gi|310783215|gb|EFQ23613.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Aminomonas paucivorans DSM 12260]
          Length = 239

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 100/236 (42%), Positives = 142/236 (60%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +Y   +P  ++  +KD     N  + AT+ GKG LNN IS ++F +
Sbjct: 1   MEKREFLYEGKAKKLYGTDDPTQVVVEYKDHLTAFNAQKKATMGGKGRLNNLISAHLFEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP +F R ++   QLV+ V + PL + VRN   GSL KRL I EG+ LPR LVEF
Sbjct: 61  LRDRGIPVHFERILDDVHQLVKKVVIFPLEVVVRNITTGSLCKRLGIREGMELPRPLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+ +  L+ E+H   F WA + E++ + AL++R+ND +  +F G+ I LVDF+++ 
Sbjct: 121 YYKEDALDDPLILEDHALLFGWATREELDTIKALALRVNDELREIFSGLGIILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR ++     ++LADEI PD CR WD S  +  DK RF K    +L  Y E+ RRL
Sbjct: 181 GRDME---GNLLLADEISPDTCRFWDRSTGDRLDKDRFRKDLGDVLGAYEEIWRRL 233


>gi|325661036|ref|ZP_08149663.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Lachnospiraceae bacterium 4_1_37FAA]
 gi|325472543|gb|EGC75754.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Lachnospiraceae bacterium 4_1_37FAA]
          Length = 236

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 90/239 (37%), Positives = 143/239 (59%), Gaps = 3/239 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K ++   +P  +I  +KDD    N  +  T++GKGV+NNR++ ++F  
Sbjct: 1   MKKMEQLYEGKAKRVFLTEDPEVVIVSYKDDATAFNGEKKGTISGKGVVNNRMTNHVFKM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           + K GIP + +  +N RE  V+ VE++PL + VRN AAGS +KR+ + EG  L   ++EF
Sbjct: 61  MEKEGIPTHLVEELNDRETAVKKVEIVPLEVIVRNVAAGSFSKRMGVEEGTELLCPILEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D      +++++  A   A Q E++ +   + ++N+F+ G FL   ++L+DF+I+ 
Sbjct: 121 SYKNDELGDPFINDDYALALGLAEQEEIDTIRTYAKKVNEFLKGYFLDAGMKLIDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
           GRL D     I+LADE+ PD CRLWD+   E+ DK RF +    + E Y EV RRLG+ 
Sbjct: 181 GRLPD---GTIILADEVSPDTCRLWDVDTNEKLDKDRFRRDMGNVEEAYEEVFRRLGLL 236


>gi|297616788|ref|YP_003701947.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Syntrophothermus lipocalidus DSM 12680]
 gi|297144625|gb|ADI01382.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Syntrophothermus lipocalidus DSM 12680]
          Length = 239

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 81/237 (34%), Positives = 131/237 (55%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +Y   +   ++  +KDD    +  +  T+  KG++NNR++  +F  
Sbjct: 1   MEKRELIYEGKAKRVYSTDDENLVVIEYKDDATAFDGKKKGTIESKGIVNNRVTSVLFKI 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP + ++ ++ R  L + + +IP+ + VRN  AGSLA RL + EG  LP  ++EF
Sbjct: 61  LEDNGIPTHLVKLLDGRNMLAKKLSIIPVEVVVRNRIAGSLATRLGLEEGAPLPNPILEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +V+E HI    WA   ++ EM  ++++IN  +       N++LVDF+++ 
Sbjct: 121 YYKSDELHDPMVNEYHILTMGWATPEQLAEMKEMALKINSVLVPFLRERNLELVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G        +++L DEI PD CRLWD+   E+ DK RF +   +  E Y EV +R+ 
Sbjct: 181 GV----HQGKVILGDEISPDTCRLWDVQTGEKLDKDRFRRDLGKEREAYIEVLQRME 233


>gi|152985125|ref|YP_001349736.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas aeruginosa PA7]
 gi|166230833|sp|A6V9K1|PUR7_PSEA7 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|150960283|gb|ABR82308.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas aeruginosa PA7]
          Length = 236

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 83/238 (34%), Positives = 131/238 (55%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K +Y   +   LI  F++D    +  R   L+ KG +NN+ + ++  +
Sbjct: 1   MEKREELYRGKAKSVYRTDDADRLILLFRNDTSAFDGKRIEQLDRKGAVNNKFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP  F   ++  E LV+ ++MIP+   VRN AAGSL +RL + EG++L     E 
Sbjct: 61  LEAAGIPTQFDTLLSDTECLVKKLDMIPVECVVRNFAAGSLVRRLGVEEGIALTPPTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+     ++E H+ AF WA   ++ +M   S ++N+ +  LF    + LVDF+++ 
Sbjct: 121 FLKNDALGDPFINESHVQAFGWATPEQLAQMKTYSFKVNEVLNKLFEEAGLLLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        +IVL DE  PD CRLWD   +++ DK RF +   +++E Y EVARRLG+
Sbjct: 181 GLFH----GQIVLGDEFSPDGCRLWDKETRKKMDKDRFRQGLGEVIEAYEEVARRLGV 234


>gi|226357165|ref|YP_002786905.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Deinococcus deserti VCD115]
 gi|259546829|sp|C1CYX1|PUR7_DEIDV RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|226319155|gb|ACO47151.1| putative Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           (SAICAR synthetase)
           (Phosphoribosylaminoimidazole-succinocarboxamide
           synthetase) [Deinococcus deserti VCD115]
          Length = 237

 Score =  255 bits (652), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 89/236 (37%), Positives = 136/236 (57%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M      YE K K +Y   + G  I  +KDD    N  + A + GKG +NN I+ +++  
Sbjct: 1   MTRGEMKYEGKAKRVYATEQAGEYIVEYKDDATAFNGVKKAQIMGKGEINNAITAHLYPL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP +F+ +++ REQ VR V ++P+ I VRN AAGS +KRL I EG  LPR +VE+
Sbjct: 61  LEAAGIPTHFLEKLSDREQRVRAVTIVPVEIIVRNVAAGSFSKRLGIEEGTPLPRPVVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    L++ +   A  WA ++++  +  LS+++ DF+   F    ++LVDF+++ 
Sbjct: 121 CYKSDALGDPLINTDTAVALGWATEADLARIRELSLQVRDFLVPYFEARGVRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+L       IVLADEI PD CR WD    E+ DK RF +    + + Y+E+ RR+
Sbjct: 181 GKL---SSGEIVLADEISPDTCRFWDAQTNEKMDKDRFRRDLGGVEDAYAEMLRRV 233


>gi|94984175|ref|YP_603539.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Deinococcus geothermalis DSM 11300]
 gi|167011916|sp|Q1J2B4|PUR7_DEIGD RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|94554456|gb|ABF44370.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Deinococcus geothermalis DSM 11300]
          Length = 241

 Score =  255 bits (652), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 86/234 (36%), Positives = 137/234 (58%), Gaps = 3/234 (1%)

Query: 3   PRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLG 62
                YE K K +Y    P   +  +KDD    N  + A + GKG +NN I+ ++F  L 
Sbjct: 2   KLEQRYEGKAKKVYATENPLEYVVEYKDDATAFNGVKRAQIVGKGQINNAITAHLFPLLE 61

Query: 63  KIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYY 122
           + G+P +F+ +++ REQ VR V +IP+ + VRN AAGS AKRL + EG  L R +VE+  
Sbjct: 62  EAGVPTHFLEKLSEREQRVRAVTIIPVEVIVRNVAAGSFAKRLGLEEGTPLARPVVEYCL 121

Query: 123 LPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGR 182
             D+    L++ +   A  WA++ +++ +  L++++ DF+T  F    I+L+DF+++ GR
Sbjct: 122 KSDALGDPLINTDTAVALGWASEDDLKRIRELALKVRDFLTPYFAARGIRLIDFKLEFGR 181

Query: 183 LLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
             D    +IVLADEI PD CR WD +  E+ DK RF +    + + Y+E+ RR+
Sbjct: 182 THD---GQIVLADEISPDTCRFWDAATNEKLDKDRFRRDLGGVEDAYAEMLRRV 232


>gi|169831785|ref|YP_001717767.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Desulforudis audaxviator MP104C]
 gi|169638629|gb|ACA60135.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Desulforudis audaxviator MP104C]
          Length = 244

 Score =  255 bits (652), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 99/236 (41%), Positives = 139/236 (58%), Gaps = 2/236 (0%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K IY   +PG  +  +KDD    +  +  T+ GKGV+NN +S ++F  
Sbjct: 9   MEKTEFLYEGKAKKIYRTPDPGLYLVEYKDDATAFDGLKKGTIAGKGVVNNLVSAHLFQL 68

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+P +F+  ++ RE +VR V +I L I VRN  AGSLAKRL + EGL L + +VE 
Sbjct: 69  LERHGVPTHFVELVSDREMVVRAVRIIALEIVVRNITAGSLAKRLGLEEGLVLDQPVVET 128

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     L++ +HI   N A   EVE M A ++ +N+ +     G  I LVDF+++ 
Sbjct: 129 YYKSDELHDPLINNDHIRLLNLAAPEEVEAMRAAALVVNEVLKEYLAGRGIDLVDFKLEF 188

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR LD    R+VLADEI PD CRLWD   K++ DK RF +    + E Y+E+ RRL
Sbjct: 189 GRTLD--DGRLVLADEISPDTCRLWDRDTKKKLDKDRFRRDLGGVEEAYAEIMRRL 242


>gi|307546167|ref|YP_003898646.1| phosphoribosylaminoimidazole-succinocarboxamidesy nthase [Halomonas
           elongata DSM 2581]
 gi|307218191|emb|CBV43461.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Halomonas
           elongata DSM 2581]
          Length = 250

 Score =  255 bits (652), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 82/238 (34%), Positives = 129/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K +Y   +P  LI  F+DD    +  R  +L  KG +NNR + ++  +
Sbjct: 14  MDKRQELYAGKAKSVYATDDPDRLILHFRDDTSAFDGERMESLARKGKVNNRFNAFIMEK 73

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP ++ R ++  E +V+ ++M+P+   +RN AAG L KRL + EG  L     E 
Sbjct: 74  LQAAGIPTHYERLLSDTESVVKKLDMLPVECVIRNIAAGGLVKRLGVEEGSELAPPTFEL 133

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +++E     F WA   ++ EM +L+ R+ND +  LF   ++ LVD++++ 
Sbjct: 134 FLKNDALHDPMINESLAETFGWATPEQLAEMKSLTYRVNDVLKQLFADGDLLLVDYKLEF 193

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         IVL DE  PD CRLWD   +E+ DK RF +    ++E Y EV RR+G+
Sbjct: 194 GLF----NGEIVLGDEFSPDGCRLWDAKTREKLDKDRFRQGLGGVIEAYEEVGRRIGV 247


>gi|225850078|ref|YP_002730312.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Persephonella marina EX-H1]
 gi|254783969|sp|C0QUE7|PUR7_PERMH RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|225645335|gb|ACO03521.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Persephonella marina EX-H1]
          Length = 238

 Score =  255 bits (651), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 96/236 (40%), Positives = 140/236 (59%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KIIY   EP  +I ++KD     +  + AT+ GKGVLNN+I+ + F  
Sbjct: 1   MEKREKLYEGKAKIIYATDEPDKVIAYYKDSATAFDAIKKATIEGKGVLNNKIASFFFQL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP +FI++I+ RE L+  V++IP+ + VRN AAGS+ KRL IPE       LVEF
Sbjct: 61  LNEKGIPTHFIKQISDREMLIYKVDIIPVEVVVRNIAAGSIVKRLGIPEKKEFDPPLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y   D     ++ E+HI A + A   EV++M  L++++ND +        I LVDF+++ 
Sbjct: 121 YLKNDELHDPIICEQHIYAMDLAKPEEVQKMKELALKVNDVLREFMREQGIILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR       +I+LADEI PD CR WD    E+ DK RF      L+EGY+++  ++
Sbjct: 181 GR----KDGQIILADEISPDTCRFWDAKTGEKLDKDRFRFDLGDLIEGYTKILEKI 232


>gi|330814232|ref|YP_004358471.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487327|gb|AEA81732.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Pelagibacter sp. IMCC9063]
          Length = 260

 Score =  255 bits (651), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 123/242 (50%), Positives = 166/242 (68%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K KI+Y G E GT IQ+FKDD    NN + A ++GKGVLNNRISE++  Q
Sbjct: 1   MSRGKKIYEGKAKILYAGPERGTYIQYFKDDATAFNNVKKAVIDGKGVLNNRISEFLLNQ 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  + I+R+NMREQL++ VE+IP+   VRN AAGSL+KRL IPEG  L R ++E+
Sbjct: 61  LNEMGIETHLIKRVNMREQLIKAVEIIPIEFVVRNIAAGSLSKRLGIPEGTQLKRPIIEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    LV+EEHI   +WA+  E+   T  S+R+NDF+ GLF  + I+LVDF+++ 
Sbjct: 121 YYKDDALGDPLVTEEHIDINDWASMEEISIATDTSLRVNDFLIGLFRAVGIKLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+  DD  R++LADEI PD CRLWD+  + + DK RF K    L+E Y EVA+RLGI  
Sbjct: 181 GRIWKDDEKRVILADEISPDTCRLWDVKDERKLDKDRFRKDLGGLMEAYQEVAKRLGIMP 240

Query: 241 KN 242
           + 
Sbjct: 241 EG 242


>gi|254455888|ref|ZP_05069317.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082890|gb|EDZ60316.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Pelagibacter sp. HTCC7211]
          Length = 261

 Score =  255 bits (650), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 110/241 (45%), Positives = 162/241 (67%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K KIIY   + G +IQ+FKDD    NN + + + GKGVLNNRISE++ + 
Sbjct: 1   MKKGKKLYEGKAKIIYATNDKGLVIQYFKDDATAFNNQKKSVIEGKGVLNNRISEHILSN 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +IGI ++ ++R+NMREQ+++ VE+IP+   VRN A+GS+ KRL I +G  L   L+E+
Sbjct: 61  LSQIGIKNHLVKRLNMREQVIKLVEIIPIEFIVRNVASGSITKRLGIEDGTVLKEPLIEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
               D     L++EEHI AF WA + E+E++  + +RINDFM G+F G+ I+L+DF+++ 
Sbjct: 121 CLKDDKLGDPLIAEEHILAFEWATKKEIEKVKKMILRINDFMIGMFRGVGIKLIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRL  +    ++LADEI PD CRLWD    ++ DK RF K+   L+  Y+EVA+RLGI  
Sbjct: 181 GRLKVNGKDEVILADEISPDTCRLWDSITDKKLDKDRFRKNLGDLIPAYTEVAKRLGILH 240

Query: 241 K 241
           +
Sbjct: 241 E 241


>gi|289423548|ref|ZP_06425349.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Peptostreptococcus anaerobius 653-L]
 gi|289156050|gb|EFD04714.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Peptostreptococcus anaerobius 653-L]
          Length = 234

 Score =  255 bits (650), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 90/237 (37%), Positives = 139/237 (58%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     VYE K K +++   P  +I  +KDD    N  +  T+ GKGV+NN +S  +F  
Sbjct: 1   MEKLEQVYEGKAKKVFKTENPDYVIVSYKDDATAFNGLKKGTIEGKGVINNLMSNKLFEY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+  +F+  I+ R+ +V+ VE++PL + VRN AAGS +KRL + EG    +  VEF
Sbjct: 61  LEKNGVNTHFVETIDNRDTVVKHVEIVPLEVIVRNVAAGSFSKRLGVEEGTPFDQPTVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++    A   A Q E++++ ++++++N+ +  LFL  NI+L+DF+++ 
Sbjct: 121 SYKNDDLGDPLINDSFALALKLATQEEIDQIKSMALKVNELLKDLFLECNIKLIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           GR       +I+LADEI PD CRLWD    E+ DK RF +    +   Y+EV RRLG
Sbjct: 181 GRFH----GQIILADEISPDTCRLWDKETNEKLDKDRFRRDMGNVEGAYAEVRRRLG 233


>gi|319790145|ref|YP_004151778.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermovibrio ammonificans HB-1]
 gi|317114647|gb|ADU97137.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermovibrio ammonificans HB-1]
          Length = 241

 Score =  255 bits (650), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 95/236 (40%), Positives = 138/236 (58%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K++Y+      L+ +FKDD    +  +   L  KGV+N  IS  +F  
Sbjct: 1   MEKREKLYEGKAKVLYKTDSDNLLVAYFKDDTTAFDGAKKEVLEDKGVINCAISTVIFEY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI  +F+ R++ RE LV+  E+IP+ + VRN AAGS ++R  +PEG  L   LVE+
Sbjct: 61  LEKHGIKTHFVERLSPREMLVKKCEIIPVEVVVRNVAAGSFSRRYGVPEGTPLKEPLVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +Y  D     +V   H+  F WA + E+ +MT +++ +N+ +   F  I+IQLVDF+++ 
Sbjct: 121 FYKNDELHDPMVCPNHVYLFGWATREELGQMTKIALEVNELLKKFFDEIDIQLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR        I+LADEI PD CRLWD S  E  DK RF K   +++E Y EV RR+
Sbjct: 181 GRC----NGEIILADEITPDSCRLWDKSSGEVLDKDRFRKDMGKVVESYKEVYRRI 232


>gi|83647585|ref|YP_436020.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Hahella
           chejuensis KCTC 2396]
 gi|123531602|sp|Q2SCM9|PUR7_HAHCH RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|83635628|gb|ABC31595.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Hahella
           chejuensis KCTC 2396]
          Length = 236

 Score =  255 bits (650), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 82/238 (34%), Positives = 138/238 (57%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K I++  +    +  F+DD    +  + A L+ KG +NN+ + ++ ++
Sbjct: 1   MQKLEELYSGKAKSIFKTDDADLFVMEFRDDTSAFDGVKKAKLSRKGEVNNKFNAFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+P +F+R ++ RE LV+ ++MIP+   VRN AAGSL +RL + EG+ L     E 
Sbjct: 61  LAEAGVPVHFVRLLSERESLVKRLQMIPVECVVRNVAAGSLCRRLGVREGMVLTPPTYEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D     +++E H  AF WA  +++EEM AL+ ++ND +  LF    + LVD++++ 
Sbjct: 121 FLKNDELHDPMINEHHARAFGWATDAQLEEMKALTFKVNDILKALFDAAGMTLVDYKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G +      ++ L DE  PD CR+WD +  E+ DK RF +    ++E Y EV RRLG+
Sbjct: 181 GLI----DGKVTLGDEFSPDGCRIWDKATGEKMDKDRFRQDLGDVIEYYEEVGRRLGV 234


>gi|262370800|ref|ZP_06064124.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter johnsonii SH046]
 gi|262314162|gb|EEY95205.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter johnsonii SH046]
          Length = 239

 Score =  254 bits (649), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 86/238 (36%), Positives = 129/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +Y  K K +YE      LI  F+DD    N  +   L+ KG +NNR + ++  +
Sbjct: 1   MLKQTLLYTGKAKSVYETDSADHLILVFRDDASAFNGEKIEQLDRKGKVNNRFNAFIMDK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +F + ++  E LV+ + MIP+   +RN AAGSL +RL + EG  L     E 
Sbjct: 61  LAAAGIETHFEKLLSPTEVLVKKLSMIPVECVIRNYAAGSLCRRLGVEEGKELTPPTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           ++  D+    +V+E    A  WA   ++E+M  L+ ++N+ +  LF    + LVDF+++ 
Sbjct: 121 FFKDDALGDPMVNESQAIALGWATAEQLEQMKVLTYQVNEVLKNLFDQGGMLLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G   D    RIVL DE  PD CRLWD   K++ DK RF +    ++E Y EVA RLGI
Sbjct: 181 GVFHD----RIVLGDEFSPDGCRLWDKETKKKLDKDRFRQGLGGVVEAYEEVAARLGI 234


>gi|304436690|ref|ZP_07396659.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Selenomonas sp. oral taxon 149 str. 67H29BP]
 gi|304370386|gb|EFM24042.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Selenomonas sp. oral taxon 149 str. 67H29BP]
          Length = 237

 Score =  254 bits (649), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 91/236 (38%), Positives = 140/236 (59%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K KIIY    P   + ++KDD    N  +  T+ GKG++NN++S + F  
Sbjct: 1   MERKEALYEGKAKIIYATDNPNEYLVYYKDDATAGNGAKRGTIVGKGIMNNKMSAFFFDL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI H++I   + RE LV+ + +IPL + +RN AAGSLAKRL + EG+ +P  ++E+
Sbjct: 61  LAKEGIAHHYISMPSDREMLVKKLTIIPLEVIIRNVAAGSLAKRLGLEEGVPMPFPVIEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     +++  HI A   A  +E++E+  +S++IND +T       + L+DF+++ 
Sbjct: 121 CYKNDDLGDPMLNRYHIRAMKIATDAELDEIERMSLKINDILTKFLKSKKVDLIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR  D    +I+LADEI PD CR WD   KE+ DK RF +    + + Y E+ RRL
Sbjct: 181 GRDAD---GKIILADEISPDNCRFWDSDTKEKLDKDRFRRDLGNVEDAYKEMLRRL 233


>gi|258544222|ref|ZP_05704456.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Cardiobacterium hominis ATCC 15826]
 gi|258520536|gb|EEV89395.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Cardiobacterium hominis ATCC 15826]
          Length = 241

 Score =  254 bits (649), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 91/243 (37%), Positives = 133/243 (54%), Gaps = 3/243 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K+K IY   +P  +I  + DD    N  +   + GKG+LNNRI+  +F  
Sbjct: 1   MEKRALLYTGKSKAIYATDDPDLVIIHYNDDATAGNGAKHEIIEGKGILNNRIATLIFRA 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP ++   +N REQL   VE+IPL + VRN  AGS+A RL   EG      + E 
Sbjct: 61  LIAAGIPTHYRDTLNEREQLCEKVEIIPLEVIVRNVIAGSMAARLGFEEGSETEYPIFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    L++++H  A   A+  +++ +  L+ +IN  +  +F   ++ LVDF+I+ 
Sbjct: 121 CYKNDALGDPLINDDHAVALGIASYEDLDRIYELTDQINATLFDIFDECDVLLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR  D     IVLADEI PD CRLWD    E+ DK RF +    LLE Y ++  RL   +
Sbjct: 181 GRTAD---GEIVLADEISPDSCRLWDADTLEKLDKDRFRRDMGGLLEAYQDILDRLEERE 237

Query: 241 KNE 243
           +N+
Sbjct: 238 END 240


>gi|49081926|gb|AAT50363.1| PA1013 [synthetic construct]
          Length = 237

 Score =  254 bits (649), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 82/238 (34%), Positives = 132/238 (55%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K +Y+  +   LI  F++D    +  R   L+ KG +NN+ + ++  +
Sbjct: 1   MEKREELYRGKAKSVYQTDDADRLILLFRNDTSAFDGKRIEQLDRKGAVNNKFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP  F + ++  E LV+ ++MIP+   VRN AAGSL +RL + EG++L     E 
Sbjct: 61  LEAAGIPTQFDKLLSDTECLVKKLDMIPVECVVRNFAAGSLVRRLGVEEGIALTPPTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+     ++E H+ AF WA   ++ +M   S ++N+ +  LF    + LVDF+++ 
Sbjct: 121 FLKNDALGDPFINESHVQAFGWATPEQLAQMKTYSFKVNEVLNKLFDDAGLLLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        +IVL DE  PD CRLWD   +++ DK RF +    ++E Y EVA+RLG+
Sbjct: 181 GLFH----GQIVLGDEFSPDGCRLWDKETRKKMDKDRFRQGLGDVIEAYEEVAKRLGV 234


>gi|121535463|ref|ZP_01667273.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermosinus carboxydivorans Nor1]
 gi|121305972|gb|EAX46904.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermosinus carboxydivorans Nor1]
          Length = 238

 Score =  254 bits (648), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 93/236 (39%), Positives = 136/236 (57%), Gaps = 5/236 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M    P+YE K K IY       L+ ++KDD    N  +  T+  KGVLNN+IS + F  
Sbjct: 1   MEK-QPLYEGKAKKIYATDNADELLVYYKDDATAFNGIKRGTILNKGVLNNKISAFFFEL 59

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LGK GI H++IR I+ RE LV+ ++++P+ + VRN AAGSLAKR+   EG  LP +++EF
Sbjct: 60  LGKHGIKHHYIRTISDREMLVKTLKILPVEVVVRNIAAGSLAKRIGWEEGKKLPTTVLEF 119

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     L+++ HI A   A + +V+ M   +++IND +       N++L+DF+++ 
Sbjct: 120 YYKNDELGDPLINDYHIKALGLATEDQVKTMAETALKINDILGAYLKEKNLELIDFKLEF 179

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G         ++L DEI PD CR WD    E+ DK RF +    + E Y EV  RL
Sbjct: 180 GL----HKGELLLGDEISPDTCRFWDSRTGEKLDKDRFRRDLGNVEEAYKEVLYRL 231


>gi|15596210|ref|NP_249704.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas aeruginosa PAO1]
 gi|107100454|ref|ZP_01364372.1| hypothetical protein PaerPA_01001479 [Pseudomonas aeruginosa PACS2]
 gi|116048941|ref|YP_792258.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218893027|ref|YP_002441896.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas aeruginosa LESB58]
 gi|254239350|ref|ZP_04932673.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas aeruginosa C3719]
 gi|254245286|ref|ZP_04938608.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas aeruginosa 2192]
 gi|296390629|ref|ZP_06880104.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas aeruginosa PAb1]
 gi|22001873|sp|Q9I4W0|PUR7_PSEAE RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|122258048|sp|Q02IH8|PUR7_PSEAB RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|226723550|sp|B7UXT0|PUR7_PSEA8 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|9946923|gb|AAG04402.1|AE004533_13 phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas aeruginosa PAO1]
 gi|61969326|emb|CAH61044.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas aeruginosa]
 gi|115584162|gb|ABJ10177.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126171281|gb|EAZ56792.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas aeruginosa C3719]
 gi|126198664|gb|EAZ62727.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas aeruginosa 2192]
 gi|218773255|emb|CAW29067.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Pseudomonas aeruginosa LESB58]
          Length = 236

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 82/238 (34%), Positives = 132/238 (55%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K +Y+  +   LI  F++D    +  R   L+ KG +NN+ + ++  +
Sbjct: 1   MEKREELYRGKAKSVYQTDDADRLILLFRNDTSAFDGKRIEQLDRKGAVNNKFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP  F + ++  E LV+ ++MIP+   VRN AAGSL +RL + EG++L     E 
Sbjct: 61  LEAAGIPTQFDKLLSDTECLVKKLDMIPVECVVRNFAAGSLVRRLGVEEGIALTPPTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+     ++E H+ AF WA   ++ +M   S ++N+ +  LF    + LVDF+++ 
Sbjct: 121 FLKNDALGDPFINESHVQAFGWATPEQLAQMKTYSFKVNEVLNKLFDDAGLLLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        +IVL DE  PD CRLWD   +++ DK RF +    ++E Y EVA+RLG+
Sbjct: 181 GLFH----GQIVLGDEFSPDGCRLWDKETRKKMDKDRFRQGLGDVIEAYEEVAKRLGV 234


>gi|15805262|ref|NP_293950.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Deinococcus radiodurans R1]
 gi|6457896|gb|AAF09811.1|AE001884_6 phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Deinococcus radiodurans R1]
          Length = 294

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 84/236 (35%), Positives = 133/236 (56%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M      YE K K +Y    P   +  +KDD    N  +     GKG  NN I+ +++ Q
Sbjct: 58  MTRGEMKYEGKAKRVYATENPHEYVVEYKDDATAFNAQKRGEWAGKGATNNAITAHLYPQ 117

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP +F+ +++ REQ V+ V ++P+ + VRN AAGS +KRL + EG  LPR +VE+
Sbjct: 118 LEAAGIPTHFLEKLSDREQRVKAVTIVPVEVIVRNVAAGSFSKRLGVEEGTPLPRPVVEY 177

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    L++ +   A  WA++ +++ +  L+++I DF+   F    ++L+DF+++ 
Sbjct: 178 CYKSDALGDPLINTDTAVALGWASEDDLKRIRELALQIRDFLVPYFEKRGVRLIDFKLEF 237

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+L       IVLADEI PD CR WD    E+ DK RF +      E Y+E+ +R+
Sbjct: 238 GKLP---SGEIVLADEISPDTCRFWDAETNEKMDKDRFRRDLGGEAEAYAEMLKRV 290


>gi|146329516|ref|YP_001209996.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Dichelobacter nodosus VCS1703A]
 gi|166229545|sp|A5EXP1|PUR7_DICNV RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|146232986|gb|ABQ13964.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Dichelobacter nodosus VCS1703A]
          Length = 239

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 89/239 (37%), Positives = 128/239 (53%), Gaps = 3/239 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+  + +Y  K K +Y    P  +I  + DD    N  + A +  KG+LNN+I+  +F  
Sbjct: 1   MQKHDLLYSGKAKSVYATDNPTQIIMHYNDDATAGNGAKHAVIADKGILNNQITTLIFKV 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L    IP + I  +N REQL + V + PL + VRNT AGS+AKRL + EG  L   + E 
Sbjct: 61  LKAADIPTHHIETLNDREQLCQKVTIFPLEVIVRNTVAGSMAKRLGMEEGTELDNVVFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L++++H  A   A+  +++ +  L+ +IN  ++ LF    I LVDF+I+ 
Sbjct: 121 CYKNDKLNDPLINDDHAVALGAASYEDLDTIYELTDKINQSLSALFAACQINLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
           GR        IVLADEI PD CRLWD+    + DK RF +    L + Y EV RRL   
Sbjct: 181 GRT---AAGEIVLADEISPDTCRLWDMQTNNKLDKDRFRRDLGGLTDAYREVLRRLQQL 236


>gi|153814544|ref|ZP_01967212.1| hypothetical protein RUMTOR_00758 [Ruminococcus torques ATCC 27756]
 gi|145848038|gb|EDK24956.1| hypothetical protein RUMTOR_00758 [Ruminococcus torques ATCC 27756]
          Length = 255

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 89/238 (37%), Positives = 136/238 (57%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K ++   +P  +I  +KDD    N  +  T+ GKGV+NNR++ Y+F  
Sbjct: 21  MKKLEQLYEGKAKKVFATEDPDVVIVDYKDDATAFNGEKKGTIVGKGVINNRMTNYVFQV 80

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+P +++  ++ RE  V+ VE++PL + VRN AAGS +KRL I EG  L    +EF
Sbjct: 81  LEKEGVPTHYVEELSDRETAVKKVEIVPLEVIVRNVAAGSFSKRLGIEEGRKLLAPTLEF 140

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++    A   A + E++++T  + ++ND +   F    I L+DF+I+ 
Sbjct: 141 SYKDDDLGDPLINDYFAIAIGAATREEIDKITEYTFKVNDVLKKFFDEAGIDLIDFKIEF 200

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR        I+LADEI PD CRLWD    E+ DK RF +    + + Y EV +R+GI
Sbjct: 201 GRYH----GDIILADEISPDTCRLWDKETHEKLDKDRFRRDMGNVEDAYQEVFKRIGI 254


>gi|313105956|ref|ZP_07792218.1| phosphoribosylaminoimidazole-succinocarboxamidesy nthase
           [Pseudomonas aeruginosa 39016]
 gi|310878720|gb|EFQ37314.1| phosphoribosylaminoimidazole-succinocarboxamidesy nthase
           [Pseudomonas aeruginosa 39016]
          Length = 236

 Score =  253 bits (647), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 82/238 (34%), Positives = 133/238 (55%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K +Y+  +   LI  F++D    +  R   L+ KG +NN+ + ++  +
Sbjct: 1   MEKREELYRGKAKSVYQTDDADRLILLFRNDTSAFDGKRIEQLDRKGAVNNKFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP  F + ++  E LV+ ++MIP+   VRN AAGSL +RL + EG++L     E 
Sbjct: 61  LEAAGIPTQFDKLLSDTECLVKKLDMIPVECVVRNFAAGSLVRRLGVEEGIALTPPTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+     ++E H+ AF WA   ++ +M   S ++N+ +  LF  + + LVDF+++ 
Sbjct: 121 FLKNDALGDPFINESHVQAFGWATPEQLAQMKTYSFKVNEVLNKLFDDVGLLLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        +IVL DE  PD CRLWD   +++ DK RF +    ++E Y EVA+RLG+
Sbjct: 181 GLFH----GQIVLGDEFSPDGCRLWDKETRKKMDKDRFRQGLGDVIEAYEEVAKRLGV 234


>gi|255527080|ref|ZP_05393969.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium carboxidivorans P7]
 gi|296188144|ref|ZP_06856536.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium carboxidivorans P7]
 gi|255509232|gb|EET85583.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium carboxidivorans P7]
 gi|296047270|gb|EFG86712.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium carboxidivorans P7]
          Length = 236

 Score =  253 bits (647), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 86/237 (36%), Positives = 133/237 (56%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +Y   +   ++ ++KDD    N  +   +  KGV+NN I+  +F  
Sbjct: 1   MEKREMIYEGKAKKVYATDDKDKVVVYYKDDATAFNGEKKGQIEDKGVMNNSITSALFEL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+  +F +++N REQL + VE++PL + VRN AAGS+AKR  + EG  L  +++E 
Sbjct: 61  LEKNGVKTHFEKKLNEREQLCKKVEIVPLEVIVRNVAAGSMAKRYGLQEGFELKTTVLEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A       E++ + A++ +IND +   FL  NI+L+DF+++ 
Sbjct: 121 SYKNDDLGDPLINDYHAVAIGITTFDELKTIYAMASKINDILKEFFLKQNIKLIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           GR        I+LADEI PD CR WD    E+ DK RF +    + E Y E+  R+G
Sbjct: 181 GRF----NGEILLADEISPDTCRFWDAKTNEKLDKDRFRRDLGNVKEAYIEILNRIG 233


>gi|317500587|ref|ZP_07958808.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331089312|ref|ZP_08338213.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Lachnospiraceae bacterium 3_1_46FAA]
 gi|316898020|gb|EFV20070.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330405493|gb|EGG85025.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 243

 Score =  253 bits (647), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 89/238 (37%), Positives = 136/238 (57%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K ++   +P  +I  +KDD    N  +  T+ GKGV+NNR++ Y+F  
Sbjct: 9   MKKLEQLYEGKAKKVFATEDPDVVIVDYKDDATAFNGEKKGTIVGKGVINNRMTNYVFQV 68

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+P +++  ++ RE  V+ VE++PL + VRN AAGS +KRL I EG  L    +EF
Sbjct: 69  LEKEGVPTHYVEELSDRETAVKKVEIVPLEVIVRNVAAGSFSKRLGIEEGRKLLAPTLEF 128

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++    A   A + E++++T  + ++ND +   F    I L+DF+I+ 
Sbjct: 129 SYKDDDLGDPLINDYFAIAIGAATREEIDKITEYTFKVNDVLKKFFDEAGIDLIDFKIEF 188

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR        I+LADEI PD CRLWD    E+ DK RF +    + + Y EV +R+GI
Sbjct: 189 GRYH----GDIILADEISPDTCRLWDKETHEKLDKDRFRRDMGNVEDAYQEVFKRIGI 242


>gi|310826793|ref|YP_003959150.1| hypothetical protein ELI_1199 [Eubacterium limosum KIST612]
 gi|308738527|gb|ADO36187.1| hypothetical protein ELI_1199 [Eubacterium limosum KIST612]
          Length = 235

 Score =  253 bits (647), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 88/237 (37%), Positives = 139/237 (58%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K +++  +P   I  +KDD    N  +  T+ GKGV+NN+++  +F  
Sbjct: 1   MQKLEQLYEGKAKKVFKTEDPDQFIIEYKDDATAGNGEKKGTIVGKGVINNKMTATIFKM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP +FI  ++  EQLV+ V + PL + +RNTAAGS+ KRL   EG +L   + EF
Sbjct: 61  LEEKGIPTHFIELLSDNEQLVKAVTIFPLEVIIRNTAAGSICKRLPFEEGQALEAPIFEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     ++++ H TA   A Q E++ +  ++++IN+ +   FL   I L+DF+I+ 
Sbjct: 121 CYKNDDYGDPVINDNHATALKLATQEELDAIREMTMKINEILKAYFLEKGINLIDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G+  D    +IVLADEI PD CR WD++  E+ DK RF +    + E Y E+ +R+ 
Sbjct: 181 GKTND---GQIVLADEISPDTCRFWDVNTGEKLDKDRFRRDLGGIEEAYEEMLKRVN 234


>gi|167038111|ref|YP_001665689.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|167039177|ref|YP_001662162.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacter sp. X514]
 gi|256750851|ref|ZP_05491735.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|300913228|ref|ZP_07130545.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacter sp. X561]
 gi|307723758|ref|YP_003903509.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacter sp. X513]
 gi|320116517|ref|YP_004186676.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|229568628|sp|B0KBQ8|PUR7_THEP3 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229568629|sp|B0K3Q1|PUR7_THEPX RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|166853417|gb|ABY91826.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacter sp. X514]
 gi|166856945|gb|ABY95353.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|256750186|gb|EEU63206.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|300889913|gb|EFK85058.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacter sp. X561]
 gi|307580819|gb|ADN54218.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacter sp. X513]
 gi|319929608|gb|ADV80293.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 235

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 91/239 (38%), Positives = 142/239 (59%), Gaps = 4/239 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +Y+  E    I  +KDD    N  +  T+  KG++NN++S  +F  
Sbjct: 1   MEKRELLYEGKAKKVYKTDEENLYIIEYKDDATAFNGLKKGTIAEKGIVNNKVSAILFAL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K  +P ++++R++ RE LV+ VE+ PL + VRN AAGS+ KRL + EGL     ++EF
Sbjct: 61  LDKNNVPTHYVKRLSDREMLVKKVEIFPLEVIVRNYAAGSICKRLGLEEGLKFKTPVLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D  +  +++E HI A   A + E+E MT ++ ++N+ ++  FL  +I LVDF+++ 
Sbjct: 121 SYKNDELKDPMINEYHIQALELATKEEIEIMTGMTFKVNEILSEYFLSKDIILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
           G+  +     I+LADEI PD CR WD +  E+ DK RF K   ++ E Y E+ +RLG  
Sbjct: 181 GKSSEG----ILLADEISPDTCRFWDKNTMEKLDKDRFRKDLGKVEEAYLEILKRLGGM 235


>gi|332297304|ref|YP_004439226.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Treponema
           brennaborense DSM 12168]
 gi|332180407|gb|AEE16095.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Treponema
           brennaborense DSM 12168]
          Length = 244

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 84/234 (35%), Positives = 132/234 (56%), Gaps = 3/234 (1%)

Query: 3   PRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLG 62
            ++ +YE K K ++   +P  +I  +KD     N  +  T++ KGVLNN I+  +F  L 
Sbjct: 10  KQDQLYEGKAKKVFATNDPDLVIMEYKDSATAFNGEKKGTIDEKGVLNNTIAAALFEMLN 69

Query: 63  KIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYY 122
             GIP +FI ++N RE L + V ++PL + VRN AAGS +KRL +PEG +L  ++ E  Y
Sbjct: 70  AKGIPTHFITKLNDREVLCKKVSIVPLEVIVRNVAAGSFSKRLGVPEGSALKTTVFEISY 129

Query: 123 LPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGR 182
             D+    L+++ H  A   A   E++ +  L+ +IND +   FL   ++L+DF+++ G+
Sbjct: 130 KDDALGDPLINDYHAVAIGAATWDELKVIYDLTAKINDILKAFFLSCGVKLIDFKLEFGK 189

Query: 183 LLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
                   I+LADEI PD CR WD    E+ DK RF +    + E Y E+  R+
Sbjct: 190 D---SKGTIILADEISPDTCRFWDAKTNEKLDKDRFRRDLGNVKEAYVEMLNRI 240


>gi|307266311|ref|ZP_07547851.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306918689|gb|EFN48923.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 235

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 91/239 (38%), Positives = 140/239 (58%), Gaps = 4/239 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +Y+  E    I  +KDD    N  +  T+  KG++NN++S  +F  
Sbjct: 1   MEKRELLYEGKAKKVYKTDEENFYIIEYKDDATAFNGLKKGTIAEKGIVNNKVSAILFAL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K  +P++++ +++ RE LV+ VE+ PL + VRN AAGS+ KRL + EGL     ++EF
Sbjct: 61  LEKNNVPNHYVEKLSDREMLVKKVEIFPLEVIVRNYAAGSICKRLGLEEGLKFKTPVLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     +++E HI A   A + EVE MT ++ ++N  ++  FL  +I LVDF+++ 
Sbjct: 121 SYKNDELGDPMINEYHIQALELATKEEVEIMTGMTFKVNKILSEYFLSKDIILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
           G+  +     I+LADEI PD CR WD +  E+ DK RF K   ++ E Y E+ +RLG  
Sbjct: 181 GKSNEG----ILLADEISPDTCRFWDKNTMEKLDKDRFRKDLGKVEEAYLEILKRLGGM 235


>gi|161830391|ref|YP_001597071.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Coxiella
           burnetii RSA 331]
 gi|161762258|gb|ABX77900.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Coxiella
           burnetii RSA 331]
          Length = 240

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 94/237 (39%), Positives = 132/237 (55%), Gaps = 4/237 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             R  +Y  K K +YE  EPG LI  F+DD    +  +   L  KGV+NN+I+ ++   L
Sbjct: 5   SKRKLLYSGKVKSMYETDEPGFLIAEFRDDTTAFDGEKHEKLARKGVINNQINAHIMQAL 64

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
              GI  +F   ++  E LVR ++MIPL   VRN AAGSL +RL I  GL L   L EF+
Sbjct: 65  KDAGILTHFESVLSPNESLVRRLKMIPLECVVRNIAAGSLCRRLGIESGLRLNPPLYEFF 124

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
              D+    +++E H  +F WA Q++++ M  LS +IN+ +  LF  +N+ LVD + + G
Sbjct: 125 LKNDALHDPMINENHALSFGWATQAQLDRMKELSFKINNVLFALFSNVNLILVDAKYEFG 184

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
              D     I L DEI PD CR+WD   KE  DK RF K   +++E Y E+A R  I
Sbjct: 185 VSND----EIYLGDEISPDSCRIWDAKTKEPLDKDRFRKDMGRVVESYEEIAHRFQI 237


>gi|291542784|emb|CBL15894.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Ruminococcus bromii L2-63]
          Length = 235

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 90/238 (37%), Positives = 143/238 (60%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K ++   +P   I  +KDD    N  +  T+ GKGV+NNR+S +MF  
Sbjct: 1   MEKKELLYEGKAKKVFSTEDPDLCIVSYKDDATAFNGEKKGTIVGKGVVNNRMSNFMFKL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI   F+  +N R+ +++ VE++PL + +RN AAGSL+KRL +PEG  +   ++EF
Sbjct: 61  LEKHGIATDFVEELNDRDTVLKKVEIVPLEVILRNKAAGSLSKRLGLPEGTPMKTPVLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     +V+E HI A  +A + E++ +T ++ +IN+ M   F    + L+DF+I+ 
Sbjct: 121 CYKNDELGDPMVNEYHILAAGFATKEEIDTITEMAFKINEIMIEFFKQCKVDLIDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR       +I+LADEI PD CR WD+  +E+ DK RF +    + E Y+E+ +R+G+
Sbjct: 181 GRY----KGKILLADEISPDTCRFWDMDTQEKLDKDRFRRDMGGVEEAYAEMMKRVGL 234


>gi|83590881|ref|YP_430890.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Moorella
           thermoacetica ATCC 39073]
 gi|83573795|gb|ABC20347.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Moorella
           thermoacetica ATCC 39073]
          Length = 244

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 86/237 (36%), Positives = 127/237 (53%), Gaps = 4/237 (1%)

Query: 3   PRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLG 62
               +YE K K +Y   +P   +  FKD+    +  +  T+  KG +N R+S   F  L 
Sbjct: 4   KGELLYEGKAKRVYRTDDPDHYLVEFKDEATAFDGLKKGTIARKGEINTRLSALFFQMLA 63

Query: 63  KIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYY 122
             GIP +FI +   RE LVR V++IP+ +  RN AAGSLAKRL + EG  L R ++EFYY
Sbjct: 64  GRGIPTHFIEQTGPREMLVRAVDIIPVEVVARNIAAGSLAKRLGLAEGEPLKRPVLEFYY 123

Query: 123 LPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGR 182
             D     +++  HI A   A   +VE M   + ++N+ +T      N+ LVDF+++ G 
Sbjct: 124 KSDELHDPMINNYHIAALELAAGDQVEAMEGYAWKVNELLTEFLKPANLVLVDFKLEFGL 183

Query: 183 LLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
                  +++LADEI PD CR WD +  E+ DK RF +    + + Y EV RR+   
Sbjct: 184 HH----GQVLLADEISPDTCRFWDSTSGEKLDKDRFRRDLGGVEDAYEEVLRRVERL 236


>gi|238926168|ref|ZP_04657928.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Selenomonas flueggei ATCC 43531]
 gi|238885848|gb|EEQ49486.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Selenomonas flueggei ATCC 43531]
          Length = 246

 Score =  253 bits (645), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 90/236 (38%), Positives = 139/236 (58%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K KIIY    P   + ++KDD    N  +  T+ GKG++NN++S + F  
Sbjct: 10  MERKEALYEGKAKIIYATDNPNEYLVYYKDDATAGNGAKRGTIVGKGIMNNKMSAFFFDL 69

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI H++I   + RE LV+ + +IPL + +RN AAGSLAKRL + EG+ +P  ++E+
Sbjct: 70  LAKEGIAHHYISMPSDREMLVKKLTIIPLEVIIRNVAAGSLAKRLGLEEGVPMPFPVIEY 129

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     +++  HI A   A  +E++E+  +S++IND +T       + L+DF+++ 
Sbjct: 130 CYKNDDLGDPMLNRYHIRAMKIATDAELDEIERMSLKINDILTKFLKSKKVDLIDFKLEF 189

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR  D    +I+LADEI PD CR WD   KE+ DK RF +    + + Y E+  RL
Sbjct: 190 GRDAD---GKIILADEISPDNCRFWDSDTKEKLDKDRFRRDLGNVEDAYKEMLHRL 242


>gi|255022175|ref|ZP_05294178.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidithiobacillus caldus ATCC 51756]
 gi|254968439|gb|EET25998.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidithiobacillus caldus ATCC 51756]
          Length = 239

 Score =  253 bits (645), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 92/232 (39%), Positives = 137/232 (59%), Gaps = 4/232 (1%)

Query: 7   VYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIGI 66
           +YE K KI+Y G +  TL+ FFKDD    +  +   L  KG +NN  + Y+ T L + G+
Sbjct: 8   LYEGKAKIVYPGEDADTLVLFFKDDTSAFDGEKREQLARKGEINNAFNAYIQTYLQEHGV 67

Query: 67  PHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPDS 126
           P +F+RR++ R  LVR ++MIP+   +RN AAGSL +RL + EG  L   ++EF+   D+
Sbjct: 68  PTHFLRRLDARRSLVRRLDMIPVESVLRNRAAGSLCRRLGVEEGRLLEPPVLEFFLKNDA 127

Query: 127 SEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLLDD 186
               +++  HI  F +A+  EVE M   ++R+N  +   F  + + LVDF+++ GR    
Sbjct: 128 LHDPMINRSHIRTFGYAHAEEVERMEYWTLRVNALLRERFAQVGLILVDFKLEFGRF--- 184

Query: 187 DILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
               I L DE  PD CRLWD+  +E+ DK RF +    ++E Y EVARRLGI
Sbjct: 185 -AGEIFLGDEFSPDGCRLWDVQSQEKMDKDRFRRGLGGVVEAYIEVARRLGI 235


>gi|159795633|pdb|2YWV|A Chain A, Crystal Structure Of Saicar Synthetase From Geobacillus
           Kaustophilus
 gi|159795634|pdb|2YWV|B Chain B, Crystal Structure Of Saicar Synthetase From Geobacillus
           Kaustophilus
          Length = 244

 Score =  253 bits (645), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 96/236 (40%), Positives = 134/236 (56%), Gaps = 3/236 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             +  +YE K K IY   EP  L   +KD     N  + AT+ GKG LNN IS  +F +L
Sbjct: 5   TKQQLLYEGKAKKIYATDEPDVLWVEYKDSATAFNGEKKATIAGKGRLNNEISSLLFLKL 64

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            + GI ++FI +++  EQLVR V +IPL + VRN  AGSLAKR+ + EG  L   LVEFY
Sbjct: 65  REAGIANHFIEKLSPTEQLVRRVTIIPLEVVVRNVVAGSLAKRIGLEEGTPLEAPLVEFY 124

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     L+ E+HI     A++ EV  +   ++ +ND +   F   N++L+DF+++ G
Sbjct: 125 YKNDDLGDPLLLEDHIFILKLASREEVAALKQAALAVNDVLRLHFAERNVRLIDFKLEFG 184

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           R  D     I+LADEI PD CRLWD    E+ DK  F +    L + Y  + +RLG
Sbjct: 185 RTAD---GAILLADEISPDTCRLWDAKTNEKLDKDVFRRDLGSLTDAYEVILQRLG 237


>gi|291515955|emb|CBK65165.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Alistipes
           shahii WAL 8301]
          Length = 238

 Score =  253 bits (645), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 94/236 (39%), Positives = 137/236 (58%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K ++   +P  +I  +KD     NN + AT+  KGVLNN IS  +F +
Sbjct: 1   MKQLEMLYEGKAKQVFRTDDPDKIIIHYKDAATAFNNIKKATIENKGVLNNAISTLIFKE 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+  ++I  IN R+Q+ R V +IPL + VRN  AGS+A+RL I EG      + + 
Sbjct: 61  LHKAGVKTHYIETINDRDQVCRRVTIIPLEVIVRNVIAGSMAQRLGIEEGTQPSNVIFDI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A   A   E+ EM A++ +IN+ +  LFL +NI+LVDF+I+ 
Sbjct: 121 CYKKDELGDPLINDHHAVALGAATYEELNEMYAMTAKINEVLKELFLKMNIKLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+  D     IVLADE+ PD CRLWD +  E+ DK RF +   ++ E Y E+  RL
Sbjct: 181 GKTSD---GEIVLADEVSPDTCRLWDATTNEKLDKDRFRRDLGKVREAYEEILARL 233


>gi|331085240|ref|ZP_08334326.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|330408023|gb|EGG87513.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 236

 Score =  253 bits (645), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 88/239 (36%), Positives = 141/239 (58%), Gaps = 3/239 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K ++   +P  +I  +KDD    N  +   ++GKGV+NNR++ ++F  
Sbjct: 1   MKKMEQLYEGKAKRVFLTEDPEVVIVSYKDDATAFNGEKKGMISGKGVVNNRMTNHVFKM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           + K GIP + +  +N RE  V+ VE++PL + VRN AAGS +KR+ + EG  L   ++EF
Sbjct: 61  MEKEGIPTHLVEELNDRETAVKKVEIVPLEVIVRNVAAGSFSKRMGVEEGTELLCPILEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D      +++++  A   A Q E++ +   + ++N+F+ G FL   ++L+DF+I+ 
Sbjct: 121 SYKNDELGDPFINDDYALALGLAEQEEIDTIRTYAKKVNEFLKGYFLDAGMKLIDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
           GRL D     I+LADE+ PD CRLWD+   E+ DK RF +    + E Y EV  RLG+ 
Sbjct: 181 GRLPD---GTIILADEVSPDTCRLWDVDTNEKLDKDRFRRDMGNVEEAYEEVFHRLGLL 236


>gi|325282439|ref|YP_004254980.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Deinococcus proteolyticus MRP]
 gi|324314248|gb|ADY25363.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Deinococcus proteolyticus MRP]
          Length = 237

 Score =  253 bits (645), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 85/236 (36%), Positives = 130/236 (55%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M    P+YE K K ++    P   I  +KDD    N  +     GKG  NN I+ ++F  
Sbjct: 1   MNSSAPLYEGKAKKVFATENPAEYIVQYKDDATAFNAQKRGEWAGKGATNNAITAHLFPL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP +FI +++  EQ V+ V ++P+ + VRN AAGS +KRL + EG  L R +VE+
Sbjct: 61  LEAAGIPTHFIEQLSDTEQRVKAVTIVPVEVIVRNIAAGSFSKRLGVEEGEKLSRPVVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    L++ +   A  WA++ ++  +  L++++ DF+   F    + LVDF+++ 
Sbjct: 121 CYKSDALGDPLINTDTALALGWASEEDLTRIRELALKVRDFLVPYFEKRGVTLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+L       IVLADEI PD CR WD    E+ DK RF +      E Y+E+ RR+
Sbjct: 181 GKLP---GGEIVLADEISPDTCRFWDAQTGEKLDKDRFRRDLGGEAEAYAEMLRRV 233


>gi|261418588|ref|YP_003252270.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Geobacillus sp. Y412MC61]
 gi|319765403|ref|YP_004130904.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Geobacillus sp. Y412MC52]
 gi|261375045|gb|ACX77788.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Geobacillus sp. Y412MC61]
 gi|317110269|gb|ADU92761.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Geobacillus sp. Y412MC52]
          Length = 242

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 95/236 (40%), Positives = 134/236 (56%), Gaps = 3/236 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             +  +YE K K IY   EP  L   +KD     N  + AT+ GKG LNN IS  +F +L
Sbjct: 3   TKQQLLYEGKAKKIYATDEPDVLWVEYKDSATAFNGEKKATIAGKGRLNNEISSLLFLKL 62

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            + GI ++FI +++  EQLVR V +IPL + VRN  AGSLAKR+ + EG  L   LVEFY
Sbjct: 63  REAGIANHFIEKLSPTEQLVRRVTIIPLEVVVRNVVAGSLAKRIGLEEGTPLEAPLVEFY 122

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     L+ E+HI     A++ E+  +   ++ +ND +   F   N++L+DF+++ G
Sbjct: 123 YKNDDLGDPLLLEDHIFILKLASREEIAALKQAALAVNDVLRLHFAERNVRLIDFKLEFG 182

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           R  D     I+LADEI PD CRLWD    E+ DK  F +    L + Y  + +RLG
Sbjct: 183 RTAD---GAILLADEISPDTCRLWDAKTNEKLDKDVFRRDLGSLTDAYEVILQRLG 235


>gi|289577805|ref|YP_003476432.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacter italicus Ab9]
 gi|289527518|gb|ADD01870.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacter italicus Ab9]
          Length = 235

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 92/239 (38%), Positives = 143/239 (59%), Gaps = 4/239 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +Y+  E    I  +KDD    N  +  T+  KGV+NN++S  +F  
Sbjct: 1   MEKRELLYEGKAKKVYKTEEENFYIIEYKDDATAFNGLKKGTIAEKGVVNNKVSAILFAL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K  +P+++++R++ RE LV+ VE+ PL + VRN AAGS+ KRL + EGL     ++EF
Sbjct: 61  LEKNNVPNHYVKRLSDREMLVKKVEIFPLEVIVRNYAAGSICKRLGLEEGLKFKTPVLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D  +  +++E HI A   A + E+E MT ++ ++N+ ++  FL  +I LVDF+++ 
Sbjct: 121 SYKNDELKDPMINEYHIQALELATKEEIEIMTEMTFKVNEILSEYFLSKDIILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
           G+  +     I+LADEI PD CR WD +  E+ DK RF K   ++ E Y E+ +RLG  
Sbjct: 181 GKSNEG----ILLADEISPDTCRFWDKNTMEKLDKDRFRKDLGKVEEAYLEILKRLGGM 235


>gi|56418795|ref|YP_146113.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Geobacillus kaustophilus HTA426]
 gi|297528674|ref|YP_003669949.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Geobacillus sp. C56-T3]
 gi|56378637|dbj|BAD74545.1| phosphoribosylaminoimidazole succinocarboxamide synthetase
           [Geobacillus kaustophilus HTA426]
 gi|297251926|gb|ADI25372.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Geobacillus sp. C56-T3]
          Length = 242

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 96/236 (40%), Positives = 134/236 (56%), Gaps = 3/236 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             +  +YE K K IY   EP  L   +KD     N  + AT+ GKG LNN IS  +F +L
Sbjct: 3   TKQQLLYEGKAKKIYATDEPDVLWVEYKDSATAFNGEKKATIAGKGRLNNEISSLLFLKL 62

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            + GI ++FI +++  EQLVR V +IPL + VRN  AGSLAKR+ + EG  L   LVEFY
Sbjct: 63  REAGIANHFIEKLSPTEQLVRRVTIIPLEVVVRNVVAGSLAKRIGLEEGTPLEAPLVEFY 122

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     L+ E+HI     A++ EV  +   ++ +ND +   F   N++L+DF+++ G
Sbjct: 123 YKNDDLGDPLLLEDHIFILKLASREEVAALKQAALAVNDVLRLHFAERNVRLIDFKLEFG 182

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           R  D     I+LADEI PD CRLWD    E+ DK  F +    L + Y  + +RLG
Sbjct: 183 RTAD---GAILLADEISPDTCRLWDAKTNEKLDKDVFRRDLGSLTDAYEVILQRLG 235


>gi|332993238|gb|AEF03293.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Alteromonas sp. SN2]
          Length = 237

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 135/238 (56%), Gaps = 3/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R+ +Y  K K +Y   +   LI  F++D    +  +   L+ KG +NN+ + ++ T+
Sbjct: 1   MEKRDELYRGKAKTVYFTDDSDKLILHFRNDTSAFDGEKIEQLDRKGEVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI       ++  E LV+ ++MIP+   VRN AAGSL +RL + EG +L   + EF
Sbjct: 61  LEEAGIATQVEALLSDTESLVKKLDMIPVECVVRNLAAGSLVRRLGVEEGQTLAPPVFEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    ++++ HI +F WA ++++ EM +L+ ++N  +  LF    + LVD++++ 
Sbjct: 121 FLKNDALHDPMINDYHIVSFGWATEAQIAEMKSLTFKVNAVLKSLFDEAGMLLVDYKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G   D     IVL DE  PD CRLWD   +++ DK RF +    ++E Y EVA RLG+
Sbjct: 181 GVDPD---GNIVLGDEFTPDGCRLWDKETRKKMDKDRFRQGLGSVVETYIEVAERLGV 235


>gi|229542640|ref|ZP_04431700.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           coagulans 36D1]
 gi|229327060|gb|EEN92735.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           coagulans 36D1]
          Length = 236

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 96/231 (41%), Positives = 137/231 (59%), Gaps = 3/231 (1%)

Query: 6   PVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIG 65
            VYE K K +YE  +P  L   +KD     N  + A + GKG LNN IS  +F +L + G
Sbjct: 2   LVYEGKAKRLYETEDPDVLRVEYKDSATAFNGVKKAEIEGKGQLNNEISSLIFKRLAEKG 61

Query: 66  IPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPD 125
           +  +FIR+I+ REQLVR VE+IPL + VRN  AGSLAKRL + EG    + +VEFYY  D
Sbjct: 62  VKSHFIRKISEREQLVRRVEIIPLEVVVRNVVAGSLAKRLGLEEGTPAGQPVVEFYYKKD 121

Query: 126 SSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLLD 185
                L++E+H+     A+  +++ +   ++ +N+ +  LF  I ++LVDF+++ GR  D
Sbjct: 122 ELGDPLITEDHVRLLGIASSEDLQFLRKQALAVNESLKALFAEIGVRLVDFKLEFGRGRD 181

Query: 186 DDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
                I+LADEI PD CRLWD +  E+ DK  F +    L E Y E+  RL
Sbjct: 182 ---GAILLADEISPDTCRLWDRATNEKLDKDVFRRDLGSLTEVYQEILNRL 229


>gi|297565498|ref|YP_003684470.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Meiothermus silvanus DSM 9946]
 gi|296849947|gb|ADH62962.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Meiothermus silvanus DSM 9946]
          Length = 235

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 89/232 (38%), Positives = 137/232 (59%), Gaps = 3/232 (1%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K KI+Y G E GT   ++KDD    N  + A + GKGV+NNR+S  +F  L   
Sbjct: 2   EKLYEGKAKIVYTGPEVGTYRVYYKDDATAFNGQKRAQIGGKGVVNNRVSSTLFRYLEAH 61

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
           G+P +F+  ++ RE LVR VE+IPL + +RN AAGS AKR  + EG  L + LVEF    
Sbjct: 62  GVPTHFLGELSEREMLVRQVEIIPLEVIIRNRAAGSFAKRYGVAEGTPLAKPLVEFSLKN 121

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D+    L+ ++ + A   A+ +E+  +  L++++N+ +   F    ++++DF+++ GRL 
Sbjct: 122 DALGDPLIYDDAVLALGLASANELSRIKELALQVNELLKAFFSQRGLEVIDFKLEFGRLP 181

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
                 +VLADEI PD  RLW++   E+ DK RF +    + E Y EV RR+
Sbjct: 182 ---GGTVVLADEISPDTMRLWEVGTGEKMDKDRFRRDLGGVEEAYQEVLRRV 230


>gi|325265332|ref|ZP_08132057.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium sp. D5]
 gi|324029511|gb|EGB90801.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium sp. D5]
          Length = 235

 Score =  252 bits (643), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 85/238 (35%), Positives = 137/238 (57%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K ++   +P  +I  +KDD    N  +  T+ GKG++NNR++ Y+F  
Sbjct: 1   MKKLEQLYEGKAKKVFATDDPDIVIVDYKDDATAFNGEKKGTIVGKGMINNRMTNYIFQV 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+P +++  ++ RE  V+ VE++PL + VRN AAGS +K+L I EG  L    +EF
Sbjct: 61  LEKEGVPTHYVEELSDRETAVKKVEIVPLEVIVRNVAAGSFSKKLGIEEGRKLLAPTLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     ++++    A   A + E++++T  + ++ND +   F    I+L+DF+I+ 
Sbjct: 121 SYKDDDLGDPMINDYFAIAIGAATREEIDKITEYTFKVNDVLRKFFDEAGIELIDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR        I+LADE+ PD CRLWD    E+ DK RF +    + + Y EV +R+GI
Sbjct: 181 GRFH----GDIILADEVSPDTCRLWDKETHEKLDKDRFRRDMGNVEDAYQEVFKRIGI 234


>gi|167758441|ref|ZP_02430568.1| hypothetical protein CLOSCI_00781 [Clostridium scindens ATCC 35704]
 gi|167664338|gb|EDS08468.1| hypothetical protein CLOSCI_00781 [Clostridium scindens ATCC 35704]
          Length = 239

 Score =  252 bits (643), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 88/238 (36%), Positives = 140/238 (58%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K +++  +P  +I  +KDD    N  +  T+ GKGV+NNR++ Y+F  
Sbjct: 5   MQKLEQLYEGKAKKVFKTDDPDIVIVDYKDDATAFNGEKKGTIVGKGVINNRMTNYIFQV 64

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+P +++  ++ RE  V+ VE++PL + VRN AAGS +KRL I EG  L    +EF
Sbjct: 65  LEKEGVPTHYVEELSDRETAVKKVEIVPLEVIVRNVAAGSFSKRLGIEEGTKLLAPTLEF 124

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++    A   + + E+E++T  + ++N+ +   F    I+L+DF+I+ 
Sbjct: 125 SYKDDDLGDPLINDYMAIAIGASTREEIEKITEYTFKVNEVLKKFFADAGIELIDFKIEF 184

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR        ++LADEI PD CRLWD++  E+ DK RF +    + + Y EV RR+GI
Sbjct: 185 GRFH----GNVILADEISPDTCRLWDINTHEKLDKDRFRRDMGNVEDAYQEVFRRIGI 238


>gi|167751385|ref|ZP_02423512.1| hypothetical protein EUBSIR_02376 [Eubacterium siraeum DSM 15702]
 gi|167655631|gb|EDR99760.1| hypothetical protein EUBSIR_02376 [Eubacterium siraeum DSM 15702]
          Length = 239

 Score =  252 bits (643), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 86/236 (36%), Positives = 139/236 (58%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K ++   +P  +I  +KDD    N  +  T++GKGV+NN+++ YMF  
Sbjct: 4   MEKKEQLYEGKAKKVFATDDPNLVIVSYKDDATAFNGLKKGTISGKGVINNKMTNYMFGL 63

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+P + ++ +N RE LV+ V ++PL + VRN AAGS +K+L I EG  L    +EF
Sbjct: 64  LEKAGVPTHLVKELNDRETLVKKVSIVPLEVIVRNVAAGSFSKKLGIEEGTKLLCPTLEF 123

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D      +++ +  A   A + E++ ++  + ++N+FM   F  +NI L+DF+I+ 
Sbjct: 124 SYKNDDLGDPFINDYYALALGLATKEEIDLISKYAFKVNEFMLDFFKKLNIDLIDFKIEF 183

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+  D     I+LADEI PD CR WD +  E+ DK RF +    + + Y+E+ +RL
Sbjct: 184 GKTSD---GTIILADEISPDTCRFWDSTTHEKLDKDRFRRDMGGVEDAYAEIMKRL 236


>gi|323487087|ref|ZP_08092395.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium symbiosum WAL-14163]
 gi|323399588|gb|EGA91978.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium symbiosum WAL-14163]
          Length = 238

 Score =  252 bits (643), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 82/238 (34%), Positives = 137/238 (57%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+  + +YE K K +Y   +P  LI  +KDD    N  +  T+ GKG +NNR++ ++F  
Sbjct: 1   MKKVDLLYEGKAKKVYTTEDPDVLIVDYKDDATAFNGLKKGTIVGKGAINNRMTNHIFKL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+P + +  ++ RE  V+ VE++PL + +RN +AGS AK++ + EG+      +EF
Sbjct: 61  LEAEGVPTHLVEELSDRETAVKKVEIVPLEVIIRNFSAGSFAKKMGMEEGIEFKCPTLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D      +++ +  +   A + E++ +T  + ++N+ M   F  + I+L+DF+I+ 
Sbjct: 121 SYKNDDLGDPFINKYYALSLELATEEEIDTITKYAFKVNEVMRKYFGELGIELIDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR       +I+LADE+ PD CRLWD    E+ DK RF +    + + Y+EV RRLGI
Sbjct: 181 GRYH----GQIILADEVSPDTCRLWDKETHEKLDKDRFRRDMGNVEDAYNEVFRRLGI 234


>gi|167752777|ref|ZP_02424904.1| hypothetical protein ALIPUT_01038 [Alistipes putredinis DSM 17216]
 gi|167659846|gb|EDS03976.1| hypothetical protein ALIPUT_01038 [Alistipes putredinis DSM 17216]
          Length = 238

 Score =  252 bits (643), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 92/241 (38%), Positives = 138/241 (57%), Gaps = 3/241 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K ++   +P  ++  +KD     NN + AT+  KGVLNNRIS  +F  
Sbjct: 1   MQQGEMLYEGKAKQVFLTDDPDMILIHYKDAATAFNNIKKATIENKGVLNNRISTLIFEY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI  ++++ +N R+QL R V +IPL + VRN  AGS+A+RL I EG      + + 
Sbjct: 61  LNKQGIKTHYVKTLNDRDQLCRRVRIIPLEVIVRNVIAGSMAQRLGIEEGTKPSNVIFDI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A       E++++ A++ RIN+ +  LF  +NI L+DF+I+ 
Sbjct: 121 CYKNDELGDPLINDHHAVALGVVTYDELKQIYAMTARINEVLKELFAKMNINLIDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR  D     IVLADE+ PD CRLWD++  E+ DK RF +   ++ E Y E+  RL    
Sbjct: 181 GRTSD---GEIVLADEVSPDTCRLWDMATNEKLDKDRFRRDLGKVREAYEEILARLEKVI 237

Query: 241 K 241
           K
Sbjct: 238 K 238


>gi|299535259|ref|ZP_07048583.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Lysinibacillus fusiformis ZC1]
 gi|298729380|gb|EFI69931.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Lysinibacillus fusiformis ZC1]
          Length = 236

 Score =  252 bits (643), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 91/237 (38%), Positives = 139/237 (58%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K ++   EP  L+  +KD     N  +   + GKG+LNNRI+  +F +
Sbjct: 1   MTKGQLLYEGKAKKLFTTEEPNVLLVEYKDSATAFNGEKKEEIEGKGILNNRITSLIFEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +F+++++  +QLV+ VE+IP+ + VRN AAGSLAKRL + EG  L R +VEF
Sbjct: 61  LQANGIASHFVKQLSDTQQLVKKVEIIPIEVVVRNIAAGSLAKRLGLEEGTPLKRPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     L++ EHI     A  +EV  +   ++ +N  +  +F  +N+ L+DF+++ 
Sbjct: 121 YYKDDDLGDPLITTEHIDVLGLATPTEVTAIYDGALAVNKVLQPIFADVNVTLIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           GR +D     ++LADEI PD CRLWD + K++ DK  F +    L E Y+ +  RLG
Sbjct: 181 GRDMD---GHVLLADEISPDTCRLWDATTKQKLDKDVFRRDLGNLTEVYTIILSRLG 234


>gi|323694594|ref|ZP_08108760.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium symbiosum WAL-14673]
 gi|323501362|gb|EGB17258.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium symbiosum WAL-14673]
          Length = 240

 Score =  251 bits (642), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 82/238 (34%), Positives = 137/238 (57%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+  + +YE K K +Y   +P  LI  +KDD    N  +  T+ GKG +NNR++ ++F  
Sbjct: 3   MKKVDLLYEGKAKKVYTTEDPDVLIVDYKDDATAFNGLKKGTIVGKGAINNRMTNHIFKL 62

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+P + +  ++ RE  V+ VE++PL + +RN +AGS AK++ + EG+      +EF
Sbjct: 63  LEAEGVPTHLVEELSDRETAVKKVEIVPLEVIIRNFSAGSFAKKMGMEEGIEFKCPTLEF 122

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D      +++ +  +   A + E++ +T  + ++N+ M   F  + I+L+DF+I+ 
Sbjct: 123 SYKNDDLGDPFINKYYALSLELATEEEIDTITKYAFKVNEVMRKYFGELGIELIDFKIEF 182

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR       +I+LADE+ PD CRLWD    E+ DK RF +    + + Y+EV RRLGI
Sbjct: 183 GRYH----GQIILADEVSPDTCRLWDKETHEKLDKDRFRRDMGNVEDAYNEVFRRLGI 236


>gi|225570420|ref|ZP_03779445.1| hypothetical protein CLOHYLEM_06520 [Clostridium hylemonae DSM
           15053]
 gi|225160791|gb|EEG73410.1| hypothetical protein CLOHYLEM_06520 [Clostridium hylemonae DSM
           15053]
          Length = 239

 Score =  251 bits (642), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 89/238 (37%), Positives = 141/238 (59%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K +++  +P  +I  +KDD    N  +  T+ GKGV+NNR++ Y+F  
Sbjct: 5   MQKLEQLYEGKAKKVFKTEDPDIVIVDYKDDATAFNGEKKGTIVGKGVINNRMTNYIFQV 64

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+P +F+  ++ RE  V+ VE++PL + VRN AAGS +KRL I EG +L    +EF
Sbjct: 65  LEKEGVPTHFVEELSDRETAVKRVEIVPLEVIVRNVAAGSFSKRLGIEEGTNLLAPTLEF 124

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++    A   + + E+E++T  + ++N+ +   F    I+L+DF+I+ 
Sbjct: 125 SYKDDDLGDPLINDYMAIAIGASTREEIEKITEYTFKVNEVLKKFFAEAGIELIDFKIEF 184

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR        ++LADEI PD CRLWD++  E+ DK RF +    + + Y EV RR+GI
Sbjct: 185 GRFH----GDVILADEISPDTCRLWDINTHEKLDKDRFRRDMGNVEDAYQEVFRRIGI 238


>gi|328950092|ref|YP_004367427.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Marinithermus hydrothermalis DSM 14884]
 gi|328450416|gb|AEB11317.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Marinithermus hydrothermalis DSM 14884]
          Length = 241

 Score =  251 bits (642), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 94/245 (38%), Positives = 132/245 (53%), Gaps = 5/245 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K KIIY G E  T+  +FKDD    N  +  T+ GKG +NN++S  +F  
Sbjct: 2   ME--TKLYEGKAKIIYPGPEADTVRVYFKDDATAFNGAKRGTIQGKGAVNNQVSAALFAY 59

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+  +F+R++  RE LVR VE++PL + VR  AAGS +KR  I EG  L   LVEF
Sbjct: 60  LEAHGVRTHFVRQLGEREMLVRRVEIVPLEVIVRYRAAGSFSKRYGIEEGTPLRTPLVEF 119

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
               D+     +S E   A   A   EVE +   ++R+   +  LF    ++LVDF+++ 
Sbjct: 120 CLKNDALNDPPISGEAAVALGLATPKEVETLRREALRVGALLKDLFARQGLELVDFKLEF 179

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR  D     +VLADEI PD  RLW++   E  DK RF +    + E Y EV +R+    
Sbjct: 180 GRTSD---GALVLADEISPDTVRLWEVGTGERMDKDRFRRDLGGVEEAYQEVLKRVRAAT 236

Query: 241 KNEPA 245
           + EP 
Sbjct: 237 QAEPQ 241


>gi|269792375|ref|YP_003317279.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Thermanaerovibrio acidaminovorans DSM 6589]
 gi|269100010|gb|ACZ18997.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Thermanaerovibrio acidaminovorans DSM 6589]
          Length = 239

 Score =  251 bits (642), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 93/241 (38%), Positives = 143/241 (59%), Gaps = 3/241 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     VYE K K ++   +PG L+  +KD     N  + A++ GKG LNN IS  +F  
Sbjct: 1   MSKGEMVYEGKAKRMFLTDDPGRLVVEYKDSLTAFNAQKVASMEGKGRLNNVISSVIFQY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+ ++F+R I+   Q V  V ++P+ + VRN  AGS+ KRL + EGL LPR LVE 
Sbjct: 61  LKDRGVDNHFVRVIDDTHQEVLRVTILPIEVVVRNITAGSICKRLGVKEGLPLPRPLVEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    +++E+H   F WA Q E++++ ++++++N  +  +F  + + LVDF+++ 
Sbjct: 121 YYKDDALGDPIITEDHAVLFGWATQEELDQVKSMALKVNQLLGEMFEQVGVTLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR  D    RI+LADEI PD CRLWD +  +  DK RF     ++LE Y E+ +RL   K
Sbjct: 181 GRTKD---GRIILADEISPDTCRLWDKATNDRLDKDRFRNDLGRVLEAYEEIWKRLSEPK 237

Query: 241 K 241
           +
Sbjct: 238 E 238


>gi|29654523|ref|NP_820215.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Coxiella
           burnetii RSA 493]
 gi|212212395|ref|YP_002303331.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Coxiella
           burnetii CbuG_Q212]
 gi|39931902|sp|Q83CA8|PUR7_COXBU RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|29541790|gb|AAO90729.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Coxiella
           burnetii RSA 493]
 gi|212010805|gb|ACJ18186.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Coxiella
           burnetii CbuG_Q212]
          Length = 240

 Score =  251 bits (642), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 93/237 (39%), Positives = 131/237 (55%), Gaps = 4/237 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             R  +Y  K K +YE  EPG LI  F+DD    +  +   L  KGV+NN+I+ ++   L
Sbjct: 5   SKRKLLYSGKVKSMYETDEPGFLIAEFRDDTTAFDGEKHEKLARKGVINNQINAHIMQAL 64

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
              GI  +F   ++  E LVR ++MIPL   VRN AAGSL +RL I  GL L   L E +
Sbjct: 65  KDAGILTHFESVLSPNESLVRRLKMIPLECVVRNIAAGSLCRRLGIESGLRLNPPLYELF 124

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
              D+    +++E H  +F WA Q++++ M  LS +IN+ +  LF  +N+ LVD + + G
Sbjct: 125 LKNDALHDPMINENHALSFGWATQAQLDRMKELSFKINNVLFALFSNVNLILVDAKYEFG 184

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
              D     I L DEI PD CR+WD   KE  DK RF K   +++E Y E+A R  I
Sbjct: 185 VSND----EIYLGDEISPDSCRIWDAKTKEPLDKDRFRKDMGRVVESYEEIAHRFQI 237


>gi|297544092|ref|YP_003676394.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
 gi|296841867|gb|ADH60383.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
          Length = 235

 Score =  251 bits (642), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 94/239 (39%), Positives = 142/239 (59%), Gaps = 4/239 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +Y+  E    I  +KDD    N  +  T+  KGV+NN++S  +FT 
Sbjct: 1   MEKRELLYEGKAKKVYKTEEENFYIIEYKDDATAFNGLKKGTIAEKGVVNNKVSAILFTL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K  IP ++++R++ RE LV+ VE+ PL + VRN AAGS+ KRL + EGL     ++EF
Sbjct: 61  LEKNNIPTHYVKRLSDREMLVKKVEIFPLEVIVRNYAAGSICKRLGLEEGLKFKTPVLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D  +  +++E HI A   A + E+E MT ++ ++N  ++  FL  +I LVDF+++ 
Sbjct: 121 SYKNDELKDPMINEYHIQALELATKEEIEIMTGMTFKVNKILSEYFLSKDIILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
           G+  +     I+LADEI PD CR WD +  E+ DK RF K   ++ E Y E+ +RLG  
Sbjct: 181 GKSNEG----ILLADEISPDTCRFWDKNTMEKLDKDRFRKDLGKVEEAYLEILKRLGGM 235


>gi|167772972|ref|ZP_02445025.1| hypothetical protein ANACOL_04360 [Anaerotruncus colihominis DSM
           17241]
 gi|167664905|gb|EDS09035.1| hypothetical protein ANACOL_04360 [Anaerotruncus colihominis DSM
           17241]
          Length = 244

 Score =  251 bits (641), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 88/236 (37%), Positives = 137/236 (58%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +++  +P   I  +KDD    N  +  T+  KGV+NNR+S ++   
Sbjct: 9   MEKLEQLYEGKAKKVFKTDDPEAYIVSYKDDATAFNGQKKGTIAEKGVINNRVSNHLMRM 68

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GIP + IR ++ RE LV+ V ++PL + VRN AAGSL+KRL +PEG  L ++++E+
Sbjct: 69  LEKEGIPTHLIRELSDRETLVKKVTIVPLEVIVRNIAAGSLSKRLGLPEGTKLKKTVLEY 128

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     ++++ H+ A   A   E+  +   ++RIN+ ++     +NI+L+DF+++ 
Sbjct: 129 SYKDDELGDPMINDYHVFALELATPEELSTIAGYALRINELLSAYLKDLNIELIDFKLEF 188

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+  D     I+LADEI PD CR WD    E+ DK RF +    +   Y EV RRL
Sbjct: 189 GKTSD---GTIILADEISPDTCRFWDSRTGEKLDKDRFRRDMGGVEGAYHEVMRRL 241


>gi|292490781|ref|YP_003526220.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nitrosococcus halophilus Nc4]
 gi|291579376|gb|ADE13833.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nitrosococcus halophilus Nc4]
          Length = 238

 Score =  251 bits (641), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 86/236 (36%), Positives = 136/236 (57%), Gaps = 4/236 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             ++ +Y  K K +Y+  +P  LI  F+DD    +  +    + KG +NN+ + ++  +L
Sbjct: 4   EKQSELYSGKAKTVYKTDDPARLILHFRDDTSAFDGQKIEQFSRKGEINNKFNAFIMEKL 63

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
              GIP +F R ++ +E LV+ +EM P+   VRN + GSL +RL + EGL L   + EF+
Sbjct: 64  AAAGIPTHFERLLSAQESLVKHLEMFPVECVVRNISTGSLCRRLGVQEGLDLEPPVFEFF 123

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
              D+    +++E HI  F WA+  +VE M   + +IND +  LFLG  + LVD++++ G
Sbjct: 124 LKNDALHDPMINEYHICTFGWASMEQVERMKEYTFKINDILKSLFLGAGLLLVDYKLEFG 183

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
               D   ++VL DE   D CRLWD+  +E+ DK RF +    ++E Y EVARRLG
Sbjct: 184 ----DYQGQVVLGDEFTLDGCRLWDVETREKLDKDRFRQGLGGVVEAYEEVARRLG 235


>gi|126649615|ref|ZP_01721856.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           sp. B14905]
 gi|126593940|gb|EAZ87863.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           sp. B14905]
          Length = 236

 Score =  251 bits (641), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 90/237 (37%), Positives = 136/237 (57%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +Y   EP  L+  +KD     N  +   + GKG+LNNRI+  +F +
Sbjct: 1   MTKGQLLYEGKAKKLYTTEEPNVLLVEYKDSATAFNGEKKEEIEGKGILNNRITSLIFEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +F+++++  +QLVR V++IP+ + VRN  AGSLAKR+ + EG  L R +VEF
Sbjct: 61  LQGNGIASHFVKQLSDTQQLVRKVDIIPIEVVVRNIVAGSLAKRIGLEEGTPLKRPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D      ++ EHI     A  +EV  +   ++ IN  +  +F  +N+ L+DF+++ 
Sbjct: 121 YYKDDELGDPFITTEHIDILELATSAEVSAIYEKALAINKVLQPIFADVNVTLIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           GR  D     ++LADEI PD CRLWD + K++ DK  F +    L E Y+ +  RLG
Sbjct: 181 GRDAD---GHVLLADEISPDTCRLWDATTKQKLDKDVFRRDLGNLTEVYTIILSRLG 234


>gi|326390919|ref|ZP_08212470.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacter ethanolicus JW 200]
 gi|325993067|gb|EGD51508.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacter ethanolicus JW 200]
          Length = 235

 Score =  251 bits (641), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 91/239 (38%), Positives = 141/239 (58%), Gaps = 4/239 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +Y+  E    I  +KDD    N  +  T+  KG++NN++S  +F  
Sbjct: 1   MEKRELLYEGKAKKVYKTDEENFYIIEYKDDATAFNGLKKGTIAEKGIVNNKVSAILFAL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K  +P +++++++ RE LV+ VE+ PL + VRN AAGS+ KRL + EGL     ++EF
Sbjct: 61  LEKNNVPTHYVKKLSDREMLVKKVEIFPLEVIVRNYAAGSICKRLGLEEGLKFKTPVLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D  +  +++E HI A   A + EVE MT ++ ++N  ++  FL  +I LVDF+++ 
Sbjct: 121 SYKNDELKDPMINEYHIQALELATKEEVEIMTGMTFKVNKILSEYFLSKDIILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
           G+  +     I+LADEI PD CR WD +  E+ DK RF K   ++ E Y E+ +RLG  
Sbjct: 181 GKSNEG----ILLADEISPDTCRFWDKNTMEKLDKDRFRKDLGKVEEAYLEILKRLGGM 235


>gi|153209555|ref|ZP_01947440.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Coxiella
           burnetii 'MSU Goat Q177']
 gi|212218637|ref|YP_002305424.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Coxiella
           burnetii CbuK_Q154]
 gi|120575312|gb|EAX31936.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Coxiella
           burnetii 'MSU Goat Q177']
 gi|212012899|gb|ACJ20279.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Coxiella
           burnetii CbuK_Q154]
          Length = 240

 Score =  251 bits (640), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 93/237 (39%), Positives = 131/237 (55%), Gaps = 4/237 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             R  +Y  K K +YE  EPG LI  F+DD    +  +   L  KGV+NN+I+ ++   L
Sbjct: 5   SKRKLLYSGKVKSMYETDEPGFLIAEFRDDTTAFDGEKHEKLARKGVINNQINAHIMQAL 64

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
              GI  +F   ++  E LVR ++MIPL   VRN AAGSL +RL I  GL L   L E +
Sbjct: 65  KDAGILTHFESFLSPNESLVRRLKMIPLECVVRNIAAGSLCRRLGIESGLRLNPPLYELF 124

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
              D+    +++E H  +F WA Q++++ M  LS +IN+ +  LF  +N+ LVD + + G
Sbjct: 125 LKNDALHDPMINENHALSFGWATQAQLDRMKELSFKINNVLFALFSNVNLILVDAKYEFG 184

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
              D     I L DEI PD CR+WD   KE  DK RF K   +++E Y E+A R  I
Sbjct: 185 VSDD----EIYLGDEISPDSCRIWDAKTKEPLDKDRFRKDMGRVVESYEEIAHRFQI 237


>gi|323490425|ref|ZP_08095637.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Planococcus donghaensis MPA1U2]
 gi|323395924|gb|EGA88758.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Planococcus donghaensis MPA1U2]
          Length = 238

 Score =  251 bits (640), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 91/237 (38%), Positives = 137/237 (57%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +Y   E   L   +KD     N  +   + GKG+LNN+I+  +FT+
Sbjct: 1   MEKGQLLYEGKAKRLYATDEKEILWVEYKDSATAFNGEKKEEITGKGILNNKITSLIFTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +F+++++  EQLV+ V +IPL + VRN  AGS+AKRL I EG+++ R +VEF
Sbjct: 61  LQEAGIASHFVKQLSDHEQLVQSVSIIPLEVVVRNITAGSMAKRLGIEEGVAISRPVVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y   D     L++++H+     A   EV  +   +  IN+ + G F  I + LVDF+I+ 
Sbjct: 121 YLKDDELGDPLITDDHVDMLKLATAEEVAVLKQKAREINEVLIGFFKEIGVDLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           GR  +    +I+LADEI PD CRLWD+  K++ DK  F ++   L E Y  +  RLG
Sbjct: 181 GRDKN---GQILLADEISPDTCRLWDMETKQKLDKDVFRRNLGNLTEAYELILTRLG 234


>gi|225176017|ref|ZP_03730009.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Dethiobacter alkaliphilus AHT 1]
 gi|225168605|gb|EEG77407.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Dethiobacter alkaliphilus AHT 1]
          Length = 237

 Score =  251 bits (640), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 78/236 (33%), Positives = 132/236 (55%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K IY   +P  ++  +KDD    +  +   +  KG+LNN+I+ + F  
Sbjct: 1   MERQAFLYEGKAKRIYATADPDLVLVEYKDDATAFDGEKKGRIANKGILNNKIAAHFFEL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+P +F+R ++ RE LV+ +++I + +  RN  AGSL+KRL + EG+ L R ++EF
Sbjct: 61  LAEQGVPSHFVRHLSEREMLVKKLQIIKVEVVARNRVAGSLSKRLGLDEGVELSRPVLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     L++E HI A   A + E++++   +++IN+ +       +I L D +++ 
Sbjct: 121 YYKNDELHDPLINEYHIYALKLATKEELQQIAEQALQINEILVKYLAKRDIILADMKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G         ++L DEI PD CR WD +  E+ DK RF +    + + Y E+  RL
Sbjct: 181 GLF----NGEVLLGDEISPDTCRFWDANTMEKLDKDRFRRDLGNVEKAYEEILSRL 232


>gi|169825814|ref|YP_001695972.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Lysinibacillus sphaericus C3-41]
 gi|229564405|sp|B1HTV1|PUR7_LYSSC RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|168990302|gb|ACA37842.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Lysinibacillus sphaericus C3-41]
          Length = 236

 Score =  251 bits (640), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 90/237 (37%), Positives = 136/237 (57%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +Y   EP  L+  +KD     N  +   + GKG+LNNRI+  +F +
Sbjct: 1   MTKGQLLYEGKAKKLYTTEEPNVLLVEYKDSATAFNGEKKEEIEGKGILNNRITSLIFEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +F+++++  +QLVR V++IP+ + VRN  AGSLAKR+ + EG  L R +VEF
Sbjct: 61  LQGNGIASHFVKQLSDTQQLVRKVDIIPIEVVVRNIVAGSLAKRIGLEEGTPLKRPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D      ++ EHI     A  +EV  +   ++ IN  +  +F  +N+ L+DF+++ 
Sbjct: 121 YYKDDELGDPFITTEHIDVLELATSAEVSAIYDKALAINKVLQPIFADVNVTLIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           GR  D     ++LADEI PD CRLWD + K++ DK  F +    L E Y+ +  RLG
Sbjct: 181 GRDAD---GHVLLADEISPDTCRLWDATTKQKLDKDVFRRDLGNLTEVYTIILSRLG 234


>gi|154706363|ref|YP_001424657.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Coxiella
           burnetii Dugway 5J108-111]
 gi|165919006|ref|ZP_02219092.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Coxiella
           burnetii RSA 334]
 gi|154355649|gb|ABS77111.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Coxiella
           burnetii Dugway 5J108-111]
 gi|165917261|gb|EDR35865.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Coxiella
           burnetii RSA 334]
          Length = 240

 Score =  251 bits (640), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 93/237 (39%), Positives = 131/237 (55%), Gaps = 4/237 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             R  +Y  K K +YE  EPG LI  F+DD    +  +   L  KGV+NN+I+ ++   L
Sbjct: 5   SKRKLLYSGKVKSMYETDEPGFLIAEFRDDTTAFDGEKHEKLARKGVINNQINAHIMQAL 64

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
              GI  +F   ++  E LVR ++MIPL   VRN AAGSL +RL I  GL L   L E +
Sbjct: 65  KDAGILTHFESVLSPNESLVRRLKMIPLECVVRNIAAGSLCRRLGIESGLRLNPPLYELF 124

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
              D+    +++E H  +F WA Q++++ M  LS +IN+ +  LF  +N+ LVD + + G
Sbjct: 125 LKNDALHDPMINENHALSFGWATQAQLDRMKELSFKINNVLFALFSNVNLILVDAKYEFG 184

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
              D     I L DEI PD CR+WD   KE  DK RF K   +++E Y E+A R  I
Sbjct: 185 VSDD----EIYLGDEISPDSCRIWDAKTKEPLDKDRFRKDMGRVVESYEEIAHRFQI 237


>gi|297624668|ref|YP_003706102.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Truepera
           radiovictrix DSM 17093]
 gi|297165848|gb|ADI15559.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Truepera
           radiovictrix DSM 17093]
          Length = 265

 Score =  251 bits (640), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 81/235 (34%), Positives = 129/235 (54%), Gaps = 3/235 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
           R    +YE K K +Y    P  L+  FKDD    N  +   + GKG +N+ +S  +F  L
Sbjct: 30  RRGALLYEGKAKQVYATEHPERLVVAFKDDATAFNAQKRGVIAGKGEVNSAVSARLFGLL 89

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
              G+P +F++ ++ REQLVR V++IPL + VR  AAGS A R  + EG  L  +++E+ 
Sbjct: 90  EAAGVPTHFLKTLSPREQLVRAVQIIPLEVVVRRFAAGSFAARYGVAEGEVLEPTVLEWC 149

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D+     ++++   A   A   E+  +  L++++++ +   F    ++L+DF+++ G
Sbjct: 150 YKSDALGDPPLNDDTALALKLATPDELRALRRLALKVSEVLGDFFASRGLELIDFKLEFG 209

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           R        ++LADEI PD CRLWD    E  DK RF +    + E Y EVARR+
Sbjct: 210 R---APGGELLLADEISPDTCRLWDRQSGERLDKDRFRRDLGGVEEAYQEVARRV 261


>gi|325955233|ref|YP_004238893.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Weeksella
           virosa DSM 16922]
 gi|323437851|gb|ADX68315.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Weeksella
           virosa DSM 16922]
          Length = 240

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 90/240 (37%), Positives = 134/240 (55%), Gaps = 3/240 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             ++ +YE K K +Y   E   +I ++KDD    N  +  T+  KG +NN+IS  +F  L
Sbjct: 4   TKKDFIYEGKAKQVYATEEADKVIVYYKDDATAFNAQKRGTVKDKGEMNNKISTLIFHYL 63

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
              GIP +FI ++N REQLV+ V +IPL + VRN  AGS+A+RL + EG   P ++ +  
Sbjct: 64  MNKGIPTHFIEQLNDREQLVKKVSIIPLEMVVRNYVAGSMAQRLGLEEGAKSPITIFDLC 123

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     L+++ H      A   E+EE+  L+ +IN+ +  LFL   + L DF+I+ G
Sbjct: 124 YKKDELGDPLINDHHAVLLGAATYDELEELYKLTDKINEALKELFLEAGLILADFKIEFG 183

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKK 241
           +  +     I+LADEI PD CRLWD+   ++ DK RF +    + E Y EV  RL    K
Sbjct: 184 KDAE---GNIILADEISPDTCRLWDVETGKKLDKDRFRRDLGDVSEAYHEVYNRLSAILK 240


>gi|149375127|ref|ZP_01892899.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Marinobacter algicola DG893]
 gi|149360491|gb|EDM48943.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Marinobacter algicola DG893]
          Length = 237

 Score =  250 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 83/238 (34%), Positives = 131/238 (55%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K +Y   +P   +  F+DD    +  +   LN KG++NNR + ++  +
Sbjct: 1   MEKREELYAGKAKSVYRTDDPDRFVMVFRDDTSAFDGEKKEQLNRKGMVNNRFNAFIMEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+P +F   ++  E LV+ ++MIP+   VRN +AGSL +RL + EGL+L     E 
Sbjct: 61  LEAAGVPTHFEGLLSDTESLVKKLDMIPVECVVRNISAGSLCRRLGVEEGLTLNPPTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E    +F WA   E+  M  L+ ++ND +  LF    + LVD++++ 
Sbjct: 121 FLKNDAMHDPMVNESLAVSFGWAKAEELARMKELTYQVNDVLKALFEEAGMLLVDYKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR       +IVL DE  PD CR+WD   +++ DK RF +    ++E Y EV RRLGI
Sbjct: 181 GR----SGGQIVLGDEFSPDGCRIWDRETRKKMDKDRFRQGLGDVIETYEEVGRRLGI 234


>gi|325971977|ref|YP_004248168.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Spirochaeta sp. Buddy]
 gi|324027215|gb|ADY13974.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Spirochaeta sp. Buddy]
          Length = 237

 Score =  250 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 83/236 (35%), Positives = 135/236 (57%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K +YE  + G  I  +KDD    N  +  ++ GKG +NN+++ ++   
Sbjct: 1   MQKLAMLYEGKAKRVYETDQKGVYIVSYKDDATAFNGKKKGSILGKGAINNQVTNHLMQL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GIP +F+ +++  E  V+ V ++PL + VR+ AAGSL++RL + EG  L  +++EF
Sbjct: 61  LSKEGIPTHFVAQLSETETAVKAVRIVPLEVIVRSIAAGSLSERLGLKEGTKLASTVIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     LV+  HI A   A + ++E +T  S++IND ++   + + I L+DF+++ 
Sbjct: 121 CYKRDDLNDPLVNNSHIKALGLATEQQLELITKYSLKINDILSAYLVEVGIALIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G         +VLADEI  D CR WD+   ++ DK RF +    + E Y EV +RL
Sbjct: 181 GIT---SEGELVLADEISSDTCRFWDIKTGKKLDKDRFRRDLGDVEEAYHEVMQRL 233


>gi|317054982|ref|YP_004103449.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Ruminococcus albus 7]
 gi|315447251|gb|ADU20815.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Ruminococcus albus 7]
          Length = 239

 Score =  250 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 81/234 (34%), Positives = 132/234 (56%), Gaps = 3/234 (1%)

Query: 3   PRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLG 62
               +YE K K +Y   +P  +I  +KDD    N  +  T+ GKGV+NNR++ +MF +L 
Sbjct: 6   KGEQLYEGKAKKVYATNDPDLVIVDYKDDATAFNGEKKGTIVGKGVINNRMTNFMFKKLE 65

Query: 63  KIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYY 122
             G+P + +  ++ RE LV+ V ++PL + +RN AAGS +KR+ +PEG  L   ++EF Y
Sbjct: 66  AAGVPTHLVEELSDRETLVKKVSIVPLEVIIRNVAAGSFSKRMGVPEGKELLTPILEFSY 125

Query: 123 LPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGR 182
             D      +++ +  A   A + E++ +   +  +N FM   F G+ + L+DF+I+ G+
Sbjct: 126 KNDDLGDPFINDYYALALGLATKEELDTIAKYAFAVNSFMVDFFKGVGVDLIDFKIEFGK 185

Query: 183 LLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
             D     I+LADEI PD CR WD    E+ DK RF +    + + Y E+ +R+
Sbjct: 186 TSD---GTIILADEISPDTCRFWDSKTHEKLDKDRFRRDMGGVEDAYQEMMKRV 236


>gi|257454674|ref|ZP_05619930.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Enhydrobacter aerosaccus SK60]
 gi|257447984|gb|EEV22971.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Enhydrobacter aerosaccus SK60]
          Length = 242

 Score =  250 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 88/238 (36%), Positives = 140/238 (58%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+  + +Y+ K K ++E   P  LI  F+DD    N  R   L  KG +NNR + ++  +
Sbjct: 1   MQKLDLLYKGKAKSVFETDNPDYLILEFRDDTSAFNGERIEQLARKGKVNNRFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +F ++++  E LV+ + MIP+   VRN AAGSL +RL + EG +L     E 
Sbjct: 61  LSEAGIETHFEQQLSDEEVLVKRLTMIPVECVVRNYAAGSLVRRLGLQEGQALTPPTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +Y  D     +V++    +  WA Q++++EM AL+ ++ND ++ +F    + LVDF+++ 
Sbjct: 121 FYKDDGLGDPMVNDSLAVSLGWATQAQLDEMKALTFKVNDVLSKMFDDGGLMLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G   D    RIVL DE  PD CR+WD   K++ DK RF +S   ++EGY EVA+R+G+
Sbjct: 181 GVFKD----RIVLGDEFSPDGCRVWDKQTKKKLDKDRFRQSLGDVVEGYEEVAKRIGV 234


>gi|257126286|ref|YP_003164400.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Leptotrichia buccalis C-1013-b]
 gi|257050225|gb|ACV39409.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Leptotrichia buccalis C-1013-b]
          Length = 239

 Score =  250 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 84/237 (35%), Positives = 125/237 (52%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K I+       +I +FKDD    N  +   L  KG+LNN+IS  ++  
Sbjct: 1   MEKREQIYEGKAKSIFATDNADEIIMYFKDDATAFNGVKKDQLEDKGILNNKISTLIYGY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+  ++I  +N REQL + VE++PL + +RN A GS  K+    EG        E 
Sbjct: 61  LIKNGVKTHWIETLNEREQLCKKVEIVPLEVIIRNRATGSFVKKYGAEEGKIFKNPTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L++++H  A    +  E++E+   +  IN  ++ +F  +N+ LVDF+I+ 
Sbjct: 121 SYKNDDLGDPLLNDDHALALELVSAEELKEIKEQTFLINKLLSEIFDKMNLILVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           GR  D     I+LADEI PD  RLWD    ++ DK RF +    ++  Y EV RRL 
Sbjct: 181 GRDKD---GNILLADEISPDSMRLWDKDTLKKLDKDRFRQDLGDVMGAYREVLRRLE 234


>gi|326562036|gb|EGE12365.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Moraxella
           catarrhalis 46P47B1]
          Length = 236

 Score =  250 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 87/238 (36%), Positives = 139/238 (58%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +YE   P  LI  F++D    N  +  +L+ KGV+NNR + ++  +
Sbjct: 1   MQKQALLYTGKAKSVYETDHPDYLILHFRNDASAFNGEKMESLDRKGVVNNRFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +F ++++  E LV+ ++MIP+   VRN AAG L KRL + EGL L     E 
Sbjct: 61  LAEAGIETHFEKQLSDDEVLVKRLKMIPVEAVVRNYAAGGLMKRLGLSEGLPLLPPTYEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +Y  D+    ++SE    A  +A   E+ +M +L++++N+ ++ LF    + LVDF+++ 
Sbjct: 121 FYKDDALGDPMLSESTAIALGYATADELAQMQSLTLKVNEVLSKLFDDAGLMLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        R+VL DE  PD CRLWD   K++ DK RF +    ++EGY EVARR+G+
Sbjct: 181 GLF----QGRVVLGDEFSPDGCRLWDKQTKKKLDKDRFRQGLGDVVEGYEEVARRIGV 234


>gi|138893916|ref|YP_001124369.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Geobacillus thermodenitrificans NG80-2]
 gi|196250534|ref|ZP_03149225.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Geobacillus sp. G11MC16]
 gi|134265429|gb|ABO65624.1| Phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Geobacillus thermodenitrificans NG80-2]
 gi|196210024|gb|EDY04792.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Geobacillus sp. G11MC16]
          Length = 243

 Score =  250 bits (638), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 92/236 (38%), Positives = 137/236 (58%), Gaps = 3/236 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             +  +YE K K IY   E   L   +KD     N  + AT+ GKG LNN IS  +F +L
Sbjct: 4   TKQQLLYEGKAKKIYATDEADVLWVEYKDSATAFNGEKKATITGKGRLNNEISSLLFMKL 63

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            + G+ ++FI++++  EQLV+ V +IPL + VRN  AGSLAKR+ + EG  L   LVEFY
Sbjct: 64  QEAGVANHFIQKLSPTEQLVKSVTIIPLEVVVRNVVAGSLAKRIGLAEGTPLEVPLVEFY 123

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     L+ E+HIT    A++ E+ ++ + ++++ND +   F    ++L+DF+++ G
Sbjct: 124 YKNDDLGDPLLLEDHITILKLASREEIAQLKSEALKVNDVLRAHFAERKVRLIDFKLEFG 183

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           R  D     I+LADE+ PD CRLWD    E+ DK  F +    L E Y  + +RLG
Sbjct: 184 RTTD---GAILLADEVSPDTCRLWDAETNEKLDKDVFRRDLGSLTEAYEVILQRLG 236


>gi|289522498|ref|ZP_06439352.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Anaerobaculum hydrogeniformans ATCC BAA-1850]
 gi|289504334|gb|EFD25498.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Anaerobaculum hydrogeniformans ATCC BAA-1850]
          Length = 324

 Score =  250 bits (638), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 97/242 (40%), Positives = 138/242 (57%), Gaps = 3/242 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +YE  +P   I  +KD     N  +  T+ GKG L N IS      
Sbjct: 1   MNKIKLIYEGKAKKVYETDDPSLAIFEYKDSLTAFNAQKKDTMQGKGRLTNLISATFLKL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP +F++ ++   QLV+ +++IPL + VRNT+ GSL KRL + EGL L   LVEF
Sbjct: 61  LQDKGIPTHFVKLLDDNHQLVKRLKIIPLEVVVRNTSTGSLCKRLGVEEGLDLVPPLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y   D     LV+E+HI AF +A++  VE+M  L +++N+ ++       I+LVDF+++ 
Sbjct: 121 YLKNDELGDPLVTEDHIRAFGFASKPHVEKMKELCLKVNEILSKYLFERGIKLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           G     D   I +ADEI PD CR WDL+ KE  DK RF K    +LE Y E+ RR+  + 
Sbjct: 181 GMD---DEGNIFVADEISPDTCRFWDLTSKERLDKDRFRKDLGNVLEAYEEIWRRIADWD 237

Query: 241 KN 242
           K+
Sbjct: 238 KS 239


>gi|315651147|ref|ZP_07904179.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Eubacterium saburreum DSM 3986]
 gi|315486612|gb|EFU76962.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Eubacterium saburreum DSM 3986]
          Length = 235

 Score =  250 bits (638), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 91/238 (38%), Positives = 140/238 (58%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +++  EP  LI  +KDD    N  +  T+ GKG +NNR++ ++F  
Sbjct: 1   MEKLEQLYEGKAKKVFKTAEPDVLIVSYKDDATAFNGEKKGTIVGKGAINNRMTNHLFKL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+P +FI  +N RE  V+ VE++PL + VRN +AGS AK+L + EG+ L    +EF
Sbjct: 61  LEKKGVPTHFIEELNDRETAVKAVEIVPLEVIVRNYSAGSFAKKLGMEEGIKLKTPTLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D      ++  +  A + A Q E++++ + + ++N+ +   F  + I L+DF+I+ 
Sbjct: 121 SYKDDDLGDPFINGYYALALDLATQEEIDKIASYAFKVNETLINYFDNLGIDLIDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR   D    I+LADEI PD CRLWD +  E+ DK RF +    + + Y+EV RRLGI
Sbjct: 181 GRYKKD----IILADEISPDTCRLWDKNTHEKLDKDRFRRDLGGVEDAYAEVFRRLGI 234


>gi|187934734|ref|YP_001885302.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium botulinum B str. Eklund 17B]
 gi|229485917|sp|B2TN72|PUR7_CLOBB RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|187722887|gb|ACD24108.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium botulinum B str. Eklund 17B]
          Length = 235

 Score =  250 bits (638), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 88/236 (37%), Positives = 134/236 (56%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K IY   +   ++ ++KDD    N  +   +  KGV+NN+I+  +F Q
Sbjct: 1   MEKLEMLYEGKAKQIYATDKADEVVIYYKDDATAFNGEKKGQITDKGVMNNKITSILFEQ 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI  +FI+++N REQL + V ++PL + VRN AAGS+AKRL + EG  L  ++ EF
Sbjct: 61  LEKQGIKTHFIKKLNDREQLCKKVSIVPLEVIVRNVAAGSMAKRLGLEEGTKLKTTVFEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L++  H  A   A   E++ +  ++ +IN+ +   F   NI L+DF+I+ 
Sbjct: 121 SYKDDELGDPLINSYHAVAIGAATFEEIDTILEMTAKINNILKEAFAKENINLIDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+  D     IVLADEI PD CR WD +  E+ DK RF +    + + Y E+ +R+
Sbjct: 181 GKCAD---GTIVLADEISPDTCRFWDATTGEKLDKDRFRRDLGNVEDAYIEILKRI 233


>gi|228989450|ref|ZP_04149436.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           pseudomycoides DSM 12442]
 gi|228995645|ref|ZP_04155308.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           mycoides Rock3-17]
 gi|229003274|ref|ZP_04161104.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           mycoides Rock1-4]
 gi|228757892|gb|EEM07107.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           mycoides Rock1-4]
 gi|228764022|gb|EEM12906.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           mycoides Rock3-17]
 gi|228770271|gb|EEM18849.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           pseudomycoides DSM 12442]
          Length = 239

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 91/237 (38%), Positives = 131/237 (55%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  + AT+ GKG LNN I+  +F +
Sbjct: 1   MQKLELLYEGKAKRIYRTEAADMVWVEYKDSATAFNGEKKATITGKGRLNNEITTLLFRK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+ +++  EQLV+ V +IPL +  RN  AGSL+KRL + EG  L   +VEF
Sbjct: 61  LQEVGIKTHFVEKLSDTEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGTVLAAPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     LV+E+HI   N A   +V  +   +++IN  +   F    ++LVDF+++ 
Sbjct: 121 YYKDDDLGDPLVTEDHIRVLNVATPEQVSTLREKALQINQVLIEHFASCRVRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     +   IVLADEI PD CRLWD    E+ DK  F +    L E Y E+ +RLG
Sbjct: 181 GVT---EEGEIVLADEISPDTCRLWDEESNEKFDKDVFRRDLGNLTEAYEEILKRLG 234


>gi|331090964|ref|ZP_08339806.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Lachnospiraceae bacterium 2_1_46FAA]
 gi|330405186|gb|EGG84722.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 235

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 86/238 (36%), Positives = 143/238 (60%), Gaps = 3/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K ++   +P  +I  +KDD    N  +  T+ GKGV+NNR++ ++F  
Sbjct: 1   MKKLEQLYEGKAKKVFMTDDPDVVIVDYKDDATAFNGEKKGTIVGKGVVNNRMTNHVFKL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           + K G+P + +  ++ RE  V+ V+++PL + VRN AAGS +KR+ + EG  L   ++EF
Sbjct: 61  IEKEGVPTHLVEELSDRETAVKKVDIVPLEVIVRNVAAGSFSKRMGVEEGKELLCPILEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D      +++++  A   A Q E++ + A + ++N+ +   FL  +++L+DF+I+ 
Sbjct: 121 SYKNDDLGDPFINDDYALALGLATQEEIDTIKAYTRKVNEVLKAYFLQADMKLIDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GRL D     I+LADE+ PD CRLWD+   E+ DK RF +    + E Y+EV +RLGI
Sbjct: 181 GRLKD---GTIILADEVSPDTCRLWDVHTNEKLDKDRFRRDMGNVEEAYNEVFKRLGI 235


>gi|269120716|ref|YP_003308893.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sebaldella termitidis ATCC 33386]
 gi|268614594|gb|ACZ08962.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sebaldella termitidis ATCC 33386]
          Length = 235

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 83/237 (35%), Positives = 134/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  ++ +YE K K IY   +   +I  +KDD    N  +  ++  KG++NN+I+  +FT+
Sbjct: 1   MEKKDFLYEGKAKQIYSTDDENYVIIHYKDDATAGNGEKKGSIKDKGIINNQITALLFTR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +F  ++N R+QL   V++ PL + VRN   GS++KRL + EG     +++E 
Sbjct: 61  LEEKGIRTHFKEKLNDRDQLCEKVKIFPLEVIVRNIITGSMSKRLGVKEGTKPENTILEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A   A   E++++  ++++INDF+  LF    I LVDF+I+ 
Sbjct: 121 CYKNDEYGDPLINDHHAVALGLATYDELKKIYEITLKINDFLKELFDKEGIILVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G+        I+LADEI PD CRLWD    ++ DK RF +    + E Y E+ +RL 
Sbjct: 181 GKN---SKGEILLADEITPDTCRLWDKETGKKLDKDRFRQDLGGIEEAYIEILKRLE 234


>gi|160881173|ref|YP_001560141.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium phytofermentans ISDg]
 gi|189038234|sp|A9KQ90|PUR7_CLOPH RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|160429839|gb|ABX43402.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium phytofermentans ISDg]
          Length = 235

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 93/238 (39%), Positives = 141/238 (59%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K +Y+      LI  +KDD    N  +  T+ GKGV+NNR+S Y+  Q
Sbjct: 1   MKKLEQLYEGKAKKVYKTDVEDVLIVDYKDDATAFNGEKRGTIVGKGVINNRMSNYIMKQ 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+P ++I  ++ RE  V+ V+++PL + +RN +AGS AK+L I EG  L    +EF
Sbjct: 61  LEKEGVPTHYIEELSDRETAVKKVQIVPLEVIIRNVSAGSFAKKLGIEEGRKLLCPTLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  DS    +++  +  A   A Q E++ ++  + ++N+ M   F GI I+L+DF+I+ 
Sbjct: 121 SYKDDSLGDPMINSSYAKALGLATQEEIDTISTYAYKVNEVMIKYFEGIGIELIDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR  D    +I+LADEI PD CRLWD+   E+ DK RF +    + + Y EV +RLGI
Sbjct: 181 GRYHD----QIILADEISPDTCRLWDIKTHEKLDKDRFRRDLGNVEDAYLEVFKRLGI 234


>gi|296112467|ref|YP_003626405.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Moraxella
           catarrhalis RH4]
 gi|295920161|gb|ADG60512.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Moraxella
           catarrhalis RH4]
          Length = 236

 Score =  250 bits (637), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 87/238 (36%), Positives = 138/238 (57%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +YE   P  LI  F++D    N  +  +L+ KGV+NNR + ++  +
Sbjct: 1   MQKQALLYTGKAKSVYETDHPDYLILHFRNDASAFNGEKMESLDRKGVVNNRFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +F ++++  E LV+ ++MIP+   VRN AAG L KRL + EGL L     E 
Sbjct: 61  LADAGIETHFEKQLSDDEVLVKRLKMIPVEAVVRNYAAGGLMKRLGLSEGLPLLPPTYEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +Y  D+    ++SE    A  +A   E+ +M +L++++N+ ++ LF    + LVDF+++ 
Sbjct: 121 FYKDDALGDPMLSESTAIALGYATADELAQMQSLTLKVNEVLSKLFDDAGLMLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        R+VL DE  PD CRLWD   K++ DK RF +    ++EGY EVARR+G+
Sbjct: 181 GLF----QGRVVLGDEFSPDGCRLWDKQTKKKLDKDRFRQGLGDVVEGYEEVARRIGV 234


>gi|229055118|ref|ZP_04195546.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus AH603]
 gi|228721194|gb|EEL72723.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus AH603]
          Length = 258

 Score =  250 bits (637), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 91/237 (38%), Positives = 133/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  + AT+ GKG LNN I+  +F +
Sbjct: 20  MQKLELLYEGKAKRIYRTEAADMVWVEYKDSATAFNGEKKATITGKGRLNNEITTLLFRK 79

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+ +++  EQLV+ V +IPL +  RN  AGSL+KRL + EG +L   +VEF
Sbjct: 80  LQEVGIKTHFVEKLSDTEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGTALTTPIVEF 139

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     LV+E+HI   N A   +V  +   +++IN  M   F    ++LVDF+++ 
Sbjct: 140 YYKDDDLGDPLVTEDHIRLLNVATPEQVSVLRDAALQINQVMIEHFASCRVRLVDFKLEF 199

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     +   I+LADEI PD CRLWD +  E+ DK  F +    L E Y E+ +RLG
Sbjct: 200 GVT---EEGEIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNLTEAYEEILKRLG 253


>gi|160934359|ref|ZP_02081746.1| hypothetical protein CLOLEP_03230 [Clostridium leptum DSM 753]
 gi|156867032|gb|EDO60404.1| hypothetical protein CLOLEP_03230 [Clostridium leptum DSM 753]
          Length = 235

 Score =  250 bits (637), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 86/238 (36%), Positives = 141/238 (59%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K +Y   +   +I  +KDD    N  +  T+ GKGV+NN++S Y+   
Sbjct: 1   MQKAQMMYEGKAKKVYATDDDRYVIVSYKDDATAFNGQKKGTIVGKGVVNNKMSNYLMQM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+   ++  +N RE +++ VE++PL + VRN AAGS +KRL + EG  L   ++EF
Sbjct: 61  LEKNGVKTDYVEELNDRETVLKKVEIVPLEVIVRNKAAGSFSKRLGVAEGTELKCPILEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    +V+E H+ A  +A + E++ +T+++ RIND +   F    ++L+DF+++ 
Sbjct: 121 CYKDDALGDPMVNEYHVLAMGYATREELDTITSMTFRINDLLKEFFAKTGVELIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR        I+LADEI PD CR WD+   E+ DK RF +    + E Y+E+ +R+G+
Sbjct: 181 GRC----DGEILLADEISPDTCRFWDIRTHEKLDKDRFRRDMGGVEEAYAEMMKRIGL 234


>gi|319655017|ref|ZP_08009088.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           sp. 2_A_57_CT2]
 gi|317393284|gb|EFV74051.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           sp. 2_A_57_CT2]
          Length = 241

 Score =  250 bits (637), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 89/237 (37%), Positives = 138/237 (58%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +Y+  +   +   +KD     N  + A+++GKG LNN I+  +F++
Sbjct: 1   MEKGELLYEGKAKKVYQTNDENIVWIEYKDSATAFNGEKKASISGKGRLNNEITSLLFSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  +GI  +FI R++  EQLV+ V++IPL   VRN AAGS +KRL + EG  LPR +VEF
Sbjct: 61  LHDLGIESHFIERLSETEQLVKKVDIIPLETVVRNVAAGSFSKRLGVVEGKELPRPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     L++E+HI     A++ E   +   ++++N  +   F  + I+LVDF+++ 
Sbjct: 121 YYKDDELGDPLLTEDHIEVLELADKKEAALLQEKALQVNAILRDFFKDLGIKLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G+    +  +I+LADEI PD CRLWD+   E+ DK  F +    L + Y  +  RLG
Sbjct: 181 GKD---ESGQILLADEISPDTCRLWDIETNEKLDKDVFRRDLGNLTDAYENILARLG 234


>gi|323703206|ref|ZP_08114859.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfotomaculum nigrificans DSM 574]
 gi|323531865|gb|EGB21751.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfotomaculum nigrificans DSM 574]
          Length = 234

 Score =  250 bits (637), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 83/236 (35%), Positives = 133/236 (56%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +Y    P      +KDD    N  +  T+  KGV+NN++S  +F  
Sbjct: 1   MNKLEMMYEGKAKKVYRTDNPDYYWVEYKDDATAFNGQKKGTIENKGVVNNKVSAVLFQL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           +   GIP +F+  +N RE +V+ +++I + + VRN  AGSLAKR+ +PEG  LP++++E+
Sbjct: 61  MESKGIPTHFVELVNDREMIVKALDIIKVEVVVRNIVAGSLAKRIGLPEGTVLPKTVLEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     L+++ HI A   A   ++E ++  ++++N+ +      INI LVDF+++ 
Sbjct: 121 YYKDDELGDPLINDYHIAALGLATPEQMEYISTTALKVNNILREYLAPINIDLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G        +++L DEI PD CR WD +  E+ DK RF +    +   Y EV RRL
Sbjct: 181 GLHH----GQVLLGDEISPDTCRFWDKTTGEKLDKDRFRRDLGNVEGAYQEVLRRL 232


>gi|71734052|ref|YP_273793.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|298486122|ref|ZP_07004186.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|123637444|sp|Q48LD2|PUR7_PSE14 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|71554605|gb|AAZ33816.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|298159367|gb|EFI00424.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|320325210|gb|EFW81277.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. glycinea str. B076]
 gi|320327795|gb|EFW83803.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330877419|gb|EGH11568.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. glycinea str. race 4]
          Length = 236

 Score =  250 bits (637), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 85/238 (35%), Positives = 130/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K +Y+  +   LI  F++D    +  R   L+ KG++NN+ + ++  +
Sbjct: 1   MEKREELYRGKAKSVYKTDDADRLILLFRNDTSAFDGKRIEQLDRKGMVNNKFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+P  F + +   E LV+ ++MIP+   VRN AAGSL KRL I EG  L     E 
Sbjct: 61  LEEAGVPTQFDKLLGDNECLVKKLDMIPVECVVRNYAAGSLVKRLGIEEGTRLNPYTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+     ++E H+ AF W    ++  M  LSI++N+ +T LF    + LVDF+++ 
Sbjct: 121 FLKDDAKGDPFINESHVVAFGWGTAEQLVRMKELSIKVNEVLTKLFDDAGLLLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         IVL DE  PD CRLWD   +++ DK RF +    ++E Y EVA RLG+
Sbjct: 181 GVFH----GEIVLGDEFSPDGCRLWDKDTRKKMDKDRFRQGLGDVIEAYEEVANRLGV 234


>gi|326570739|gb|EGE20765.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Moraxella
           catarrhalis BC8]
          Length = 236

 Score =  250 bits (637), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 87/238 (36%), Positives = 139/238 (58%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +YE   P  LI  F++D    N  +  +L+ KGV+NNR + ++  +
Sbjct: 1   MQKQALLYTGKAKSVYETDHPDYLILHFRNDASAFNGEKMESLDRKGVVNNRFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +F ++++  E LV+ ++MIP+   VRN AAG L KRL + EGL L     E 
Sbjct: 61  LAEAGIETHFEKQLSDDEVLVKRLKMIPVEAVVRNYAAGGLMKRLGLSEGLPLLPPTYEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +Y  D+    ++SE    A  +A   E+ +M +L++++N+ ++ LF    + LVDF+++ 
Sbjct: 121 FYKDDTLGDPMLSESTAIALGYATADELAQMQSLTLKVNEVLSKLFDDAGLMLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        R+VL DE  PD CRLWD   K++ DK RF +    ++EGY EVARR+G+
Sbjct: 181 GLF----QGRVVLGDEFSPDGCRLWDKQTKKKLDKDRFRQGLGDVVEGYEEVARRIGV 234


>gi|154500470|ref|ZP_02038508.1| hypothetical protein BACCAP_04142 [Bacteroides capillosus ATCC
           29799]
 gi|150270701|gb|EDM97997.1| hypothetical protein BACCAP_04142 [Bacteroides capillosus ATCC
           29799]
          Length = 238

 Score =  250 bits (637), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 85/235 (36%), Positives = 126/235 (53%), Gaps = 3/235 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             R  +YE K K +Y   +P  +I  +KDD    N  +  T+ GKG +NNR++  +  +L
Sbjct: 4   EKREQLYEGKAKKVYATDDPQVVIVSYKDDATAFNGLKKGTITGKGAINNRMTNNLMRRL 63

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            + G+P +++  ++ RE  V+ V ++PL + VRN +AGS AKR  + EG+      +EF 
Sbjct: 64  EEKGVPTHYVEELSDRETAVKKVSIVPLEVIVRNISAGSFAKRYGVEEGIVFDEPTIEFS 123

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     L++  H  A   A + E+  +   +  +ND + G    I I LVDF+++ G
Sbjct: 124 YKNDDLGDPLLNTYHALALKLATKEEIALIEKYTFMVNDLLKGFMKEIGIDLVDFKLEFG 183

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           +  D     IVLADEI PD CRLWD    E+ DK RF +      E Y EV RRL
Sbjct: 184 KTAD---GTIVLADEISPDTCRLWDEKTHEKLDKDRFRRDMGGAEEAYEEVMRRL 235


>gi|188589747|ref|YP_001920433.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium botulinum E3 str. Alaska E43]
 gi|251778031|ref|ZP_04820951.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium botulinum E1 str. 'BoNT E Beluga']
 gi|229485916|sp|B2V3B9|PUR7_CLOBA RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|188500028|gb|ACD53164.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium botulinum E3 str. Alaska E43]
 gi|243082346|gb|EES48236.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium botulinum E1 str. 'BoNT E Beluga']
          Length = 235

 Score =  250 bits (637), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 89/236 (37%), Positives = 135/236 (57%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K IY   +   ++ ++KDD    N  +   +  KGV+NN+I+  +F Q
Sbjct: 1   MEKLEMLYEGKAKQIYATDKADEVVIYYKDDATAFNGEKKGQITDKGVMNNKITSILFEQ 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI  +FI+++N REQL + VE++PL + VRN AAGS+AKRL + EG  L  ++ EF
Sbjct: 61  LEKQGIKTHFIKKLNDREQLCKKVEIVPLEVIVRNVAAGSMAKRLGLEEGTKLKTTVFEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L++  H  A   A   E++ +  ++ +IN+ +   F   NI L+DF+I+ 
Sbjct: 121 SYKDDELGDPLINSYHAVAIGAATFEEIDTILEMTAKINNILKEAFAKENINLIDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+  D     IVLADEI PD CR WD +  E+ DK RF +    + + Y E+ +R+
Sbjct: 181 GKCAD---GTIVLADEISPDTCRFWDATTGEKLDKDRFRRDLGNVEDAYIEILKRI 233


>gi|257463304|ref|ZP_05627702.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fusobacterium sp. D12]
 gi|317060884|ref|ZP_07925369.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fusobacterium sp. D12]
 gi|313686560|gb|EFS23395.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fusobacterium sp. D12]
          Length = 238

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 87/236 (36%), Positives = 134/236 (56%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +Y   +   +I  +KDD    N  +  +++ KG++NN I+  +F  
Sbjct: 1   MERREFLYEGKAKQLYATEDKDLVIVHYKDDATAGNGAKKGSIHNKGIMNNEITALIFNM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +F++++N R+QL + V++ PL + VRN  AGS+AKR+ I EG     ++ E 
Sbjct: 61  LEEHGIKTHFVKKLNERDQLCQKVQIFPLEVIVRNLIAGSMAKRVGIAEGTKPSNTIFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A N A   E++E+ A++ +IN+ +   F  I I LVDF+I+ 
Sbjct: 121 CYKNDEYGDPLINDHHAVALNLATYEELKEIYAITSKINELLKEKFDKIGITLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+        I+LADEI PD CRLWD    E+ DK RF +    + E Y EV +RL
Sbjct: 181 GKN---SKGEILLADEITPDTCRLWDKETGEKLDKDRFRRDLGNIEEAYIEVVKRL 233


>gi|66044797|ref|YP_234638.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. syringae B728a]
 gi|75502825|sp|Q4ZW72|PUR7_PSEU2 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|63255504|gb|AAY36600.1| SAICAR synthetase [Pseudomonas syringae pv. syringae B728a]
          Length = 236

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 87/238 (36%), Positives = 130/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K +Y+  +   LI  F++D    +  R   L+ KG++NN+ + ++  +
Sbjct: 1   MEKREELYRGKAKSVYKTDDADRLILLFRNDTSAFDGKRIEQLDRKGMVNNKFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP  F + +   E LV+ ++MIP+   VRN AAGSL KRL I EG  L     E 
Sbjct: 61  LEEAGIPTQFDKLLGDNECLVKKLDMIPVECVVRNYAAGSLVKRLGIEEGTRLNPYTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+     ++E H+ AF W    ++  M  LSI++ND +T LF    + LVDF+++ 
Sbjct: 121 FLKDDAKGDPFINESHVVAFGWGTAEQLARMKELSIKVNDVLTKLFDDAGLLLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         IVL DE  PD CRLWD   +++ DK RF +    ++E Y EVA RLG+
Sbjct: 181 GVFH----GEIVLGDEFSPDGCRLWDKDTRKKMDKDRFRQGLGDVIEAYEEVANRLGV 234


>gi|289628950|ref|ZP_06461904.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289651068|ref|ZP_06482411.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. aesculi str. 2250]
 gi|330868052|gb|EGH02761.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. aesculi str. 0893_23]
          Length = 236

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 85/238 (35%), Positives = 130/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K +Y+  +   LI  F++D    +  R   L+ KG++NN+ + ++  +
Sbjct: 1   MEKREELYRGKAKSVYKTDDADRLILLFRNDTSAFDGKRIEQLDRKGMVNNKFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+P  F + +   E LV+ ++MIP+   VRN AAGSL KRL I EG  L     E 
Sbjct: 61  LEEAGVPTQFDKLLGDNECLVKKLDMIPVECVVRNYAAGSLVKRLGIEEGTRLNPYTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+     ++E H+ AF W    ++  M  LSI++N+ +T LF    + LVDF+++ 
Sbjct: 121 FLKDDAKGDPFINESHVVAFGWGTAEQLVRMKELSIKVNEVLTKLFDDAGLLLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         IVL DE  PD CRLWD   +++ DK RF +    ++E Y EVA RLG+
Sbjct: 181 GVFH----GEIVLGDEFSPDGCRLWDKDTRKKMDKDRFRQGLGDVIEAYEEVASRLGV 234


>gi|152974111|ref|YP_001373628.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus subsp. cytotoxis NVH 391-98]
 gi|189038241|sp|A7GKH5|PUR7_BACCN RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|152022863|gb|ABS20633.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cytotoxicus NVH 391-98]
          Length = 239

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 90/237 (37%), Positives = 136/237 (57%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  + AT+ GKG LNN I+ ++F +
Sbjct: 1   MQKLELLYEGKAKRIYRTEAADMVWIEYKDSATAFNGEKKATITGKGRLNNEITTFLFRK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+++++  EQLV+ V +IPL +  RN  AGSL+KRL + EG+ L + +VEF
Sbjct: 61  LQEVGIETHFVKKLSDTEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGIPLAKPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     LV+E+HI   N A   ++  +   ++RIN  +   F    ++L+DF+++ 
Sbjct: 121 YYKDDDLGDPLVTEDHIRVLNAATLEQISTLREKALRINQVLIEHFASCRVRLIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     +  +IVLADEI PD CRLWD    E+ DK  F +    L E Y E+ +RLG
Sbjct: 181 GIT---EEGKIVLADEISPDTCRLWDEESNEKFDKDVFRRDLGNLTEAYEEILKRLG 234


>gi|256027254|ref|ZP_05441088.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fusobacterium sp. D11]
 gi|289765228|ref|ZP_06524606.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Fusobacterium sp. D11]
 gi|289716783|gb|EFD80795.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Fusobacterium sp. D11]
          Length = 237

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 86/236 (36%), Positives = 133/236 (56%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +YE  +   +I  +KDD    N  +  T++ KG++NN I+  +F  
Sbjct: 1   MEKGKFIYEGKAKQLYETDDKDLVIVHYKDDATAGNGAKKGTIHNKGIMNNEITTLIFNM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +F++++N R+QL + V++ PL + VRN  AGS+AKRL I EG  +  ++ E 
Sbjct: 61  LEEHGIKTHFVKKLNDRDQLCQRVKIFPLEVIVRNIIAGSMAKRLGIKEGTKINNAIFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A   A   E++++  ++ +IN+ +   F  I I LVDF+I+ 
Sbjct: 121 CYKNDEYGDPLINDHHAVALGIATYDELKKIYEITAKINNLLKEKFDKIGITLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+        I+LADEI PD CRLWD    E+ DK RF +    + E Y EV +RL
Sbjct: 181 GKN---SKGEILLADEITPDTCRLWDKKTGEKLDKDRFRRDLGNIEEAYIEVVKRL 233


>gi|317131193|ref|YP_004090507.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Ethanoligenens harbinense YUAN-3]
 gi|315469172|gb|ADU25776.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Ethanoligenens harbinense YUAN-3]
          Length = 238

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 88/236 (37%), Positives = 141/236 (59%), Gaps = 4/236 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
                +YE K K +Y+  +P   I  +KDD    N  +  T++GKGV+NNR++ ++  +L
Sbjct: 3   TKLEQIYEGKAKKVYKTDDPELFIVDYKDDATAFNGKKKGTISGKGVINNRVTNFLMEKL 62

Query: 62  -GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
             + G+P +F++ ++ RE LV+ V ++PL + +RN AAGS++KRL IPEG  LP   +EF
Sbjct: 63  EKEAGVPTHFVKELSERETLVKKVTIVPLEVIIRNIAAGSMSKRLGIPEGTVLPIPTLEF 122

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D  +  L+++ H  A   A + +++ +T L+ ++ND++   F GI I+LVDF+++ 
Sbjct: 123 SYKNDDLDDPLINDYHALAMGLATREDIDTITTLAFKVNDYLKTFFAGIGIELVDFKLEF 182

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+  D     I+LADEI PD CR WD    E+ DK RF +    +   Y E+  RL
Sbjct: 183 GKTTD---GTIILADEISPDTCRFWDSKTHEKLDKDRFRRDLGNVEGAYQEILHRL 235


>gi|237744475|ref|ZP_04574956.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Fusobacterium sp. 7_1]
 gi|260493972|ref|ZP_05814103.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fusobacterium sp. 3_1_33]
 gi|229431704|gb|EEO41916.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Fusobacterium sp. 7_1]
 gi|260198118|gb|EEW95634.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fusobacterium sp. 3_1_33]
          Length = 237

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 86/236 (36%), Positives = 133/236 (56%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +YE  +   +I  +KDD    N  +  T++ KG++NN I+  +F  
Sbjct: 1   MEKGKFIYEGKAKQLYETDDKDLVIVHYKDDATAGNGAKKGTIHNKGIMNNEITTLIFNM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +F++++N R+QL + V++ PL + VRN  AGS+AKRL I EG  +  ++ E 
Sbjct: 61  LEEHGIKTHFVKKLNDRDQLCQRVKIFPLEVIVRNIIAGSMAKRLGIKEGTKINNTIFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A   A   E++++  ++ +IN+ +   F  I I LVDF+I+ 
Sbjct: 121 CYKNDEYGDPLINDHHAVALGIATYDELKKIYEITAKINNLLKEKFDKIGITLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+        I+LADEI PD CRLWD    E+ DK RF +    + E Y EV +RL
Sbjct: 181 GKN---SKGEILLADEITPDTCRLWDKKTGEKLDKDRFRRDLGNIEEAYIEVVKRL 233


>gi|228899009|ref|ZP_04063282.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis IBL 4222]
 gi|228860584|gb|EEN04971.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis IBL 4222]
          Length = 258

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 88/237 (37%), Positives = 133/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  +  T+ GKG LNN I+  +F +
Sbjct: 20  MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITGKGRLNNEITTLLFRK 79

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+ +++  EQLV+ V +IPL +  RN  AGSL+KRL + EG  L   +VEF
Sbjct: 80  LQEVGIKTHFVEKLSETEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGTVLAEPIVEF 139

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D     LV+E+HI   N A+  +V  +  ++++IN  +   F    ++LVDF+++ 
Sbjct: 140 YFKDDDLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVLIDHFASCRVRLVDFKLEF 199

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     +   I+LADEI PD CRLWD +  E+ DK  F +    L E Y E+ +RLG
Sbjct: 200 GVT---EEGEIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNLTEAYEEILKRLG 253


>gi|313158495|gb|EFR57889.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Alistipes
           sp. HGB5]
          Length = 238

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 93/241 (38%), Positives = 137/241 (56%), Gaps = 3/241 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K ++   +P  +I  +KD     NN + AT+  KGVLNN IS  +F +
Sbjct: 1   MKQLEMLYEGKAKQVFRTDDPEKIIIHYKDAATAFNNIKKATIENKGVLNNAISTLIFKE 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI  ++I  IN R+Q+ R V +IPL + VRN  AGS+A+RL I EG     ++ + 
Sbjct: 61  LQKAGIKTHYIETINDRDQICRKVTIIPLEVIVRNIIAGSMAQRLGIEEGTQPSNTIYDI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A       E++ + A++ RIN+ +  +F  +NI LVDF+I+ 
Sbjct: 121 CYKKDELGDPLINDHHAVALGAVTYDELDLIYAMTSRINEVLRNMFAKMNINLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR  D     IVLADE+ PD CRLWD+S  E+ DK RF +   ++ E Y E+  RL    
Sbjct: 181 GRTSD---GEIVLADEVSPDTCRLWDMSTNEKLDKDRFRRDLGKVREAYEEILARLQKIV 237

Query: 241 K 241
           +
Sbjct: 238 E 238


>gi|268608779|ref|ZP_06142506.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Ruminococcus flavefaciens FD-1]
          Length = 239

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 84/235 (35%), Positives = 136/235 (57%), Gaps = 3/235 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             +  +YE K K +Y   +P  +I  +KDD    N  +  T+ GKGV+NNR++ +MF  L
Sbjct: 5   EKKEQLYEGKAKKVYATNDPDLVIVDYKDDATAFNGEKKGTIAGKGVINNRMTNFMFKML 64

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            K G+P + +  I+ RE +V+ V ++PL + +RN AAGS +KR+ + EG  L   ++E+ 
Sbjct: 65  EKEGVPTHLVEEISDRETIVKKVSIVPLEVIIRNVAAGSFSKRMGVEEGKQLLCPILEYS 124

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D      +++ +  A   A + E++ +   + ++N+FM   F G+NI L+DF+I+ G
Sbjct: 125 YKNDDLGDPFINDYYALALGIATKEELDTIAKYAFKVNEFMVKFFKGLNIDLIDFKIEFG 184

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           +  D     I+LADEI PD CR WD +  E+ DK RF +    + E Y E+ +RL
Sbjct: 185 KTSD---GTIILADEISPDTCRFWDSTTHEKLDKDRFRRDMGGVEEAYQEIMKRL 236


>gi|22001879|sp|Q9RXT0|PUR7_DEIRA RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
          Length = 237

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 84/236 (35%), Positives = 133/236 (56%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M      YE K K +Y    P   +  +KDD    N  +     GKG  NN I+ +++ Q
Sbjct: 1   MTRGEMKYEGKAKRVYATENPHEYVVEYKDDATAFNAQKRGEWAGKGATNNAITAHLYPQ 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP +F+ +++ REQ V+ V ++P+ + VRN AAGS +KRL + EG  LPR +VE+
Sbjct: 61  LEAAGIPTHFLEKLSDREQRVKAVTIVPVEVIVRNVAAGSFSKRLGVEEGTPLPRPVVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    L++ +   A  WA++ +++ +  L+++I DF+   F    ++L+DF+++ 
Sbjct: 121 CYKSDALGDPLINTDTAVALGWASEDDLKRIRELALQIRDFLVPYFEKRGVRLIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+L       IVLADEI PD CR WD    E+ DK RF +      E Y+E+ +R+
Sbjct: 181 GKLP---SGEIVLADEISPDTCRFWDAETNEKMDKDRFRRDLGGEAEAYAEMLKRV 233


>gi|326561600|gb|EGE11939.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Moraxella
           catarrhalis 7169]
 gi|326565339|gb|EGE15518.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Moraxella
           catarrhalis 103P14B1]
 gi|326568048|gb|EGE18138.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Moraxella
           catarrhalis BC7]
 gi|326577361|gb|EGE27247.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Moraxella
           catarrhalis 101P30B1]
          Length = 236

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 87/238 (36%), Positives = 138/238 (57%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +YE   P  LI  F++D    N  +  +L+ KGV+NNR + ++  +
Sbjct: 1   MQKQALLYTGKAKSVYETDHPDYLILHFRNDASAFNGEKMESLDRKGVVNNRFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +F ++++  E LV+ ++MIP+   VRN AAG L KRL + EGL L     E 
Sbjct: 61  LADAGIETHFEKQLSDDEVLVKRLKMIPVEAVVRNYAAGGLMKRLGLSEGLPLLPPTYEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +Y  D+    ++SE    A  +A   E+ +M +L++++N+ ++ LF    + LVDF+++ 
Sbjct: 121 FYKDDTLGDPMLSESTAIALGYATADELAQMQSLTLKVNEVLSKLFDDAGLMLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        R+VL DE  PD CRLWD   K++ DK RF +    ++EGY EVARR+G+
Sbjct: 181 GLF----QGRVVLGDEFSPDGCRLWDKQTKKKLDKDRFRQGLGDVVEGYEEVARRIGV 234


>gi|257483920|ref|ZP_05637961.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|330894757|gb|EGH27418.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. mori str. 301020]
 gi|330959287|gb|EGH59547.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. maculicola str. ES4326]
 gi|331013149|gb|EGH93205.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 236

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 86/238 (36%), Positives = 130/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K +Y+  +   LI  F++D    +  R   L+ KG++NN+ + ++  +
Sbjct: 1   MEKREELYRGKAKSVYKTDDADRLILLFRNDTSAFDGKRIEQLDRKGMVNNKFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP  F + +   E LV+ ++MIP+   VRN AAGSL KRL I EG  L     E 
Sbjct: 61  LEEAGIPTQFDKLLGDNECLVKKLDMIPVECVVRNYAAGSLVKRLGIEEGTRLNPYTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+     ++E H+ AF W    ++  M  LSI++N+ +T LF    + LVDF+++ 
Sbjct: 121 FLKDDAKGDPFINESHVVAFGWGTAEQLVRMKELSIKVNEVLTKLFDDAGLLLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         IVL DE  PD CRLWD   +++ DK RF +    ++E Y EVA RLG+
Sbjct: 181 GVFH----GEIVLGDEFSPDGCRLWDKDTRKKMDKDRFRQGLGDVIEAYEEVANRLGV 234


>gi|229015671|ref|ZP_04172656.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus AH1273]
 gi|228745621|gb|EEL95638.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus AH1273]
          Length = 258

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 89/237 (37%), Positives = 133/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  +  T+ GKG LNN I+  +F +
Sbjct: 20  MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITGKGRLNNEITTLLFRK 79

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+ +++  EQLV+ V +IPL +  RN  AGSL+KRL + EG  L   +VEF
Sbjct: 80  LQEVGIKTHFVEKLSETEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGTVLAEPIVEF 139

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D     LV+E+HI   N A+  +V  +  ++++IN  +   F    ++LVDF+++ 
Sbjct: 140 YFKDDDLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVLIDHFASCRVRLVDFKLEF 199

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     D   I+LADEI PD CRLWD +  E+ DK  F +    L E Y E+ +RLG
Sbjct: 200 GVT---DEGEIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNLTEAYEEILKRLG 253


>gi|254479196|ref|ZP_05092543.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Carboxydibrachium pacificum DSM 12653]
 gi|214034859|gb|EEB75586.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Carboxydibrachium pacificum DSM 12653]
          Length = 234

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 83/238 (34%), Positives = 136/238 (57%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K +Y+  +    I  +KDD    N  +   +  KGV+NN++S  +F  
Sbjct: 1   MEKKELLYEGKAKKVYKTDKEDYYIIEYKDDATAFNGLKKGVIEEKGVVNNKVSSILFEF 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI  ++++ ++ RE LV+ V + PL + +RN AAGS+ KRL + EG+     ++EF
Sbjct: 61  LEKNGISTHYVKMLSDREMLVKKVTIFPLEVIIRNYAAGSICKRLGLQEGIKFKEPVLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     +++E HI A   A + E++ +   + ++N+ ++  FL  +I LVDF+++ 
Sbjct: 121 CYKNDELGDPMINEYHIRALELATRDEIDLIKERAFKVNEILSEYFLSKDIILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G+  +     I+LADEI PD CR WD +  E+ DK RF K   Q+ E Y E+ RR+ +
Sbjct: 181 GKNQEG----ILLADEISPDTCRFWDKNTMEKLDKDRFRKDLGQVEEAYLEILRRVQV 234


>gi|26987975|ref|NP_743400.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas putida KT2440]
 gi|148546513|ref|YP_001266615.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas putida F1]
 gi|37999644|sp|Q88NG9|PUR7_PSEPK RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|166230834|sp|A5VZX1|PUR7_PSEP1 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|24982689|gb|AAN66864.1|AE016314_11 phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas putida KT2440]
 gi|148510571|gb|ABQ77431.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas putida F1]
 gi|313497592|gb|ADR58958.1| PurC [Pseudomonas putida BIRD-1]
          Length = 236

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 84/238 (35%), Positives = 134/238 (56%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K +Y+  +   LI  F++D    +  R   L+ KG++NN+ + ++  +
Sbjct: 1   MEKREELYRGKAKSVYKTDDADRLILLFRNDTSAFDGKRIEQLDRKGMVNNKFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+P  F + +   E LV+ ++MIP+   VRN AAGSL KRL + EG+ L  S  E 
Sbjct: 61  LEEAGVPTQFDKLLGDNECLVKKLDMIPVECVVRNYAAGSLVKRLGVEEGIKLEPSTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D      ++E H+ AF W    ++ EM  LS+++N+ ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDEKGDPFINESHVVAFGWGTAEQLVEMKKLSLKVNEVLSKLFDDAGLLLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        +IVL DE  PD CRLWD   +++ DK RF +    ++E Y EVA+RLG+
Sbjct: 181 GVFH----GQIVLGDEFSPDGCRLWDKETRKKMDKDRFRQGLGDVIEAYEEVAKRLGV 234


>gi|303229180|ref|ZP_07315981.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Veillonella atypica ACS-134-V-Col7a]
 gi|303231570|ref|ZP_07318299.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Veillonella atypica ACS-049-V-Sch6]
 gi|302513816|gb|EFL55829.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Veillonella atypica ACS-049-V-Sch6]
 gi|302516193|gb|EFL58134.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Veillonella atypica ACS-134-V-Col7a]
          Length = 242

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 87/235 (37%), Positives = 130/235 (55%), Gaps = 4/235 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
                +YE K K +Y+  +  T I  +KDD    N  +  T+ GKGVLNN+IS + F  L
Sbjct: 7   EKLTLLYEGKAKQVYQTDDKETYIVHYKDDATAFNGEKHDTILGKGVLNNKISSFFFELL 66

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            K G+P +F+RR + R Q V  + ++PL + VRN AAGS+AKR  I EG  L   ++EF 
Sbjct: 67  KKEGVPTHFVRREDDRNQTVLTLNIVPLEVIVRNIAAGSMAKRFGIEEGTPLKHPILEFC 126

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D       +E  ITA  WA Q +++ ++ +++++ND +       N+ LVDF+++ G
Sbjct: 127 YKNDELGDPFANESQITALGWATQEQLDRISEITMKVNDILKNFLATKNVTLVDFKLEFG 186

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
                    ++L DEI PD CR WD +  E+ DK RF +    + E Y E+  RL
Sbjct: 187 ----THNGEVLLGDEISPDTCRFWDATTGEKLDKDRFRRDLGNIEEAYKEMLFRL 237


>gi|229009775|ref|ZP_04166995.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           mycoides DSM 2048]
 gi|229165257|ref|ZP_04293045.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus AH621]
 gi|228618204|gb|EEK75241.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus AH621]
 gi|228751393|gb|EEM01199.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           mycoides DSM 2048]
          Length = 239

 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 90/237 (37%), Positives = 133/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  + AT+ GKG LNN I+  +F +
Sbjct: 1   MQKLELLYEGKAKRIYRTEAADMVWVEYKDSATAFNGEKKATITGKGRLNNEITTLLFRK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+ +++  EQLV+ V +IPL +  RN  AGSL+KRL + EG +L   +VEF
Sbjct: 61  LQEVGIKTHFVEKLSDTEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGTALTTPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     LV+E+HI   N A   +V  +   +++IN  +   F    ++LVDF+++ 
Sbjct: 121 YYKDDDLGDPLVTEDHIRLLNVATPEQVSVLRDAALQINQVLIEHFASCRVRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     +   I+LADEI PD CRLWD +  E+ DK  F +    L E Y E+ +RLG
Sbjct: 181 GVT---EEGEIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNLTEAYEEILKRLG 234


>gi|229194665|ref|ZP_04321458.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus m1293]
 gi|228588768|gb|EEK46793.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus m1293]
          Length = 258

 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 88/237 (37%), Positives = 133/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  +  T+ GKG LNN I+  +F +
Sbjct: 20  MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITGKGRLNNEITTLLFRK 79

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+ +++  EQLV+ V +IPL +  RN  AGSL+KRL + EG  L   +VEF
Sbjct: 80  LQEVGIKTHFVEQLSETEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGTVLAEPIVEF 139

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D     LV+E+HI   N A+  +V  +  ++++IN  +   F    ++LVDF+++ 
Sbjct: 140 YFKDDDLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVLIDHFASCRVRLVDFKLEF 199

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     D   I+LADEI PD CRLWD +  E+ DK  F +    L + Y E+ +RLG
Sbjct: 200 GVT---DEGEIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNLTDAYEEILKRLG 253


>gi|330879889|gb|EGH14038.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. morsprunorum str. M302280PT]
          Length = 236

 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 86/238 (36%), Positives = 129/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K +Y+  +   LI  F++D    +  R   L+ KG +NN+ + ++  +
Sbjct: 1   MEKREELYRGKAKSVYKTDDADRLILLFRNDTSAFDGKRIEQLDRKGTVNNKFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP  F + +   E LV+ ++MIP+   VRN AAGSL KRL I EG  L     E 
Sbjct: 61  LEEAGIPTQFDKLLGDTECLVKKLDMIPVECVVRNYAAGSLVKRLGIEEGTKLNPYTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+     ++E H+ AF W    ++  M  LSI++N+ +T LF    + LVDF+++ 
Sbjct: 121 FLKDDAKGDPFINESHVVAFGWGTAEQLVRMKELSIKVNEVLTKLFDDAGLLLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         IVL DE  PD CRLWD   +++ DK RF +    ++E Y EVA RLG+
Sbjct: 181 GVFH----GEIVLGDEFSPDGCRLWDKDTRKKMDKDRFRQGLGDVIEAYEEVANRLGV 234


>gi|253584332|ref|ZP_04861530.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Fusobacterium varium ATCC 27725]
 gi|251834904|gb|EES63467.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Fusobacterium varium ATCC 27725]
          Length = 238

 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 84/236 (35%), Positives = 129/236 (54%), Gaps = 3/236 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
           + +  +YE K K +Y   +   +I  +KDD    N  +  T+  KG++NN+I+  +F  L
Sbjct: 4   QKKEFIYEGKAKQVYSTDDENLVIIHYKDDATAGNGAKKGTIENKGIMNNKITAMLFEML 63

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            K GI  + +  +N R+QL + V++ PL + VRN  AGS+AKR+ + EG     ++ E  
Sbjct: 64  EKNGIKTHLVEVLNDRDQLCQKVKIFPLEVIVRNVIAGSMAKRVGVEEGTKPVNTIFEIC 123

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D+    L+++ H  A   A   E+ E+  ++ +IND +   F  I I LVDF+I+ G
Sbjct: 124 YKNDAYGDPLINDHHAVALGLATYEELAEIYRITGQINDLLKNAFDKIGITLVDFKIEFG 183

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           +        I+LADEI PD CRLWD     + DK RF +    + E Y EV +RLG
Sbjct: 184 KN---SKGEILLADEITPDTCRLWDKETGMKLDKDRFRRDLGGIEEAYIEVLKRLG 236


>gi|326564963|gb|EGE15164.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Moraxella
           catarrhalis 12P80B1]
          Length = 236

 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 87/238 (36%), Positives = 140/238 (58%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +YE   P  LI  F++D    N  +  +L+ KGV+NNR + ++  +
Sbjct: 1   MQKQALLYTGKAKSVYETDHPDYLILHFRNDASAFNGEKMESLDRKGVVNNRFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +F ++++  E LV+ ++MIP+   VRN AAG L KRL + EGL L     E 
Sbjct: 61  LAEAGIETHFEKQLSDDEVLVKRLKMIPVEAVVRNYAAGGLMKRLGLSEGLPLLPPTYEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +Y  D+    ++SE    A  +A   E+ +M +L++++N+ ++ LF   ++ LVDF+++ 
Sbjct: 121 FYKDDALGDPMLSESTAIALGYATADELAQMQSLTLKVNEVLSKLFDEADLMLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        R+VL DE  PD CRLWD   K++ DK RF +    ++EGY EVARR+G+
Sbjct: 181 GLF----QGRVVLGDEFSPDGCRLWDKQTKKKLDKDRFRQGLGDVVEGYEEVARRIGV 234


>gi|262067601|ref|ZP_06027213.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Fusobacterium periodonticum ATCC 33693]
 gi|291378718|gb|EFE86236.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Fusobacterium periodonticum ATCC 33693]
          Length = 237

 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 87/236 (36%), Positives = 132/236 (55%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +YE  +   +I  +KDD    N  +  T++ KGV+NN I+  +F  
Sbjct: 1   MEKGKFIYEGKAKQLYETDDKDLVIVHYKDDATAGNGAKKGTIHNKGVMNNEITTLIFNM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +F++++N R+QL + V + PL + VRN  AGS+AKR+ I EG  +  ++ E 
Sbjct: 61  LEEHGIKTHFVKKLNDRDQLCQRVTIFPLEVIVRNIIAGSMAKRVGIKEGTKINNTIFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A   A   E++E+  ++ +IN+ +   F  I I LVDF+I+ 
Sbjct: 121 CYKNDEYGDPLINDHHAVAMGLATYDELKEIYDITGKINNLLKEKFDKIGITLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+        I+LADEI PD CRLWD    E+ DK RF +    + E Y EV +RL
Sbjct: 181 GKN---SKGEILLADEITPDTCRLWDKETGEKLDKDRFRRDLGNIEEAYIEVVKRL 233


>gi|163938282|ref|YP_001643166.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           weihenstephanensis KBAB4]
 gi|229131279|ref|ZP_04260181.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus BDRD-ST196]
 gi|229485664|sp|A9VRE8|PUR7_BACWK RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|163860479|gb|ABY41538.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           weihenstephanensis KBAB4]
 gi|228652165|gb|EEL08100.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus BDRD-ST196]
          Length = 239

 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 91/237 (38%), Positives = 133/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  + AT+ GKG LNN I+  +F +
Sbjct: 1   MQKLELLYEGKAKRIYRTEAADMVWVEYKDSATAFNGEKKATITGKGRLNNEITTLLFRK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+ +++  EQLV+ V +IPL +  RN  AGSL+KRL + EG +L   +VEF
Sbjct: 61  LQEVGIKTHFVEKLSDTEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGTALTTPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     LV+E+HI   N A   +V  +   +++IN  M   F    ++LVDF+++ 
Sbjct: 121 YYKDDDLGDPLVTEDHIRLLNVATPEQVSVLRDAALQINQVMIEHFASCRVRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     +   I+LADEI PD CRLWD +  E+ DK  F +    L E Y E+ +RLG
Sbjct: 181 GVT---EEGEIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNLTEAYEEILKRLG 234


>gi|28871097|ref|NP_793716.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213969682|ref|ZP_03397817.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. tomato T1]
 gi|301384796|ref|ZP_07233214.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. tomato Max13]
 gi|302060716|ref|ZP_07252257.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. tomato K40]
 gi|302131944|ref|ZP_07257934.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|37999573|sp|Q87Y59|PUR7_PSESM RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|28854347|gb|AAO57411.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213925490|gb|EEB59050.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. tomato T1]
 gi|330964852|gb|EGH65112.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. actinidiae str. M302091]
 gi|331017399|gb|EGH97455.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 236

 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 86/238 (36%), Positives = 129/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K +Y+  +   LI  F++D    +  R   L+ KG +NN+ + ++  +
Sbjct: 1   MEKREELYRGKAKSVYKTDDADRLILLFRNDTSAFDGKRIEQLDRKGTVNNKFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP  F + +   E LV+ ++MIP+   VRN AAGSL KRL I EG  L     E 
Sbjct: 61  LEEAGIPTQFDKLLGDNECLVKKLDMIPVECVVRNYAAGSLVKRLGIEEGTKLNPYTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+     ++E H+ AF W    ++  M  LSI++N+ +T LF    + LVDF+++ 
Sbjct: 121 FLKDDAKGDPFINESHVVAFGWGTAEQLVRMKELSIKVNEVLTKLFDDAGLLLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         IVL DE  PD CRLWD   +++ DK RF +    ++E Y EVA RLG+
Sbjct: 181 GVFH----GEIVLGDEFSPDGCRLWDKDTRKKMDKDRFRQGLGDVIEAYEEVANRLGV 234


>gi|289676520|ref|ZP_06497410.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. syringae FF5]
 gi|302187127|ref|ZP_07263800.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. syringae 642]
          Length = 236

 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 87/238 (36%), Positives = 130/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K +Y+  +   LI  F++D    +  R   L+ KG++NN+ + ++  +
Sbjct: 1   MEKREELYRGKAKSVYKTDDADRLILLFRNDTSAFDGKRIEQLDRKGMVNNKFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP  F + +   E LV+ ++MIP+   VRN AAGSL KRL I EG  L     E 
Sbjct: 61  LEEAGIPTQFDKLLGDNECLVKKLDMIPVECVVRNYAAGSLVKRLGIEEGTKLNPYTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+     ++E H+ AF W    ++  M  LSI++ND +T LF    + LVDF+++ 
Sbjct: 121 FLKDDAKGDPFINESHVVAFGWGTAEQLVRMKELSIKVNDVLTKLFDDAGLLLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         IVL DE  PD CRLWD   +++ DK RF +    ++E Y EVA RLG+
Sbjct: 181 GVFH----GEIVLGDEFSPDGCRLWDKDTRKKMDKDRFRQGLGDVIEAYEEVANRLGV 234


>gi|282849168|ref|ZP_06258553.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Veillonella parvula ATCC 17745]
 gi|294792986|ref|ZP_06758132.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Veillonella sp. 6_1_27]
 gi|282580872|gb|EFB86270.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Veillonella parvula ATCC 17745]
 gi|294455931|gb|EFG24295.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Veillonella sp. 6_1_27]
          Length = 242

 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 86/235 (36%), Positives = 128/235 (54%), Gaps = 4/235 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
                +YE K K +Y        I  +KDD    N  +  T+ GKGVLNN+IS + F  L
Sbjct: 7   EKLTLLYEGKAKQVYATDNKDEYIVHYKDDATAFNGEKHDTILGKGVLNNKISSFFFELL 66

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            K G+P +F+RR + R Q V  ++++PL + VRN AAGS+AKR  I EG  L   ++EF 
Sbjct: 67  KKEGVPTHFVRREDDRNQTVLALKIVPLEVIVRNIAAGSMAKRFGIEEGTPLKHPILEFC 126

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D       +E  ITA  WA Q +++ ++ +++++ND +       N+ LVDF+++ G
Sbjct: 127 YKNDELGDPFANESQITALGWATQEQLDVISTITLKVNDILKKFLATKNVTLVDFKVEFG 186

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
                    ++L DEI PD CR WD +  E+ DK RF +    + E Y E+  RL
Sbjct: 187 ----THNGEVLLGDEISPDTCRFWDATTGEKLDKDRFRRDLGNIEEAYKEMLFRL 237


>gi|237740536|ref|ZP_04571017.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fusobacterium sp. 2_1_31]
 gi|229422553|gb|EEO37600.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fusobacterium sp. 2_1_31]
          Length = 237

 Score =  249 bits (635), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 87/236 (36%), Positives = 133/236 (56%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +YE  +   +I  +KDD    N  +  T++ KGV+NN I+  +F  
Sbjct: 1   MEKGKFIYEGKAKQLYETDDKDLVIVHYKDDATAGNGAKKGTIHNKGVMNNEITTLIFNM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +F++++N R+QL + V++ PL + VRN  AGS+AKR+ I EG  +  ++ E 
Sbjct: 61  LEEHGIKTHFVKKLNDRDQLCQRVKIFPLEVIVRNIIAGSMAKRVGIKEGTKINNTIFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A   A   E++E+  ++ +IN+ +   F  I I LVDF+I+ 
Sbjct: 121 CYKNDEYGDPLINDHHAVAMGLATYDELKEIYDITAKINNLLKEKFDKIGITLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+        I+LADEI PD CRLWD    E+ DK RF +    + E Y EV +RL
Sbjct: 181 GKN---SKGEILLADEITPDTCRLWDKETGEKLDKDRFRRDLGNIEEAYIEVVKRL 233


>gi|229094995|ref|ZP_04225991.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus Rock3-29]
 gi|229101096|ref|ZP_04231862.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus Rock3-28]
 gi|229113948|ref|ZP_04243374.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus Rock1-3]
 gi|228669407|gb|EEL24823.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus Rock1-3]
 gi|228682224|gb|EEL36335.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus Rock3-28]
 gi|228688325|gb|EEL42207.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus Rock3-29]
          Length = 239

 Score =  249 bits (635), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 88/237 (37%), Positives = 133/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  +  T+ GKG LNN I+  +F +
Sbjct: 1   MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITGKGRLNNEITTLLFRK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+ +++  EQLV+ V +IPL +  RN  AGSL+KRL + EG  L   +VEF
Sbjct: 61  LQEVGIKTHFVEKLSETEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGTVLAEPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D     LV+E+HI   N A+  +V  +  ++++IN  +   F    ++LVDF+++ 
Sbjct: 121 YFKDDDLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVLIEHFASCRVRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     +   I+LADEI PD CRLWD +  E+ DK  F +    L E Y E+ +RLG
Sbjct: 181 GVT---EEGEIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNLTEAYEEILKRLG 234


>gi|330989394|gb|EGH87497.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. lachrymans str. M301315]
          Length = 236

 Score =  249 bits (635), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 86/238 (36%), Positives = 130/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K +Y+  +   LI  F++D    +  R   L+ KG++NN+ + ++  +
Sbjct: 1   MEKREELYRGKAKSVYKTDDADRLILLFRNDTSAFDGKRIEQLDRKGMVNNKFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP  F + +   E LV+ ++MIP+   VRN AAGSL KRL I EG  L     E 
Sbjct: 61  LEEAGIPTQFDKLLGDNECLVKKLDMIPVECVVRNYAAGSLVKRLGIEEGTKLNPYTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+     ++E H+ AF W    ++  M  LSI++N+ +T LF    + LVDF+++ 
Sbjct: 121 FLKDDAKGDPFINESHVVAFGWGTAEQLVRMKELSIKVNEVLTKLFDDAGLLLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         IVL DE  PD CRLWD   +++ DK RF +    ++E Y EVA RLG+
Sbjct: 181 GVFH----GEIVLGDEFSPDGCRLWDKDTRKKMDKDRFRQGLGDVIEAYEEVANRLGV 234


>gi|192360737|ref|YP_001983286.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cellvibrio japonicus Ueda107]
 gi|229485911|sp|B3PC16|PUR7_CELJU RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|190686902|gb|ACE84580.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cellvibrio japonicus Ueda107]
          Length = 236

 Score =  249 bits (635), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 80/238 (33%), Positives = 134/238 (56%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K I+   +P  L+  F++D    +  R   L+ KG++NN+ + ++  +
Sbjct: 1   MEKREQLYAGKAKSIFNTDDPDHLVMLFRNDTSAFDGKRVEQLDRKGMVNNKFNAFIMGK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP +F++ ++  E LV+ ++MIP+   VRN AAGSL +RL + EG  L     E 
Sbjct: 61  LQAAGIPTHFVKLLSDTEALVKKMDMIPVECVVRNLAAGSLVRRLGVQEGQVLNPPTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +++E H+ +F WA + ++  M  L+ +IN+ +  LF   N+ LVDF+++ 
Sbjct: 121 FLKNDALGDPMINESHVESFGWATREQLARMKELTFKINEVLKDLFAAGNMLLVDFKVEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         ++L DE  PD CRLWD   +E+ DK RF ++   ++E Y  V +RLG+
Sbjct: 181 GL----HKGEVILGDEFSPDGCRLWDKDTREKLDKDRFRQNLGNVVESYELVGQRLGL 234


>gi|296330102|ref|ZP_06872584.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           subtilis subsp. spizizenii ATCC 6633]
 gi|305673347|ref|YP_003865019.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           subtilis subsp. spizizenii str. W23]
 gi|296152691|gb|EFG93558.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           subtilis subsp. spizizenii ATCC 6633]
 gi|305411591|gb|ADM36710.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           subtilis subsp. spizizenii str. W23]
          Length = 241

 Score =  248 bits (634), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 88/238 (36%), Positives = 139/238 (58%), Gaps = 3/238 (1%)

Query: 3   PRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLG 62
               +YE K K IY+  +  TL   +KD     N  +   ++GKG LNN IS ++F  L 
Sbjct: 5   KNELLYEGKAKKIYKTDDENTLYVVYKDSATAFNGEKKEEISGKGRLNNEISSFIFKHLH 64

Query: 63  KIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYY 122
             GI ++FI RI+  EQL++ V ++PL + VRN  AGS++KRL IPEG  L + ++EFYY
Sbjct: 65  AKGINNHFIERISETEQLIKKVTIVPLEVVVRNVVAGSMSKRLGIPEGTELEQPIIEFYY 124

Query: 123 LPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGR 182
             D+    L++E+HI     A   +VE + +++  +N+ +  +F   +++L+DF+++ G 
Sbjct: 125 KDDALGDPLITEDHIWLLKAATPEQVETIKSITKTVNEELQAIFDDCHVRLIDFKLEFGL 184

Query: 183 LLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
             D    +++LADEI PD CRLWD    E+ DK  F ++   L + Y E+ +RLG   
Sbjct: 185 DAD---GQVLLADEISPDTCRLWDKDTNEKLDKDLFRRNLGSLTDAYEEIFKRLGGIH 239


>gi|257451954|ref|ZP_05617253.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fusobacterium sp. 3_1_5R]
 gi|317058504|ref|ZP_07922989.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fusobacterium sp. 3_1_5R]
 gi|313684180|gb|EFS21015.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fusobacterium sp. 3_1_5R]
          Length = 238

 Score =  248 bits (634), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 86/236 (36%), Positives = 134/236 (56%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +Y   +   +I  +KDD    N  +  +++ KG++NN I+  +F  
Sbjct: 1   MERREFLYEGKAKQLYATDDKDLVIVHYKDDATAGNGAKKGSIHNKGIMNNEITTLIFNM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +F++++N R+QL + V++ PL + VRN  AGS+AKR+ I EG     ++ E 
Sbjct: 61  LEEHGIKTHFVKKLNERDQLCQKVQIFPLEVIVRNLIAGSMAKRVGIAEGTKPSNTIFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A   A   E++E+ +++ +IND +   F  I I LVDF+I+ 
Sbjct: 121 CYKNDEYGDPLINDHHAVALKLATYEELKEIYSITAKINDLLREKFDKIGITLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+        I+LADEI PD CRLWD +  E+ DK RF +    + E Y EV +RL
Sbjct: 181 GKN---AKGEILLADEITPDTCRLWDKATGEKLDKDRFRRDLGNIEEAYIEVVKRL 233


>gi|229083567|ref|ZP_04215897.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus Rock3-44]
 gi|228699743|gb|EEL52398.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus Rock3-44]
          Length = 239

 Score =  248 bits (634), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 90/237 (37%), Positives = 131/237 (55%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  + AT+ GKG LNN I+  +F +
Sbjct: 1   MQKLELLYEGKAKRIYRTEAADMVWVEYKDSATAFNGEKKATITGKGRLNNEITTLLFRK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+ +++  EQLV+ V +IPL +  RN  AGSL+KRL + EG +L   +VE 
Sbjct: 61  LQEVGINTHFVEKLSDTEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGTALAAPIVEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     LV+E+HI   N A   +V  +   +++IN  +   F    ++LVDF+++ 
Sbjct: 121 YYKDDDLGDPLVTEDHIRVLNVATPEQVSILREQALQINQVLIENFASCRVRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     +   IVLADEI PD CRLWD    E+ DK  F +    L E Y E+ +RLG
Sbjct: 181 GLT---EEGEIVLADEISPDTCRLWDEESNEKFDKDVFRRDLGNLTEAYEEILKRLG 234


>gi|20515574|gb|AAM23859.1| Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [Thermoanaerobacter tengcongensis MB4]
          Length = 245

 Score =  248 bits (634), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 84/236 (35%), Positives = 135/236 (57%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K +Y+  +    I  +KDD    N  +   +  KGV+NN++S  +F  
Sbjct: 11  MEKKELLYEGKAKKVYKTDKEDYYIIEYKDDATAFNGLKKGVIEEKGVVNNKVSSILFEF 70

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GIP ++++ +  RE LV+ V + PL + +RN AAGS+ KRL + EG+     ++EF
Sbjct: 71  LEKRGIPTHYVKMLKDREMLVKKVTIFPLEVIIRNYAAGSICKRLGLQEGIKFKEPVLEF 130

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     +++E HI A   A + E++ +   + ++N+ ++  FL  +I LVDF+++ 
Sbjct: 131 CYKNDELGDPMINEYHIRALELATRDEIDLIKERAFKVNEILSEYFLSKDIILVDFKLEF 190

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+  +     I+LADEI PD CR WD +  E+ DK RF K   Q+ E Y E+ RR+
Sbjct: 191 GKNQEG----ILLADEISPDTCRFWDKNTMEKLDKDRFRKDLGQVEEAYLEILRRV 242


>gi|87118942|ref|ZP_01074840.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Marinomonas sp. MED121]
 gi|86165333|gb|EAQ66600.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Marinomonas sp. MED121]
          Length = 238

 Score =  248 bits (634), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 80/238 (33%), Positives = 133/238 (55%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ R  +Y  K K +++  +P  ++  F+DD    +  +   L+ KG++NN+ + ++ T+
Sbjct: 1   MQKREELYAGKAKSVFKTDDPDKMVLVFRDDTSAFDGKKMEQLDRKGMVNNKFNAFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP +F   ++  E LV+ ++M+P+   VRN AAGSL +RL + EGL L     E 
Sbjct: 61  LQEAGIPTHFESLLSDTECLVKCLDMMPVECVVRNIAAGSLCRRLGVEEGLELTPPTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D     +++E H+  F WA    +    AL+ ++ND +  LF    + LVD++++ 
Sbjct: 121 FLKNDDLGDPMINESHVEVFGWAKPEHLATAKALTYKVNDVLKALFAEGGMLLVDYKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD CRLWD + +E+ DK RF +    ++E Y EV RR+GI
Sbjct: 181 GLF----NGEVVLGDEFSPDGCRLWDSATREKLDKDRFRQGLGGVIEAYEEVGRRIGI 234


>gi|326573576|gb|EGE23538.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Moraxella
           catarrhalis CO72]
          Length = 236

 Score =  248 bits (634), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 87/238 (36%), Positives = 139/238 (58%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +YE   P  LI  F++D    N  +  +L+ KGV+NNR + ++  +
Sbjct: 1   MQKQALLYTGKAKSVYETDHPDYLILHFRNDASAFNGEKMESLDRKGVVNNRFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +F ++++  E LV+ ++MIP+   VRN AAG L KRL + EGL L     E 
Sbjct: 61  LADAGIETHFEKQLSDDEVLVKRLKMIPVEAVVRNYAAGGLMKRLGLSEGLPLLPPTYEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +Y  D+    ++SE    A  +A   E+ +M +L++++N+ ++ LF   ++ LVDF+++ 
Sbjct: 121 FYKDDALGDPMLSESTAIALGYATADELAQMQSLTLKVNEVLSKLFDEADLMLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        R+VL DE  PD CRLWD   K++ DK RF +    ++EGY EVARR+G+
Sbjct: 181 GLF----QGRVVLGDEFSPDGCRLWDKQTKKKLDKDRFRQGLGDVVEGYEEVARRIGV 234


>gi|294497096|ref|YP_003560796.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           megaterium QM B1551]
 gi|294347033|gb|ADE67362.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           megaterium QM B1551]
          Length = 235

 Score =  248 bits (634), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 86/237 (36%), Positives = 136/237 (57%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K IY   E   L   +K++    N  + A ++GK  LNN+IS  +F+ 
Sbjct: 1   MEKQELLYEGKAKKIYATDEQDVLWVAYKNEATAFNGQKKAEISGKAQLNNQISSLLFSM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +F+++++  EQ V+ VE++PL + VRN  AGSLAKR+ + EG+   + +VE 
Sbjct: 61  LHEQGITTHFVKQLSDHEQAVKKVEIVPLEVVVRNATAGSLAKRIGVEEGIRFEQPIVEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    L+  EH      A Q E++ + A +++IN+ ++  F   +I LVDF+++ 
Sbjct: 121 YYKDDALGDPLILAEHAIFLKAATQEEIDSLKAQALQINEILSKFFKDKDIFLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           GR        I+LADEI PD CR WD+   E+ DK  F +    L E Y ++ +R+G
Sbjct: 181 GRT---SQGDIILADEISPDTCRFWDVHTNEKLDKDVFRRDLGGLTEAYEKILQRIG 234


>gi|296132347|ref|YP_003639594.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermincola sp. JR]
 gi|296030925|gb|ADG81693.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermincola potens JR]
          Length = 239

 Score =  248 bits (634), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 88/235 (37%), Positives = 142/235 (60%), Gaps = 4/235 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
           + +  +YE K K +Y+  +P      +KDD    +  +  T+  KG+LNN+IS + F  L
Sbjct: 4   QKQELLYEGKAKKVYKTTDPDLYWVEYKDDATAFDGKKKGTIMNKGILNNKISTHFFNLL 63

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
              GIP + ++++N REQ+V+  ++I + + VRN AAGSL+KR+ +PEG  LPR+++EFY
Sbjct: 64  ESKGIPTHLVKQVNDREQIVKAAKIIMVEVVVRNIAAGSLSKRIGLPEGTMLPRTVLEFY 123

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D+    L++E HI A N A   +V+ ++++++++ND +        I L+DF+++ G
Sbjct: 124 YKDDALGDPLINEYHIYALNLATPEQVQTISSIALQVNDILREYLKDKKIDLIDFKLEFG 183

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
                    ++LADEI PD CR WD+  KE+ DK RF +    + E Y EV RRL
Sbjct: 184 I----HKGEVILADEISPDTCRFWDVETKEKLDKDRFRRDLGNVEEAYREVLRRL 234


>gi|92114930|ref|YP_574858.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chromohalobacter salexigens DSM 3043]
 gi|122419304|sp|Q1QTP9|PUR7_CHRSD RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|91798020|gb|ABE60159.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chromohalobacter salexigens DSM 3043]
          Length = 236

 Score =  248 bits (634), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 82/238 (34%), Positives = 132/238 (55%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R+ +Y  K K +Y   +P  LI  F+DD    +  +  +L  KG++NN+ + ++  +
Sbjct: 1   MEKRDELYAGKAKSVYRTDDPQRLILHFRDDTSAFDGKKKESLARKGMVNNKFNAFIMEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP +F + I   E +V+++EMIP+   VRN AAG L +RL + EG +L     E 
Sbjct: 61  LQAAGIPTHFEKLIADDECVVKNLEMIPVECVVRNVAAGGLVRRLGVEEGQTLTPPTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +++E     F WA   ++  M AL+ ++ND +  LFL   + LVD++++ 
Sbjct: 121 FLKDDAHGDPMINESLAETFGWATPEQLATMKALTFKVNDVLKQLFLDGGMLLVDYKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         ++L DE  PD CRLWD + +E+ DK RF +    ++E Y EV RR+GI
Sbjct: 181 GLF----DGEVMLGDEFSPDGCRLWDANTREKMDKDRFRQGLGGVIEAYEEVGRRIGI 234


>gi|317122262|ref|YP_004102265.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermaerobacter marianensis DSM 12885]
 gi|315592242|gb|ADU51538.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermaerobacter marianensis DSM 12885]
          Length = 244

 Score =  248 bits (634), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 82/235 (34%), Positives = 125/235 (53%), Gaps = 4/235 (1%)

Query: 3   PRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLG 62
               +YE K K++Y   +PG +  +FKDD    +  +  T+  KG LN RIS ++F  + 
Sbjct: 11  RGERLYEGKAKVVYATSDPGLVRIYFKDDATAFDGRKRGTIGNKGRLNARISAHLFRVVE 70

Query: 63  KIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYY 122
             G+P + +     +E L R VE+IPL + VRN  AGSLA+RL +  G  L   +VE YY
Sbjct: 71  AAGVPTHLVAVAGEQELLARRVEIIPLEVVVRNVVAGSLARRLGLEPGRVLEEPVVELYY 130

Query: 123 LPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGR 182
             D     L++  H+     A   E++ + A+++ +N  +       ++ LVDF+++ GR
Sbjct: 131 KRDDLGDPLINRAHVRLLGLATPEELDRIEAMALAVNRALRVYLAQRDLILVDFKLEFGR 190

Query: 183 LLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
             D     ++LADEI PD CR WD    E  DK RF +    + + Y+EV RRL 
Sbjct: 191 TGDG----LLLADEISPDTCRFWDRETGEPLDKDRFRRDLGGVEDAYAEVWRRLE 241


>gi|315453047|ref|YP_004073317.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Helicobacter felis ATCC 49179]
 gi|315132099|emb|CBY82727.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Helicobacter felis ATCC 49179]
          Length = 236

 Score =  248 bits (634), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 77/236 (32%), Positives = 123/236 (52%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K +Y    P   I  +KD+    N  + ATL GKG LNNRIS  + + 
Sbjct: 1   MNIQKLLYEGKAKKVYSTDNPQHYIVEYKDEATAFNGAKKATLQGKGRLNNRISNTLMSY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+  + ++ ++  + LV+ ++M PL + VRN AAGS+ KRL   E  +    LVEF
Sbjct: 61  LNDHGVLTHLVQEMSPTQTLVKQLKMFPLEVIVRNRAAGSICKRLGFEEARAFAPPLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+     ++++H+   N A   E   +  L+++IN  +   F  ++I LVDF+++ 
Sbjct: 121 CYKNDALGDPFINDDHVRILNLATPEECATIKTLALKINTLLEAYFQKLDIILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+        I+L DE+ PD CR W     E+ DK RF +    + E Y  +  ++
Sbjct: 181 GKD---AQGTIILGDEVSPDTCRFWHAQSGEKLDKDRFREDLGGVCEAYEMILNKI 233


>gi|170723133|ref|YP_001750821.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas putida W619]
 gi|229564403|sp|B1JDB4|PUR7_PSEPW RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|169761136|gb|ACA74452.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas putida W619]
          Length = 236

 Score =  248 bits (634), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 84/238 (35%), Positives = 133/238 (55%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K +Y+  +   LI  F++D    +  R   L+ KG++NN+ + ++  +
Sbjct: 1   MEKREELYRGKAKSVYKTDDADRLILLFRNDTSAFDGKRIEQLDRKGMVNNKFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+P  F + +   E LV+ ++MIP+   VRN AAGSL KRL + EG+ L  S  E 
Sbjct: 61  LEEAGVPTQFDKLLGDNECLVKKLDMIPVECVVRNYAAGSLVKRLGVEEGIKLEPSTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D      ++E H+ AF W    ++ EM  LS+++N+ +  LF    + LVDF+++ 
Sbjct: 121 FLKNDEKGDPFINESHVVAFGWGTAEQLAEMKKLSLKVNEVLNKLFDDAGLLLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        +IVL DE  PD CRLWD   +++ DK RF +    ++E Y EVA+RLG+
Sbjct: 181 GVFH----GQIVLGDEFSPDGCRLWDKETRKKMDKDRFRQGLGDVIEAYEEVAKRLGV 234


>gi|296125758|ref|YP_003633010.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Brachyspira murdochii DSM 12563]
 gi|296017574|gb|ADG70811.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Brachyspira murdochii DSM 12563]
          Length = 238

 Score =  248 bits (633), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 84/238 (35%), Positives = 128/238 (53%), Gaps = 3/238 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             +  +YE K K +Y   +P  +I ++KDD    N  +  ++  KGV+NN I+  +F  L
Sbjct: 4   EKKEMIYEGKAKKVYATDDPDQIIVYYKDDATAFNGEKKGSIKDKGVMNNEITSLLFKML 63

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            K GI  +FI ++N REQL + V++ PL + VRN  AGS+AKRL I EG   P ++ E  
Sbjct: 64  EKNGIKTHFIEKLNDREQLCQRVKIFPLEVIVRNLIAGSMAKRLGIEEGTVPPNTIFEIC 123

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     L+++ H  A   A   E++ +  ++ ++N+ +      I I LVDF+++ G
Sbjct: 124 YKNDEYGDPLINDHHAVALKLATYDELKYIYDVTSKVNNLLKEALDKIGITLVDFKVEFG 183

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
           +        I+LADEI PD CR WD    ++ DK RF +    + E Y EV  RL   
Sbjct: 184 KN---SKGEILLADEITPDTCRFWDKETGKKLDKDRFRRDLGSIEEAYIEVLNRLNNL 238


>gi|295702461|ref|YP_003595536.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           megaterium DSM 319]
 gi|294800120|gb|ADF37186.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           megaterium DSM 319]
          Length = 235

 Score =  248 bits (633), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 86/237 (36%), Positives = 136/237 (57%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K IY   E   L   +K++    N  + A ++GK  LNN+IS  +F+ 
Sbjct: 1   MEKQELLYEGKAKKIYATDEQDVLWVAYKNEATAFNGQKKAEISGKAQLNNQISSLLFSM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +F+++++  EQ V+ VE++PL + VRN  AGSLAKR+ + EG+   + +VE 
Sbjct: 61  LHEQGITTHFVKQLSDYEQAVKKVEIVPLEVVVRNATAGSLAKRIGVEEGIRFEQPIVEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    L+  EH      A Q E++ + A +++IN+ ++  F   +I LVDF+++ 
Sbjct: 121 YYKDDALGDPLILAEHAIFLKAATQEEIDSLKAQALQINEVLSKFFKDKDIFLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           GR        I+LADEI PD CR WD+   E+ DK  F +    L E Y ++ +R+G
Sbjct: 181 GRT---SQGDIILADEISPDTCRFWDVHTNEKLDKDVFRRDLGGLTEAYEKILQRIG 234


>gi|317051952|ref|YP_004113068.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfurispirillum indicum S5]
 gi|316947036|gb|ADU66512.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfurispirillum indicum S5]
          Length = 238

 Score =  248 bits (633), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 91/237 (38%), Positives = 140/237 (59%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+Y   +P  +IQ+FKDD    N  +  T+  KG++NNR SE +F  
Sbjct: 1   MEKREKLYEGKAKILYATDDPNLIIQYFKDDATAFNAEKKGTIINKGIMNNRTSEIIFNF 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+P +F++++N RE L + V++IP+ +  RN  AGSLAKRL   EG+ L + +VE 
Sbjct: 61  LENHGVPTHFVKKLNDREMLCKKVQIIPVEVITRNIVAGSLAKRLGSEEGVPLAKPVVEH 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+     ++  HI A  WA + ++  +  LS++IN  +   +  INI+LVD +++ 
Sbjct: 121 CYKSDALGDPFINIYHIDAMGWATREQMATIDELSLKINALLVNYYRDINIKLVDMKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G        +I+LADE+ PD  RLWD +  E+ DK RF +   ++ E Y+EV RR+ 
Sbjct: 181 GV----HKGQIILADEMCPDTSRLWDATTNEKMDKDRFRRDLGKIEESYAEVVRRIE 233


>gi|147678881|ref|YP_001213096.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pelotomaculum thermopropionicum SI]
 gi|146274978|dbj|BAF60727.1| phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [Pelotomaculum thermopropionicum SI]
          Length = 239

 Score =  248 bits (633), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 85/235 (36%), Positives = 129/235 (54%), Gaps = 4/235 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
           +    +YE K K +Y    P   +  FKDD    N  +  T+  KG LNN+IS   F  L
Sbjct: 3   QKLEQLYEGKAKRVYRTDSPDLYLVEFKDDATAFNGAKKGTIRNKGALNNQISAVFFRLL 62

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            K G+P +F+     RE LV+ +E++ + + VRN AAGSLAKRL +PEG +LP  ++EFY
Sbjct: 63  EKRGVPTHFVELAGEREMLVKALEILKVEVVVRNIAAGSLAKRLGLPEGTALPFPVLEFY 122

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     +++  HI A   A+  ++ ++   ++++N  +     G +I LVDF+++ G
Sbjct: 123 YKSDELGDPMINGYHIRALGLASPEQMAKIEETALKVNGILLEYLAGKDIDLVDFKLEFG 182

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
                    +VL DEI PD CR WD + +E+ DK RF +    +   Y E+ RRL
Sbjct: 183 ----THKGGLVLGDEISPDTCRFWDRTTREKLDKDRFRRDLGNVEGAYEEMFRRL 233


>gi|212638080|ref|YP_002314600.1| phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [Anoxybacillus flavithermus WK1]
 gi|226723536|sp|B7GFT5|PUR7_ANOFW RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|212559560|gb|ACJ32615.1| Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [Anoxybacillus flavithermus WK1]
          Length = 240

 Score =  248 bits (633), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 97/239 (40%), Positives = 144/239 (60%), Gaps = 3/239 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K +Y   E   L   +KD+    N  + AT+ GKG LNN I+  +F+ 
Sbjct: 1   MEKQYLLYEGKAKKVYATNEKHVLWIEYKDEATAFNGEKKATIVGKGRLNNEITSLLFSL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+ ++FIR+I+  EQLVR V +IPL + VRN  AGSLAKR+ + EG  + + +VEF
Sbjct: 61  LHEAGVSNHFIRKISDTEQLVRQVTIIPLEVVVRNIVAGSLAKRIGLEEGTVMKKPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     L++E+HI     A   E+  M  +++RIND +T LF   ++QLVDF+++ 
Sbjct: 121 YYKNDDLGDPLLTEDHIALLQLATHDELLYMKQMALRINDILTSLFRSCDLQLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
           G+    +   ++LADEI PD CRLWD+  KE+ DK  F +    L E Y+++ +RLG  
Sbjct: 181 GKD---ETGAVLLADEISPDTCRLWDVHTKEKFDKDVFRRDLGDLTETYTKLLQRLGGL 236


>gi|218895398|ref|YP_002443809.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus G9842]
 gi|226723538|sp|B7IUV0|PUR7_BACC2 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|218540605|gb|ACK92999.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus G9842]
          Length = 239

 Score =  248 bits (633), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 88/237 (37%), Positives = 133/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  +  T+ GKG LNN I+  +F +
Sbjct: 1   MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITGKGRLNNEITTLLFRK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+ +++  EQLV+ V +IPL +  RN  AGSL+KRL + EG  L   +VEF
Sbjct: 61  LQEVGIKTHFVEKLSETEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGTVLAEPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D     LV+E+HI   N A+  +V  +  ++++IN  +   F    ++LVDF+++ 
Sbjct: 121 YFKDDDLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVLIDHFASCRVRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     +   I+LADEI PD CRLWD +  E+ DK  F +    L E Y E+ +RLG
Sbjct: 181 GVT---EEGEIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNLTEAYEEILKRLG 234


>gi|269797431|ref|YP_003311331.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Veillonella parvula DSM 2008]
 gi|294794971|ref|ZP_06760106.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Veillonella sp. 3_1_44]
 gi|269094060|gb|ACZ24051.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Veillonella parvula DSM 2008]
 gi|294454333|gb|EFG22707.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Veillonella sp. 3_1_44]
          Length = 242

 Score =  248 bits (633), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 86/235 (36%), Positives = 128/235 (54%), Gaps = 4/235 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
                +YE K K +Y        I  +KDD    N  +  T+ GKGVLNN+IS + F  L
Sbjct: 7   EKLTLLYEGKAKQVYATDNKDEYIVHYKDDATAFNGEKHDTILGKGVLNNKISSFFFELL 66

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            K G+P +F+RR + R Q V  ++++PL + VRN AAGS+AKR  I EG  L   ++EF 
Sbjct: 67  KKEGVPTHFVRREDDRNQTVLTLKIVPLEVIVRNIAAGSMAKRFGIEEGTPLKHPILEFC 126

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D       +E  ITA  WA Q +++ ++ +++++ND +       N+ LVDF+++ G
Sbjct: 127 YKNDELGDPFANESQITALGWATQEQLDVISTITLKVNDILKKFLATKNVTLVDFKVEFG 186

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
                    ++L DEI PD CR WD +  E+ DK RF +    + E Y E+  RL
Sbjct: 187 ----THNGEVLLGDEISPDTCRFWDATTGEKLDKDRFRRDLGNIEEAYKEMLFRL 237


>gi|254303199|ref|ZP_04970557.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Fusobacterium nucleatum subsp. polymorphum ATCC 10953]
 gi|148323391|gb|EDK88641.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Fusobacterium nucleatum subsp. polymorphum ATCC 10953]
          Length = 237

 Score =  248 bits (633), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 86/236 (36%), Positives = 133/236 (56%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +YE  +   +I  +KDD    N  +  T++ KG++NN I+  +F  
Sbjct: 1   MEKGKFIYEGKAKQLYETDDKDLVIVHYKDDATAGNGAKKGTIHNKGIMNNEITALIFNM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +F++++N R+QL + V++ PL + VRN  AGS+AKR+ I EG  +  ++ E 
Sbjct: 61  LEEHGIKTHFVKKLNDRDQLCQRVKIFPLEVIVRNIIAGSMAKRVGIKEGTKINNTIFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A   A   E++E+  ++ +IN+ +   F  I I LVDF+I+ 
Sbjct: 121 CYKNDEYGDPLINDHHAVAMGLATYDELKEIYEITGKINNLLKEKFDNIGITLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+        I+LADEI PD CRLWD    E+ DK RF +    + E Y EV +RL
Sbjct: 181 GKN---SKGEILLADEITPDTCRLWDKETGEKLDKDRFRRDLGNIEEAYIEVVKRL 233


>gi|302608286|emb|CBW44749.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase (SAICAR
           synthetase) [Marinobacter hydrocarbonoclasticus]
          Length = 252

 Score =  248 bits (633), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 83/238 (34%), Positives = 131/238 (55%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K +Y   +P   +  F+DD    +  +   LN KG++NN+ + ++  +
Sbjct: 16  MEKREELYAGKAKSVYRTDDPERFVLVFRDDTSAFDGEKKEQLNRKGMVNNKFNAFIMEK 75

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+P +F   ++  E LV+ +EMIP+   VRN +AGSL +RL + EGL L     E 
Sbjct: 76  LEAAGVPTHFEGLLSDTESLVKKLEMIPVECVVRNVSAGSLCRRLGVEEGLELNPPTFEL 135

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E    +F WA   E+  M  L+ ++ND +  LF    + LVD++++ 
Sbjct: 136 FLKNDALHDPMVNESLAVSFGWAKADELARMKELTYKVNDVLKKLFDDAGMLLVDYKLEF 195

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR       +IVL DE  PD CR+WD   +++ DK RF +   +++E Y EV RRLGI
Sbjct: 196 GR----SGGQIVLGDEFSPDGCRIWDKETRKKMDKDRFRQGLGEVIETYEEVGRRLGI 249


>gi|284051293|ref|ZP_06381503.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Arthrospira platensis str. Paraca]
          Length = 241

 Score =  248 bits (633), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 85/240 (35%), Positives = 132/240 (55%), Gaps = 7/240 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+Y   +P  L+ ++KDD    N  +  T+ GKG +NN +S ++F  
Sbjct: 1   MSDRQQLYEGKAKIVYTTDDPEVLLAYYKDDATAFNAQKRGTITGKGEINNTMSGHLFKL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP +FI   +  E  ++ V++IP+ + VRN AAGSL K+  IP G  L   LVEF
Sbjct: 61  LEAAGIPTHFIDTPSPNEMRIKRVDIIPVEVIVRNIAAGSLCKQTGIPLGTVLQPPLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L++ + + A N A++ +++ +  LS +I+  ++  F    I LVDF+++ 
Sbjct: 121 CYKNDQLGDPLLTRDRLLAMNLASEEQLKSIEDLSRQIDQILSDFFSQCGITLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEE----CDKKRFSKSNDQLLEGYSEVARRL 236
           G   D    +++LADEI PD CRLWD ++ +      DK RF      +   Y +V  R+
Sbjct: 181 GMTSD---GQLILADEISPDTCRLWDQAETDPNLRVMDKDRFRNDLGNVESAYQQVLARV 237


>gi|228919214|ref|ZP_04082584.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
 gi|228840321|gb|EEM85592.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
          Length = 258

 Score =  248 bits (633), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 87/237 (36%), Positives = 134/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  +  T+ GKG LNN I+  +F +
Sbjct: 20  MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITGKGRLNNEITTLLFRK 79

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+ +++  EQLV+ V +IPL +  RN  AGSL+KRL + EG +L   +VEF
Sbjct: 80  LQEVGIKTHFVEKLSETEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGTALAEPIVEF 139

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D     LV+E+HI   N A+  +V  +  ++++IN  +   F    ++LVDF+++ 
Sbjct: 140 YFKDDDLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVLIDHFASCRVRLVDFKLEF 199

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     +   I+LADEI PD CRLWD +  E+ DK  F +    L + Y E+ +RLG
Sbjct: 200 GVT---EEGEIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNLTDAYEEILKRLG 253


>gi|326570580|gb|EGE20618.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Moraxella
           catarrhalis BC1]
          Length = 236

 Score =  248 bits (633), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 85/238 (35%), Positives = 137/238 (57%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +YE      LI  F++D    N  +  +L+ KG++NNR + ++  +
Sbjct: 1   MQKQALLYTGKAKSVYETDHSDYLILHFRNDASAFNGEKMESLDRKGIVNNRFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +F ++++  E LV+ ++MIP+   VRN AAG L KRL + EGL L     E 
Sbjct: 61  LADAGIETHFEKQLSDDEVLVKRLKMIPVEAVVRNYAAGGLMKRLGLSEGLPLLPPTYEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +Y  D+    ++SE    A  +A   E+ +M +L++++N+ ++ LF    + LVDF+++ 
Sbjct: 121 FYKDDALGDPMLSESTAIALGYATADELAQMQSLTLKVNEVLSKLFDDAGLMLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        R+VL DE  PD CRLWD   K++ DK RF +    ++EGY EVARR+G+
Sbjct: 181 GLF----QGRVVLGDEFSPDGCRLWDKQTKKKLDKDRFRQGLGDVVEGYEEVARRIGV 234


>gi|229068034|ref|ZP_04201342.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus F65185]
 gi|228715042|gb|EEL66909.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus F65185]
          Length = 258

 Score =  248 bits (633), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 87/237 (36%), Positives = 133/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  +  T+ GKG LNN I+  +F +
Sbjct: 20  MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITGKGRLNNEITTLLFRK 79

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+ +++  EQLV+ V +IPL +  RN  AGSL+KRL + EG  L   +VEF
Sbjct: 80  LQEVGIKTHFVEKLSETEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGTVLAEPIVEF 139

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D     LV+E+HI   N A+  +V  +  ++++IN  +   F    ++LVDF+++ 
Sbjct: 140 YFKDDDLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVVIDHFASCRVRLVDFKLEF 199

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     +   I+LADEI PD CRLWD +  E+ DK  F +    L + Y E+ +RLG
Sbjct: 200 GVT---EEGEIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNLTDAYEEILKRLG 253


>gi|239825827|ref|YP_002948451.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Geobacillus sp. WCH70]
 gi|239806120|gb|ACS23185.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Geobacillus sp. WCH70]
          Length = 242

 Score =  248 bits (633), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 91/236 (38%), Positives = 138/236 (58%), Gaps = 3/236 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
           +    +YE K K +Y   +   L   +KD     N  + AT+ GKG LNN I+  +F++L
Sbjct: 3   KKLALLYEGKAKKVYTTDDANVLWVEYKDSATAFNGEKKATIAGKGRLNNEITSVLFSKL 62

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            + GIP++FI++++  EQLV+ V +IPL + VRN  AGSLAKRL IPEG  L + L+EFY
Sbjct: 63  CEAGIPNHFIQKLSATEQLVKKVTIIPLEVVVRNVVAGSLAKRLGIPEGTRLEKPLIEFY 122

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     L+ E+HI     A   ++  +  L++++ND +T  F    ++L+DF+++ G
Sbjct: 123 YKNDDLGDPLLLEDHIAILKLATSEQIAVLKELALKVNDVLTKHFADCRVRLIDFKLEFG 182

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
              +     I+LADEI PD CRLWD+   E+ DK  F +    L + Y  + +RLG
Sbjct: 183 VDAE---GAILLADEISPDTCRLWDMETNEKLDKDVFRRDLGSLTDAYETILQRLG 235


>gi|229021863|ref|ZP_04178434.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus AH1272]
 gi|229171124|ref|ZP_04298718.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus MM3]
 gi|228612302|gb|EEK69530.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus MM3]
 gi|228739433|gb|EEL89858.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus AH1272]
          Length = 239

 Score =  248 bits (633), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 89/237 (37%), Positives = 133/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  +  T+ GKG LNN I+  +F +
Sbjct: 1   MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITGKGRLNNEITTLLFRK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+ +++  EQLV+ V +IPL +  RN  AGSL+KRL + EG  L   +VEF
Sbjct: 61  LQEVGIKTHFVEKLSETEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGTVLAEPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D     LV+E+HI   N A+  +V  +  ++++IN  +   F    ++LVDF+++ 
Sbjct: 121 YFKDDDLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVLIDHFASCRVRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     D   I+LADEI PD CRLWD +  E+ DK  F +    L E Y E+ +RLG
Sbjct: 181 GVT---DEGEIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNLTEAYEEILKRLG 234


>gi|167631124|ref|YP_001681623.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Heliobacterium modesticaldum Ice1]
 gi|167593864|gb|ABZ85612.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Heliobacterium modesticaldum Ice1]
          Length = 241

 Score =  248 bits (633), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 87/236 (36%), Positives = 131/236 (55%), Gaps = 4/236 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
                +YE K K ++    P      +KD     N  + A +  KGVLNNRIS   F  L
Sbjct: 5   NKLEQIYEGKAKKVFRTENPDIYWIEYKDSATAFNGEKKAEIENKGVLNNRISALFFQYL 64

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            K G+P +F+  IN RE LV+ +++IP+ +  RN  AGSLAKR+  PEG  L + ++EFY
Sbjct: 65  AKQGVPSHFVELINDREMLVKSLQIIPVEVVARNIVAGSLAKRVGQPEGTPLAKPVLEFY 124

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D+    +++E HI A  WA   +++ + A+++++N+ +     G+NI LVDF+++ G
Sbjct: 125 YKDDALGDPMINEYHIAAMEWATPEQMDVIKAIALKVNEILKEFLAGLNIDLVDFKLEFG 184

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
                    ++L DEI PD CR WD   +E+ DK RF +    L E Y E+  RL 
Sbjct: 185 L----HNGEVLLGDEISPDTCRFWDSRTREKLDKDRFRRDMGGLEEAYREILNRLE 236


>gi|56962801|ref|YP_174527.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           clausii KSM-K16]
 gi|81822196|sp|Q5WJ89|PUR7_BACSK RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|56909039|dbj|BAD63566.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           clausii KSM-K16]
          Length = 239

 Score =  248 bits (632), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 103/239 (43%), Positives = 141/239 (58%), Gaps = 3/239 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K I+   E G L   +KDD    N  +  TL GK  LNN IS  +F  
Sbjct: 1   MVKGELLYEGKAKRIFRSSEEGELWVEYKDDATAFNGEKKETLAGKARLNNDISSLIFAT 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GIP +FIRR++  EQLV+ V++IPL + VRN  AGS+AKRL I EG++L + LVEF
Sbjct: 61  LAKKGIPSHFIRRLSDTEQLVKQVDIIPLEVVVRNVVAGSMAKRLGIEEGIALKKPLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    LV+E+HI   + A   EV ++  ++  +N+ +  LF  + +QL+DF+++ 
Sbjct: 121 YYKDDALGDPLVTEDHIAILDVAAAEEVAQLKQMAAAVNNELIELFATVGVQLIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
           GR        ++LADEI PD CRLWD   KE  DK  F ++   L EGY E+  RLG  
Sbjct: 181 GRT---QAGELLLADEISPDTCRLWDKDTKERFDKDLFRRNLGNLQEGYQEILSRLGGL 236


>gi|228906054|ref|ZP_04069943.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis IBL 200]
 gi|228950832|ref|ZP_04112956.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
 gi|229176870|ref|ZP_04304266.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus 172560W]
 gi|228606543|gb|EEK63968.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus 172560W]
 gi|228808842|gb|EEM55337.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
 gi|228853463|gb|EEM98231.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis IBL 200]
          Length = 258

 Score =  248 bits (632), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 87/237 (36%), Positives = 133/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  +  T+ GKG LNN I+  +F +
Sbjct: 20  MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITGKGRLNNEITTLLFRK 79

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+ +++  EQLV+ V +IPL +  RN  AGSL+KRL + EG  L   +VEF
Sbjct: 80  LQEVGIKTHFVEKLSETEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGTVLAEPIVEF 139

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D     LV+E+HI   N A+  +V  +  ++++IN  +   F    ++LVDF+++ 
Sbjct: 140 YFKDDDLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVLIDHFASCRVRLVDFKLEF 199

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     +   I+LADEI PD CRLWD +  E+ DK  F +    L + Y E+ +RLG
Sbjct: 200 GVT---EEGEIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNLTDAYEEILKRLG 253


>gi|323144768|ref|ZP_08079344.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Succinatimonas hippei YIT 12066]
 gi|322415465|gb|EFY06223.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Succinatimonas hippei YIT 12066]
          Length = 236

 Score =  248 bits (632), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 81/237 (34%), Positives = 132/237 (55%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +Y  K K +YE  +P   I  F+DD    N  +   L+ KG  NN  + ++  +
Sbjct: 1   MEKKRELYRGKAKSVYETDDPNHYIMLFRDDTSAFNGKKIEQLDRKGRTNNHFNFFIMKK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP +    ++  E LV+ +EM+P+   VRN +AGS+ KR  + EGL L     EF
Sbjct: 61  LEEAGIPVHVEELLSDTECLVKKLEMVPVECVVRNVSAGSICKRYGVKEGLDLNPPTFEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+ +  +V++ HI +F W  Q +++ M  LS +IN+ +  LF    + LVD++++ 
Sbjct: 121 FLKSDALDDPMVNDSHIVSFGWGTQEDIDTMRNLSYKINEVLKDLFDKAGLILVDYKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G+       +++L DE  PD CRLWD   +++ DK RF +    ++E Y EVARR+G
Sbjct: 181 GKY----NGQLILGDEFSPDGCRLWDKETRKKLDKDRFRQGLGGVIEAYEEVARRIG 233


>gi|257469767|ref|ZP_05633859.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fusobacterium ulcerans ATCC 49185]
 gi|317063998|ref|ZP_07928483.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fusobacterium ulcerans ATCC 49185]
 gi|313689674|gb|EFS26509.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fusobacterium ulcerans ATCC 49185]
          Length = 238

 Score =  248 bits (632), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 82/236 (34%), Positives = 128/236 (54%), Gaps = 3/236 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
           + +  +YE K K +Y   +   ++  +KDD    N  +  T+  KG++NN+I+  +F  L
Sbjct: 4   QKKEFIYEGKAKQVYSTDDENLVVIHYKDDATAGNGAKKGTIENKGIMNNKITAMLFEML 63

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            K GI  + +  +N R+QL + V++ PL + VRN  AGS+AKR+ + EG     ++ E  
Sbjct: 64  EKNGIKTHLVEVLNDRDQLCQKVKIFPLEVIVRNVIAGSMAKRVGVEEGTKPVNTIFEIC 123

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D+    L+++ H  A   A   E+ E+  ++  IN+ +   F  I I LVDF+I+ G
Sbjct: 124 YKNDAYGDPLINDHHAVALGLATYEELAEIYRITGEINNLLKTSFDKIGITLVDFKIEFG 183

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           +        I+LADEI PD CRLWD     + DK RF +    + E Y EV +RLG
Sbjct: 184 KN---SKGEILLADEITPDTCRLWDKETGMKLDKDRFRRDLGGIEEAYIEVLKRLG 236


>gi|157165429|ref|YP_001466743.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Campylobacter concisus 13826]
 gi|166229532|sp|A7ZD85|PUR7_CAMC1 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|112800160|gb|EAT97504.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Campylobacter concisus 13826]
          Length = 236

 Score =  248 bits (632), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 91/237 (38%), Positives = 129/237 (54%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ R  +YE K K +Y   +P  L+  FKDD    +  +     GKG LNN+IS  +F  
Sbjct: 1   MQKRELIYEGKGKKMYATDDPNLLVAEFKDDLTAFDAQKRGNEAGKGALNNKISTQLFKL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI    +  I+  EQ+V+  E+IPL + VRN A GSL+KRL I EG  LP +LVEF
Sbjct: 61  LESKGIVTDLVETISDTEQVVKKCEIIPLEVVVRNIATGSLSKRLGIKEGTVLPFTLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWA-NQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIK 179
           YY  D     LV++EH        ++ +++ +   +  IN  +   F   N++LVDF+++
Sbjct: 121 YYKNDDLHDPLVTDEHCIIMGLVKSEKDLQTLRHTAREINSILFKFFAERNLKLVDFKVE 180

Query: 180 CGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
            G   D     I+LADEI PD CR WD +  E+ DK RF +    +   Y EV RR+
Sbjct: 181 FGIDKD---GNIILADEISPDSCRFWDATTNEKLDKDRFRQDLGSVKVAYEEVLRRI 234


>gi|237736991|ref|ZP_04567472.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fusobacterium mortiferum ATCC 9817]
 gi|229420853|gb|EEO35900.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fusobacterium mortiferum ATCC 9817]
          Length = 237

 Score =  248 bits (632), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 84/236 (35%), Positives = 129/236 (54%), Gaps = 3/236 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             ++ +YE K K +Y   +   +I  +KDD    N  +  T+  KGV+NN+I+  +F  L
Sbjct: 4   EKKDFIYEGKAKQVYSTTDENLVIIHYKDDATAGNGAKKGTIVNKGVMNNKITAMLFRML 63

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            K GI  + +  +N R+QL + V++ PL + VRN  AGS+A R+ IPEG     ++ E  
Sbjct: 64  EKNGIKTHLVDVLNDRDQLCQKVKIFPLEVIVRNVIAGSMAARVGIPEGTKPTNTIFEIC 123

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D+    L+++ H  A       E+ E+  ++ +IN+ +   F  I I LVDF+I+ G
Sbjct: 124 YKNDAYGDPLINDHHAVALGLCTYEELAEIYRITGQINNLLKDAFDKIGITLVDFKIEFG 183

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           +        I+LADEI PD CRLWD    ++ DK RF +    + E Y EV +RLG
Sbjct: 184 KN---AAGEILLADEITPDTCRLWDKETGKKLDKDRFRRDLGGIEEAYIEVLKRLG 236


>gi|161760535|ref|NP_622255.2| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacter tengcongensis MB4]
 gi|22001844|sp|Q8RC58|PUR7_THETN RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
          Length = 235

 Score =  248 bits (632), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 84/236 (35%), Positives = 135/236 (57%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K +Y+  +    I  +KDD    N  +   +  KGV+NN++S  +F  
Sbjct: 1   MEKKELLYEGKAKKVYKTDKEDYYIIEYKDDATAFNGLKKGVIEEKGVVNNKVSSILFEF 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GIP ++++ +  RE LV+ V + PL + +RN AAGS+ KRL + EG+     ++EF
Sbjct: 61  LEKRGIPTHYVKMLKDREMLVKKVTIFPLEVIIRNYAAGSICKRLGLQEGIKFKEPVLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     +++E HI A   A + E++ +   + ++N+ ++  FL  +I LVDF+++ 
Sbjct: 121 CYKNDELGDPMINEYHIRALELATRDEIDLIKERAFKVNEILSEYFLSKDIILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+  +     I+LADEI PD CR WD +  E+ DK RF K   Q+ E Y E+ RR+
Sbjct: 181 GKNQEG----ILLADEISPDTCRFWDKNTMEKLDKDRFRKDLGQVEEAYLEILRRV 232


>gi|291565773|dbj|BAI88045.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Arthrospira platensis NIES-39]
          Length = 244

 Score =  248 bits (632), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 84/240 (35%), Positives = 132/240 (55%), Gaps = 7/240 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K KI+Y   +P  L+ ++KDD    N  +  T+ GKG +NN +S ++F  
Sbjct: 4   MSDRQQLYEGKAKIVYTTDDPEVLLAYYKDDATAFNAQKRGTITGKGEINNTMSGHLFKL 63

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+P +FI   +  E  ++ V++IP+ + VRN AAGSL K+  IP G  L   LVEF
Sbjct: 64  LEAAGVPTHFIDTPSPNEMRIKRVDIIPVEVIVRNIAAGSLCKQTGIPLGTVLQPPLVEF 123

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L++ + + A N A++ +++ +  LS +I+  ++  F    I LVDF+++ 
Sbjct: 124 CYKNDQLGDPLLTRDRLLAMNLASEEQLKSIEDLSRQIDQILSDFFSQCGITLVDFKLEF 183

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEE----CDKKRFSKSNDQLLEGYSEVARRL 236
           G   D    +++LADEI PD CRLWD ++ +      DK RF      +   Y +V  R+
Sbjct: 184 GMTSD---GQLILADEISPDTCRLWDQAETDPNLRVMDKDRFRNDLGNVESAYQQVLARV 240


>gi|228937570|ref|ZP_04100208.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|228970457|ref|ZP_04131108.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228789189|gb|EEM37117.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228822051|gb|EEM68041.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar berliner ATCC 10792]
          Length = 258

 Score =  248 bits (632), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 87/237 (36%), Positives = 134/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  +  T+ GKG LNN I+  +F +
Sbjct: 20  MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITGKGRLNNEITTLLFRK 79

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+ +++  EQLV+ V +IPL +  RN  AGSL+KRL + EG  L   +VEF
Sbjct: 80  LQEVGIKTHFVEKLSETEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGTVLAEPIVEF 139

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D+    LV+E+HI   N A+  +V  +  ++++IN  +   F    ++LVDF+++ 
Sbjct: 140 YFKDDNLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVLIDHFASCRVRLVDFKLEF 199

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     +   I+LADEI PD CRLWD +  E+ DK  F +    L + Y E+ +RLG
Sbjct: 200 GVT---EEGEIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNLTDAYEEILKRLG 253


>gi|257467241|ref|ZP_05631552.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fusobacterium gonidiaformans ATCC 25563]
 gi|315918369|ref|ZP_07914609.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fusobacterium gonidiaformans ATCC 25563]
 gi|313692244|gb|EFS29079.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fusobacterium gonidiaformans ATCC 25563]
          Length = 238

 Score =  248 bits (632), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 86/236 (36%), Positives = 133/236 (56%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +Y   +   +I  +KDD    N  +  +++ KG++NN I+  +F  
Sbjct: 1   MERREFLYEGKAKQLYATDDKDLVIVHYKDDATAGNGAKKGSIHNKGIMNNEITTLIFNM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +F++++N R+QL + V++ PL + VRN  AGS+AKR+ I EG     ++ E 
Sbjct: 61  LEEHGIKTHFVKKLNERDQLCQKVQIFPLEVIVRNLIAGSMAKRVGIAEGTKPSNTIFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A   A   E++E+ +++ +IND +   F  I I LVDF+I+ 
Sbjct: 121 CYKNDEYGDPLINDHHAVALKLATYEELKEIYSITAKINDLLREKFDKIGITLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+        I+LADEI PD CRLWD    E+ DK RF +    + E Y EV +RL
Sbjct: 181 GKN---AKGEILLADEITPDTCRLWDKVTGEKLDKDRFRRDLGNIEEAYIEVVKRL 233


>gi|118476042|ref|YP_893193.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis str. Al Hakam]
 gi|118415267|gb|ABK83686.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis str. Al Hakam]
          Length = 258

 Score =  248 bits (632), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 88/237 (37%), Positives = 133/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  +  T+ GKG LNN I+  +F +
Sbjct: 20  MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITGKGRLNNEITTLLFRK 79

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+ +++  EQLV+ V +IPL +  RN  AGSL+KRL + EG  L   +VEF
Sbjct: 80  LQEVGIKTHFVEKLSETEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGTVLAEPIVEF 139

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D     LV+E+HI   N A+  +V  +  ++++IN  +   F    ++LVDF+++ 
Sbjct: 140 YFKDDDLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVLIDHFASCRVRLVDFKLEF 199

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     D   I+LADEI PD CRLWD +  E+ DK  F +    L + Y E+ +RLG
Sbjct: 200 GVT---DEGEIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNLTDAYEEILKRLG 253


>gi|294782401|ref|ZP_06747727.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Fusobacterium sp. 1_1_41FAA]
 gi|294481042|gb|EFG28817.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Fusobacterium sp. 1_1_41FAA]
          Length = 237

 Score =  248 bits (632), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 87/236 (36%), Positives = 132/236 (55%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +YE  +   +I  +KDD    N  +  T++ KGV+NN I+  +F  
Sbjct: 1   MEKGKFIYEGKAKQLYETDDKDLVIVHYKDDATAGNGAKKGTIHNKGVMNNEITTLIFNM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +F++++N R+QL + V + PL + VRN  AGS+AKR+ I EG  +  ++ E 
Sbjct: 61  LEEHGIKTHFVKKLNDRDQLCQRVTIFPLEVIVRNIIAGSMAKRVGIKEGTKINNTIFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A   A   E++E+  ++ +IN+ +   F  I I LVDF+I+ 
Sbjct: 121 CYKNDDYGDPLINDHHAVAMGLATYDELKEIYDITGKINNLLKEKFDKIGITLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+        I+LADEI PD CRLWD    E+ DK RF +    + E Y EV +RL
Sbjct: 181 GKN---SKGEILLADEITPDTCRLWDKETGEKLDKDRFRRDLGNIEEAYIEVVKRL 233


>gi|254427526|ref|ZP_05041233.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Alcanivorax sp. DG881]
 gi|196193695|gb|EDX88654.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Alcanivorax sp. DG881]
          Length = 238

 Score =  248 bits (632), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 83/241 (34%), Positives = 133/241 (55%), Gaps = 4/241 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R+ +Y  K K +Y   +   LI  F+DD    +  +   L  KG +NN+ +  +  +
Sbjct: 1   MEKRDELYAGKAKSVYTTDDADKLIMLFRDDTSAFDGKKKEALARKGAVNNQFNAAIMEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP +F + ++  E LV+ ++MIP+   VRN AAGS+ +RL + EGL L     EF
Sbjct: 61  LKAAGIPCHFEKTLSATESLVKKMDMIPVECVVRNIAAGSICRRLGVEEGLELNPPTFEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D     +V++ HI +F WA   +V +M  L+ ++ND +  LFL   + LVD++++ 
Sbjct: 121 FLKDDDLGDPMVNDFHIQSFGWATDEQVAQMKVLTFQVNDVLKQLFLDGEMLLVDYKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           G         ++L DE  PD CRLWD + +E+ DK RF +    ++E Y EV +RLG+  
Sbjct: 181 GVF----NGEVLLGDEFSPDGCRLWDKNTREKLDKDRFRQGLGGVVEAYEEVGKRLGMTF 236

Query: 241 K 241
           +
Sbjct: 237 E 237


>gi|295099637|emb|CBK88726.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Eubacterium cylindroides T2-87]
          Length = 237

 Score =  248 bits (632), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 89/237 (37%), Positives = 134/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+  + +YE K K +Y   +P  +I  +KDD    N  +  T+ GKG +NNR++ ++  +
Sbjct: 1   MKQLDMIYEGKAKKVYATDDPNAVIVDYKDDATAFNGQKKGTIVGKGAINNRMTNFLMKK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+P ++I  ++ R  +V+ V +IPL + +RN AAGS +KRL I EG  L  S +EF
Sbjct: 61  LEEKGVPTHYIEELDERRTVVKRVTIIPLEVIIRNKAAGSFSKRLGIKEGTELKCSTLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L++     A   A Q +++ +T  +  INDF+   F GI I+L+DF+++ 
Sbjct: 121 SYKDDDLGDPLINSYMAKAIGAATQEDIDTITKYAFEINDFLKEFFAGIGIELIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G+  D     IVLADEI PD CR WD+   E  DK RF +        Y EV +RLG
Sbjct: 181 GKTAD---GTIVLADEISPDTCRYWDIKTGEHLDKDRFRRDLGDPEGAYKEVFKRLG 234


>gi|325272108|ref|ZP_08138543.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas sp. TJI-51]
 gi|324102751|gb|EGC00163.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas sp. TJI-51]
          Length = 236

 Score =  248 bits (632), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 84/238 (35%), Positives = 135/238 (56%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R+ +Y  K K +Y+  +   LI  F++D    +  R   L+ KG++NN+ + ++  +
Sbjct: 1   MEKRDELYRGKAKSVYKTDDADRLILLFRNDTSAFDGKRIEQLDRKGMVNNKFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+P  F + +   E LV+ ++MIP+   VRN AAGSL KRL + EG+ L  S  E 
Sbjct: 61  LEEAGVPTQFDKLLGDNECLVKKLDMIPVECVVRNYAAGSLVKRLGVEEGIKLEPSTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D      ++E H+ AF W    ++ EM  LS+++N+ ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDEKGDPFINESHVVAFGWGTAEQLAEMKKLSLKVNEVLSKLFDDAGLLLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        +IVL DE  PD CRLWD   +++ DK RF +    ++E Y EVA+RLG+
Sbjct: 181 GVFH----GQIVLGDEFSPDGCRLWDKETRKKMDKDRFRQGLGDVIEAYEEVAKRLGV 234


>gi|229042179|ref|ZP_04189933.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus AH676]
 gi|29894074|gb|AAP07366.1| Phosphoribosylamidoimidazole-succinocarboxamide synthase [Bacillus
           cereus ATCC 14579]
 gi|228727114|gb|EEL78317.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus AH676]
          Length = 258

 Score =  247 bits (631), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 87/237 (36%), Positives = 133/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  +  T+ GKG LNN I+  +F +
Sbjct: 20  MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITGKGRLNNEITTLLFRK 79

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+ +++  EQLV+ V +IPL +  RN  AGSL+KRL + EG  L   +VEF
Sbjct: 80  LQEVGIKTHFVEKLSETEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGTVLAEPIVEF 139

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D     LV+E+HI   N A+  +V  +  ++++IN  +   F    ++LVDF+++ 
Sbjct: 140 YFKDDDLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVLIDHFASCRVRLVDFKLEF 199

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     +   I+LADEI PD CRLWD +  E+ DK  F +    L + Y E+ +RLG
Sbjct: 200 GVT---EEGEIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNLTDAYEEILKRLG 253


>gi|292670984|ref|ZP_06604410.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Selenomonas noxia ATCC 43541]
 gi|292647605|gb|EFF65577.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Selenomonas noxia ATCC 43541]
          Length = 243

 Score =  247 bits (631), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 85/236 (36%), Positives = 135/236 (57%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K KIIY    P   + ++KDD    N  +  T+  KGV+NN+++ + F  
Sbjct: 7   MERKEALYEGKAKIIYATENPDEYLVYYKDDATAGNGAKRGTIADKGVMNNKMTAFFFDL 66

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI H++I   N RE +V+ + +IPL + +RN AAGSLA+RL + EG+ +P  ++E+
Sbjct: 67  LAKEGIRHHYISMPNDREMIVKKLTIIPLEVIIRNVAAGSLAQRLGLEEGVPMPFPIIEY 126

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     +++  HI A   A   +++E+  +S++IND +T       + L+DF+++ 
Sbjct: 127 CYKNDDLGDPMLNRYHIRAMKIATDEDLDEIERMSLKINDILTKFLKTKRVDLIDFKLEF 186

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+        I+LADEI PD CR WD   KE+ DK RF +    + + Y E+  RL
Sbjct: 187 GKD---ASGNIILADEISPDNCRFWDSDTKEKLDKDRFRRDLGNVEDAYKEMLHRL 239


>gi|104783043|ref|YP_609541.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas entomophila L48]
 gi|122402302|sp|Q1I6H8|PUR7_PSEE4 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|95112030|emb|CAK16757.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas entomophila L48]
          Length = 236

 Score =  247 bits (631), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 84/238 (35%), Positives = 135/238 (56%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R+ +Y  K K +Y+  +   LI  F++D    +  R   L+ KG++NN+ + ++  +
Sbjct: 1   MEKRDELYRGKAKSVYKTDDADRLILLFRNDTSAFDGKRIEQLDRKGMVNNKFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+P  F + +   E LV+ ++MIP+   VRN AAGSL KRL + EG+ L  S  E 
Sbjct: 61  LEEAGVPTQFDKLLGDNECLVKKLDMIPVECVVRNYAAGSLVKRLGVEEGIKLEPSTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D      ++E H+ AF W    ++ EM  LS+++N+ ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDEKGDPFINESHVVAFGWGTAEQLVEMKKLSLKVNEVLSKLFDDAGLLLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        +IVL DE  PD CRLWD   +++ DK RF +    ++E Y EVA+RLG+
Sbjct: 181 GVFH----GQIVLGDEFSPDGCRLWDKETRKKMDKDRFRQGLGDVIEAYEEVAKRLGV 234


>gi|296327320|ref|ZP_06869872.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Fusobacterium nucleatum subsp. nucleatum ATCC 23726]
 gi|296155570|gb|EFG96335.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Fusobacterium nucleatum subsp. nucleatum ATCC 23726]
          Length = 237

 Score =  247 bits (631), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 86/236 (36%), Positives = 133/236 (56%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +YE  +   +I  +KDD    N  +  T++ KG++NN I+  +F  
Sbjct: 1   MEKGKFIYEGKAKQLYETDDKDLVIVHYKDDATAGNGAKKGTIHNKGIMNNEITALIFNM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +F++++N R+QL + V++ PL + VRN  AGS+AKR+ I EG  +  ++ E 
Sbjct: 61  LEEHGIKTHFVKKLNDRDQLCQRVKIFPLEVIVRNIIAGSMAKRVGIKEGTKINNTIFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A   A   E++E+  ++ +IN+ +   F  I I LVDF+I+ 
Sbjct: 121 CYKNDEYGDPLINDHHAVAMGLATYDELKEIYDITGKINNLLKEKFDNIGITLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+        I+LADEI PD CRLWD    E+ DK RF +    + E Y EV +RL
Sbjct: 181 GKN---SKGEILLADEITPDTCRLWDKKTGEKLDKDRFRRDLGNIEEAYIEVVKRL 233


>gi|219667527|ref|YP_002457962.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfitobacterium hafniense DCB-2]
 gi|254783959|sp|B8FP01|PUR7_DESHD RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|219537787|gb|ACL19526.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfitobacterium hafniense DCB-2]
          Length = 238

 Score =  247 bits (631), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 99/241 (41%), Positives = 139/241 (57%), Gaps = 4/241 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +Y   + G     +KDD    N  +  T+  KG++NNR+S  +F  
Sbjct: 1   MEKGQMLYEGKAKKVYTTDQEGIYWVEYKDDATAFNGEKKGTIGDKGIVNNRLSALLFEV 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GIP +FI  +N RE LVR +EMIPL + VRN AAGSLAKRL + EGL+L R +VE 
Sbjct: 61  LEKTGIPTHFIELLNDREMLVRKLEMIPLEVVVRNIAAGSLAKRLGVAEGLNLSRPVVEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+     V+E H  A  WA QS+++E+  L ++IN  +  +     I LVDF+++ 
Sbjct: 121 YYKDDALGDPFVNESHSLAMGWAEQSDLKEIQELGLKINGELQKILDQAGIILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           G+       ++ L DEI PD CR WD   +E+ DK RF +   ++ E Y+EV RR+    
Sbjct: 181 GK----AEGKVYLGDEISPDTCRFWDKETQEKLDKDRFRRDLGKVEEAYAEVYRRVKEVL 236

Query: 241 K 241
           K
Sbjct: 237 K 237


>gi|238020037|ref|ZP_04600463.1| hypothetical protein VEIDISOL_01914 [Veillonella dispar ATCC 17748]
 gi|237863561|gb|EEP64851.1| hypothetical protein VEIDISOL_01914 [Veillonella dispar ATCC 17748]
          Length = 242

 Score =  247 bits (631), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 87/235 (37%), Positives = 129/235 (54%), Gaps = 4/235 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
                +YE K K +Y+       I  +KDD    N  +  T+ GKGVLNN+IS + F  L
Sbjct: 7   EKLTLLYEGKAKQVYQTDNKDEYIVHYKDDATAFNGEKHDTILGKGVLNNKISSFFFELL 66

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            K G+P +F+RR + R Q V  +++IPL + VRN AAGS+AKR  I EG  L   ++EF 
Sbjct: 67  KKEGVPTHFVRREDDRNQTVLTLDIIPLEVIVRNIAAGSMAKRFGIEEGTPLKHPILEFC 126

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D       +E  ITA  WA Q +++ ++ +++++ND +       N+ LVDF+++ G
Sbjct: 127 YKNDELGDPFANESQITALGWATQEQLDVISTITLKVNDILKKFLATKNVTLVDFKLEFG 186

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
                    ++L DEI PD CR WD +  E+ DK RF +    + E Y E+  RL
Sbjct: 187 ----THNGEVLLGDEISPDTCRFWDATTGEKLDKDRFRRDLGNIEEAYKEMLFRL 237


>gi|254797185|ref|YP_003082025.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Neorickettsia risticii str. Illinois]
 gi|254590422|gb|ACT69784.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Neorickettsia risticii str. Illinois]
          Length = 240

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 107/244 (43%), Positives = 149/244 (61%), Gaps = 5/244 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLE-PGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFT 59
           MR R  +YE K KI++   + P  + Q FKDD    NN + + + GKGV+NN IS +   
Sbjct: 1   MRERRKIYEGKAKILFSFPDNPNLVTQHFKDDVTAYNNQKHSVIPGKGVINNYISAFFMQ 60

Query: 60  QLGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVE 119
            L  +GI  +F++ +NMREQLV+  E+IP+ + VRN  AG LAKRL + EG++L   L+E
Sbjct: 61  NLQNVGIKTHFVKVLNMREQLVKKAELIPIEVVVRNIVAGGLAKRLGLEEGMTLDAPLIE 120

Query: 120 FYYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIK 179
            YY  DS    +V+++HI +FNW  QSE+EEM  ++ RINDF++G      I LVD +++
Sbjct: 121 TYYKSDSLGDPMVTDDHILSFNWLRQSEIEEMKVMAWRINDFLSGSLSSAGITLVDLKLE 180

Query: 180 CGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
            G        +I+L DEI PD CR WD   KE+ DK RF K    + + Y EVARRLGI 
Sbjct: 181 FGFY----DEQIILIDEISPDTCRFWDTGTKEKMDKDRFRKDLGGVSKYYREVARRLGIL 236

Query: 240 KKNE 243
             + 
Sbjct: 237 NGSF 240


>gi|229028129|ref|ZP_04184272.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus AH1271]
 gi|228733180|gb|EEL84019.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus AH1271]
          Length = 239

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 88/237 (37%), Positives = 133/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  +  T+ GKG LNN I+  +F +
Sbjct: 1   MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITGKGRLNNEITTLLFRK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+ +++  EQLV+ V +IPL +  RN  AGSL+KRL + EG  L   +VEF
Sbjct: 61  LQEVGIKTHFVEKLSEIEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGTVLAEPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D     +V+E+HI   N A+  +V  +  ++++IN  +   F    ++LVDF+++ 
Sbjct: 121 YFKDDDLGDPIVTEDHIRVLNVASPEQVSVLREMALQINQVLIDHFASCRVRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     D   I+LADEI PD CRLWD +  E+ DK  F +    L E Y E+ +RLG
Sbjct: 181 GVT---DEGEIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNLTEAYEEILKRLG 234


>gi|120554609|ref|YP_958960.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Marinobacter aquaeolei VT8]
 gi|166229553|sp|A1U1A4|PUR7_MARAV RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|120324458|gb|ABM18773.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Marinobacter aquaeolei VT8]
          Length = 237

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 83/238 (34%), Positives = 131/238 (55%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K +Y   +P   +  F+DD    +  +   LN KG++NN+ + ++  +
Sbjct: 1   MEKREELYAGKAKSVYRTDDPERFVLVFRDDTSAFDGEKKEQLNRKGMVNNKFNAFIMEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+P +F   ++  E LV+ +EMIP+   VRN +AGSL +RL + EGL L     E 
Sbjct: 61  LEAAGVPTHFEGLLSDTESLVKKLEMIPVECVVRNVSAGSLCRRLGVEEGLELNPPTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E    +F WA   E+  M  L+ ++ND +  LF    + LVD++++ 
Sbjct: 121 FLKNDALHDPMVNESLAVSFGWAKADELARMKELTYKVNDVLKKLFDDAGMLLVDYKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR       +IVL DE  PD CR+WD   +++ DK RF +   +++E Y EV RRLGI
Sbjct: 181 GR----SGGQIVLGDEFSPDGCRIWDKETRKKMDKDRFRQGLGEVIETYEEVGRRLGI 234


>gi|237741926|ref|ZP_04572407.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Fusobacterium sp. 4_1_13]
 gi|229429574|gb|EEO39786.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Fusobacterium sp. 4_1_13]
          Length = 237

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 86/236 (36%), Positives = 132/236 (55%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +YE  +   +I  +KDD    N  +   ++ KG++NN I+  +F  
Sbjct: 1   MEKGKFIYEGKAKQLYETDDKDLVIVHYKDDATAGNGAKKGIIHNKGIMNNEITTLIFNM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI  +F++++N R+QL + V++ PL + VRN  AGS+AKRL I EG  +  ++ E 
Sbjct: 61  LEKNGIKTHFVKKLNDRDQLCQRVKIFPLEVIVRNIIAGSMAKRLGIKEGTKINNTIFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A   A   E++++  ++ +IN+ +   F  I I LVDF+I+ 
Sbjct: 121 CYKNDEYGDPLINDHHAVALGIATYDELKKIYEITAKINNLLKEKFDKIGITLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+        I+LADEI PD CRLWD    E+ DK RF +    + E Y EV +RL
Sbjct: 181 GKN---SKGEILLADEITPDTCRLWDKKTGEKLDKDRFRRDLGNIEEAYIEVVKRL 233


>gi|291544798|emb|CBL17907.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Ruminococcus sp. 18P13]
          Length = 237

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 86/235 (36%), Positives = 134/235 (57%), Gaps = 4/235 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
           +    +YE K K +Y   +P  +I  +KDD    N  +  T+ GKG +NN+++ YM   L
Sbjct: 4   QKTEQLYEGKAKKVYATNDPDLVIVDYKDDATAFNGEKKGTIVGKGAINNKMTNYMLKLL 63

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            K G+P + +  I+ RE +V+ VE++PL + VRN AAGS +K+L I EG  L +  +EF 
Sbjct: 64  EKEGVPTHLVEEISDRETIVKKVEIVPLEVIVRNVAAGSFSKKLGIAEGTPLKQPTLEFS 123

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D      +++ +      A + E+E++T  + ++N+FM G F  I I L+DF+I+ G
Sbjct: 124 YKCDELGDPFINKYYALGLGLATEQEIEDITKYAFKVNEFMKGFFKNIGIDLIDFKIEFG 183

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           R       +I+LADEI PD CR WD    E+ DK RF +    + E Y E+ +R+
Sbjct: 184 RFH----GQILLADEISPDTCRFWDSKTHEKLDKDRFRRDMGGVEEAYQEMIKRV 234


>gi|169334740|ref|ZP_02861933.1| hypothetical protein ANASTE_01146 [Anaerofustis stercorihominis DSM
           17244]
 gi|169257478|gb|EDS71444.1| hypothetical protein ANASTE_01146 [Anaerofustis stercorihominis DSM
           17244]
          Length = 234

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 82/236 (34%), Positives = 136/236 (57%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +++  +    I  +KDD    N  +  T++ KGV+NN+++  +F  
Sbjct: 1   MEKLEMLYEGKAKKVFKTDKKDEYIIEYKDDATAFNGKKKDTISNKGVVNNKMTSIIFGM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+P +FI+ ++   QLV+ VE++P+ + +RN AAGS+ K L + EG+ L  ++ EF
Sbjct: 61  LEEKGVPTHFIKMLDDTHQLVKAVEIVPVEVIIRNVAAGSICKNLGLEEGMELDPTVFEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D  +  L+++ H+ A   A + E+E +   + +IN+ +   F+  N++L+DF+I+ 
Sbjct: 121 CYKEDKYDDPLINDYHVLAMGLATKEEIETIKDYTFKINELLKEFFMKSNLKLIDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR       +IVLADEI PD CRLWD     + DK RF +    + E Y EV  R+
Sbjct: 181 GRY----NGQIVLADEISPDTCRLWDKDTNRKMDKDRFRRDLGDVEETYKEVLDRI 232


>gi|310779980|ref|YP_003968312.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Ilyobacter polytropus DSM 2926]
 gi|309749303|gb|ADO83964.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Ilyobacter polytropus DSM 2926]
          Length = 236

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 87/237 (36%), Positives = 129/237 (54%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  ++ VYE K K +Y   +P  +I  FKDD    N  +  T+  KG+LNN+I+  ++  
Sbjct: 1   MIKKDMVYEGKAKKVYSTEDPNLVIIHFKDDATAGNGAKKGTIENKGILNNKITATLYEI 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI  +F + +N R+QL   VE+IPL + VRN  AGS+A R+ I EG     ++ E 
Sbjct: 61  LEKNGIKTHFKKMLNERDQLCEKVEIIPLEVIVRNVIAGSMAARVGIEEGTVPSNTIFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A       ++ ++   + +IN+ +   F    I LVDF+I+ 
Sbjct: 121 CYKNDKYNDPLINDHHAVAMGVTTYEDLAKIYDTTAKINNLLKETFDEEGITLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G+  D     I+LADEI PD CRLWD    E+ DK RF +    + E Y E+ +RLG
Sbjct: 181 GKNKD---GEILLADEITPDTCRLWDKETGEKLDKDRFRRDLGGIEEAYIEILKRLG 234


>gi|332141560|ref|YP_004427298.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Alteromonas macleodii str. 'Deep ecotype']
 gi|229485663|sp|B4RZW3|PUR7_ALTMD RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|327551582|gb|AEA98300.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Alteromonas macleodii str. 'Deep ecotype']
          Length = 237

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 83/238 (34%), Positives = 135/238 (56%), Gaps = 3/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R+ +Y  K K +Y   +   LI  F++D    +  +   L+ KG +NN+ + ++ T+
Sbjct: 1   MEKRDELYRGKAKTVYYTDDSDKLILHFRNDTSAFDGEKIEQLDRKGEVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+       I+  E LV+ ++MIP+   VRN +AGSL +RL + EG +L   + EF
Sbjct: 61  LEEAGVATQVEALISDTESLVKKLDMIPVECVVRNLSAGSLVRRLGVEEGQALNPPIFEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V++ HI +F WA Q ++ EM AL+ ++N+ +  LF    + LVD++++ 
Sbjct: 121 FLKNDALHDPMVNDYHILSFGWATQEQIAEMKALTFKVNNVLKALFDDAGMLLVDYKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G   D     IVL DE  PD CRLWD   +++ DK RF +    ++E Y EVA RLG+
Sbjct: 181 GVDKD---GNIVLGDEFTPDGCRLWDKETRKKMDKDRFRQGLGSVVETYIEVAERLGL 235


>gi|157691389|ref|YP_001485851.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           pumilus SAFR-032]
 gi|157680147|gb|ABV61291.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Bacillus
           pumilus SAFR-032]
          Length = 240

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 90/235 (38%), Positives = 141/235 (60%), Gaps = 3/235 (1%)

Query: 3   PRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLG 62
            +  +YE K K IY+  +   L   +KD     N  + A + GKG LNN IS  +F  L 
Sbjct: 4   KQELLYEGKAKKIYQTDDEHILYVEYKDSATAFNGEKKAEIEGKGRLNNEISSLIFQMLH 63

Query: 63  KIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYY 122
           + GI ++F++R++  EQL++ V+++PL + VRN  AGS++KRL IPEG  L   L+EFYY
Sbjct: 64  EKGINNHFVKRLSETEQLIQKVQIVPLEVVVRNVVAGSMSKRLGIPEGTKLDTPLIEFYY 123

Query: 123 LPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGR 182
             D+    L++E+HI   + A   +VEEM  ++ ++N+ +  +F   ++ L+DF+++ G 
Sbjct: 124 KDDALGDPLITEDHIRILDAATPEQVEEMKQITRQVNEELKQIFSDCHVNLIDFKLEFGI 183

Query: 183 LLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
             ++   RI+LADEI PD CRLWD    E+ DK  F ++   L   Y E+ +RLG
Sbjct: 184 DHEN---RILLADEISPDTCRLWDKETNEKLDKDVFRRNLGGLTNAYEEIFKRLG 235


>gi|182418795|ref|ZP_02950062.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium butyricum 5521]
 gi|237667970|ref|ZP_04527954.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|182377350|gb|EDT74910.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium butyricum 5521]
 gi|237656318|gb|EEP53874.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 235

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 89/236 (37%), Positives = 136/236 (57%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K I+   +   +I ++KDD    N  +   ++ KGV+NN I+  +F Q
Sbjct: 1   MEKLEMLYEGKAKQIFRTDKDDEVIVYYKDDATAFNGEKKGQIHDKGVMNNNITSILFEQ 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +FI+++N REQL + VE++PL + VRN AAGS+AKRL + EG +L  ++ EF
Sbjct: 61  LEAQGIKTHFIKKLNDREQLCKKVEIVPLEVIVRNVAAGSMAKRLGLEEGTALKTTVFEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  DS    L++  H  A   A   E++ +  ++ +IN+ +   F   NI L+DF+I+ 
Sbjct: 121 SYKDDSLGDPLINSYHAVAIGAATFEEIDIILEMTAKINNILKNAFAKENINLIDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+  D     IVLADEI PD CR WD +  E+ DK RF +    + + Y E+ +R+
Sbjct: 181 GKTAD---GEIVLADEISPDTCRFWDATTGEKLDKDRFRRDLGNVEDAYIEILKRI 233


>gi|254492423|ref|ZP_05105595.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylophaga thiooxidans DMS010]
 gi|224462315|gb|EEF78592.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylophaga thiooxydans DMS010]
          Length = 236

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 73/238 (30%), Positives = 135/238 (56%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K ++   +   ++  F+DD    +  +   L+ KG +NN+ + ++   
Sbjct: 1   MQKKQELYSGKAKSVFATDDNDYVVLSFRDDTSAFDGEKVEQLSRKGEVNNKFNAFIMQY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP +F + +N  E LV++++M+P+   VRN A+GSL +RL + +G+ L   + EF
Sbjct: 61  LSDNGIPTHFEKLLNDTESLVKNMQMMPVECVVRNVASGSLVRRLGVEDGMELTPPVFEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +++E HI  F WA   ++ +M  L+ ++N+ +  LF+   + LVD++++ 
Sbjct: 121 FLKNDALHDPMINEYHIETFGWAKSEDINKMKELTFKVNELLKTLFVDAGMILVDYKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        ++ L DE  PD CRLWD   +++ DK RF +    ++E Y EVA+R+G+
Sbjct: 181 GLF----NGQVYLGDEFSPDGCRLWDAETRKKLDKDRFRQGLGGVIEAYIEVAQRIGV 234


>gi|311694916|gb|ADP97789.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [marine
           bacterium HP15]
          Length = 237

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 83/238 (34%), Positives = 132/238 (55%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K +Y    P   +  F+DD    +  +   LN KG++NN+ + ++  +
Sbjct: 1   MEKREELYAGKAKSVYRTDNPERFVLVFRDDTSAFDGEKKEQLNRKGMVNNKFNAFIMEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+P +F   ++  E LV+ ++MIP+   VRN +AGSL +RL + EG  L     E 
Sbjct: 61  LEAAGVPTHFEGLLSSTESLVKKLDMIPVECVVRNVSAGSLCRRLGVAEGQELNPPTYEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E    +F WA   E+E+M +L+ R+ND +  LF    + LVD++++ 
Sbjct: 121 FLKNDALHDPMVNESLAVSFGWAAADELEQMKSLTYRVNDVLKALFDEAGMLLVDYKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR       +IVL DE  PD CR+WD   +++ DK RF +   +++E Y EV RRLGI
Sbjct: 181 GRC----EGKIVLGDEFSPDGCRIWDKETRKKMDKDRFRQGLGEVIETYEEVGRRLGI 234


>gi|221134606|ref|ZP_03560909.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Glaciecola sp. HTCC2999]
          Length = 238

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 79/238 (33%), Positives = 135/238 (56%), Gaps = 3/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ ++ +Y  K K ++   +   LI  F++D    +  +   L+ KG +NN+ + ++   
Sbjct: 1   MQKKDELYRGKAKTVFHTDDENLLILEFRNDTSAFDGEKIEQLDRKGEVNNKFNHFIMNH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI       I+  E +V+ ++MIP+   VRN AAGSL +RL + EGL+L     EF
Sbjct: 61  LEQAGIKTQVNALISDTESVVKKLDMIPVECVVRNVAAGSLCRRLGVEEGLTLNPPTFEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    ++++ HI +F WA + ++  M +L+ ++N+ +T LF   ++ LVD++++ 
Sbjct: 121 FLKNDALHDPMINDYHIVSFGWATEDQINTMKSLTFKVNEVLTALFDQGDMILVDYKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G  +D     IVL DE  PD CRLWD   + + DK RF +    ++E Y EVA RLG+
Sbjct: 181 GVDVD---GNIVLGDEFTPDGCRLWDKETRNKMDKDRFRQGLGSVVETYIEVAGRLGL 235


>gi|19704323|ref|NP_603885.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
 gi|22001845|sp|Q8REV1|PUR7_FUSNN RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|19714565|gb|AAL95184.1| Phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
          Length = 237

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 86/236 (36%), Positives = 133/236 (56%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +YE  +   +I  +KDD    N  +  T++ KG++NN I+  +F  
Sbjct: 1   MEKGKFIYEGKAKQLYETDDKDLVIVHYKDDATAGNGAKKGTIHNKGIMNNEITALIFNM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +F++++N R+QL + V++ PL + VRN  AGS+AKR+ I EG  +  ++ E 
Sbjct: 61  LEEHGIKTHFVKKLNDRDQLCQRVKIFPLEVIVRNIIAGSMAKRVGIKEGTKISNTIFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A   A   E++E+  ++ +IN+ +   F  I I LVDF+I+ 
Sbjct: 121 CYKNDEYGDPLINDHHAVAMGLATYDELKEIYDITGKINNLLKEKFDNIGITLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+        I+LADEI PD CRLWD    E+ DK RF +    + E Y EV +RL
Sbjct: 181 GKN---SKGEILLADEITPDTCRLWDKKTGEKLDKDRFRRDLGNIEEAYIEVVKRL 233


>gi|228977027|ref|ZP_04137430.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis Bt407]
 gi|228782644|gb|EEM30819.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis Bt407]
 gi|326938064|gb|AEA13960.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar chinensis CT-43]
          Length = 239

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 87/237 (36%), Positives = 134/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  +  T+ GKG LNN I+  +F +
Sbjct: 1   MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITGKGRLNNEITTLLFRK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+ +++  EQLV+ V +IPL +  RN  AGSL+KRL + EG  L   +VEF
Sbjct: 61  LQEVGIKTHFVEKLSETEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGTVLAEPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D+    LV+E+HI   N A+  +V  +  ++++IN  +   F    ++LVDF+++ 
Sbjct: 121 YFKDDNLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVLIDHFASCRVRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     +   I+LADEI PD CRLWD +  E+ DK  F +    L + Y E+ +RLG
Sbjct: 181 GVT---EEGEIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNLTDAYEEILKRLG 234


>gi|152996167|ref|YP_001341002.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Marinomonas sp. MWYL1]
 gi|189038228|sp|A6VX88|PUR7_MARMS RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|150837091|gb|ABR71067.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Marinomonas sp. MWYL1]
          Length = 238

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 79/238 (33%), Positives = 136/238 (57%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K ++   +P  ++  F+DD    +  R   L+ KG++NN+ + ++ T+
Sbjct: 1   MEKRQELYAGKAKSVFRTDDPDKMVLVFRDDTSAFDGKRIEQLDRKGMVNNKFNAFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP +F + ++  E LV+ ++MIP+   VRN AAGSL +RL + EG++L     E 
Sbjct: 61  LQEAGIPTHFEKLLSDTESLVKCLDMIPVECVVRNVAAGSLCRRLGVEEGITLTPPTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +++E H+ +F WA  S++ +   L+ ++ND +  +F    + LVD++++ 
Sbjct: 121 FLKNDALGDPMINESHVESFGWAKASDLAKAKELTFKVNDVLKAIFAEGGMILVDYKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         ++L DE  PD CRLWD   KE+ DK RF +    ++E Y +V RR+GI
Sbjct: 181 GLY----KGEVLLGDEFSPDGCRLWDAKTKEKLDKDRFRQGLGGVIEAYEDVGRRIGI 234


>gi|71064731|ref|YP_263458.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Psychrobacter arcticus 273-4]
 gi|123649796|sp|Q4FVD4|PUR7_PSYA2 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|71037716|gb|AAZ18024.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Psychrobacter arcticus 273-4]
          Length = 237

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 86/238 (36%), Positives = 139/238 (58%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y+ K K +YE  +   LI  F+DD    +  R   L  KGV+NNR + ++  +
Sbjct: 1   MQKQEMLYKGKAKSVYETEDNDLLILHFRDDTSALDGKRIEQLARKGVVNNRFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +F ++++  E LV+ ++MIP+   VRN AAGSL +RL + EG +L     E 
Sbjct: 61  LADAGIETHFEKQLSDDEVLVKRLDMIPVECVVRNFAAGSLVRRLGLEEGQALTPPTYEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +Y  D+    +V+E    +  WA  +++ +M  LS ++N+ +T LF   ++ LVDF+++ 
Sbjct: 121 FYKDDALGDPMVNESISISLGWATDAQLAKMKELSHQVNEVLTALFDAGDLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G   D    RI+L DE  PD CR+WD + K++ DK RF +S   ++E Y EVA R+G+
Sbjct: 181 GVFHD----RIILGDEFSPDGCRIWDKATKKKLDKDRFRQSLGDVIEAYEEVASRIGV 234


>gi|321314372|ref|YP_004206659.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           subtilis BSn5]
 gi|320020646|gb|ADV95632.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           subtilis BSn5]
          Length = 241

 Score =  246 bits (629), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 88/238 (36%), Positives = 139/238 (58%), Gaps = 3/238 (1%)

Query: 3   PRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLG 62
               +YE K K IY+  +  TL   +KD     N  + A ++GKG LNN IS  +F  L 
Sbjct: 5   KNELLYEGKAKKIYKTDDENTLYVVYKDSATAFNGEKKAEISGKGRLNNEISSLIFKHLH 64

Query: 63  KIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYY 122
             GI ++FI RI+  EQL++ V ++PL + VRN  AGS++KRL IPEG  L + ++EFYY
Sbjct: 65  AKGINNHFIERISETEQLIKKVTIVPLEVVVRNVVAGSMSKRLGIPEGTELEQPIIEFYY 124

Query: 123 LPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGR 182
             D+    L++E+HI     A   +VE + +++  +N+ +  +F   +++L+DF+++ G 
Sbjct: 125 KDDALGDPLITEDHIWLLKAATPEQVETIKSITKTVNEELQSIFGDCHVRLIDFKLEFGL 184

Query: 183 LLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
             +    +++LADEI PD CRLWD    E+ DK  F ++   L + Y E+ +RLG   
Sbjct: 185 DAE---GQVLLADEISPDTCRLWDKDTNEKLDKDLFRRNLGSLTDAYEEIFKRLGGIH 239


>gi|161511212|ref|NP_830165.2| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus ATCC 14579]
 gi|206968273|ref|ZP_03229229.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus AH1134]
 gi|218231628|ref|YP_002365120.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus B4264]
 gi|228956713|ref|ZP_04118499.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar pakistani str. T13001]
 gi|228963372|ref|ZP_04124533.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar sotto str. T04001]
 gi|229077636|ref|ZP_04210266.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus Rock4-2]
 gi|229107953|ref|ZP_04237580.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus Rock1-15]
 gi|229125778|ref|ZP_04254804.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus BDRD-Cer4]
 gi|229143076|ref|ZP_04271509.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus BDRD-ST24]
 gi|229148680|ref|ZP_04276930.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus m1550]
 gi|229159432|ref|ZP_04287450.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus R309803]
 gi|229188548|ref|ZP_04315587.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus ATCC 10876]
 gi|296501107|ref|YP_003662807.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis BMB171]
 gi|39931867|sp|Q81IQ6|PUR7_BACCR RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|226723539|sp|B7H4T3|PUR7_BACC4 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|206737193|gb|EDZ54340.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus AH1134]
 gi|218159585|gb|ACK59577.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Bacillus
           cereus B4264]
 gi|228594737|gb|EEK52517.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus ATCC 10876]
 gi|228624003|gb|EEK80811.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus R309803]
 gi|228634688|gb|EEK91267.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus m1550]
 gi|228640349|gb|EEK96746.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus BDRD-ST24]
 gi|228657635|gb|EEL13447.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus BDRD-Cer4]
 gi|228675456|gb|EEL30673.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus Rock1-15]
 gi|228705577|gb|EEL57933.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus Rock4-2]
 gi|228796266|gb|EEM43713.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar sotto str. T04001]
 gi|228802901|gb|EEM49733.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar pakistani str. T13001]
 gi|296322159|gb|ADH05087.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis BMB171]
          Length = 239

 Score =  246 bits (629), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 87/237 (36%), Positives = 133/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  +  T+ GKG LNN I+  +F +
Sbjct: 1   MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITGKGRLNNEITTLLFRK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+ +++  EQLV+ V +IPL +  RN  AGSL+KRL + EG  L   +VEF
Sbjct: 61  LQEVGIKTHFVEKLSETEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGTVLAEPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D     LV+E+HI   N A+  +V  +  ++++IN  +   F    ++LVDF+++ 
Sbjct: 121 YFKDDDLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVLIDHFASCRVRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     +   I+LADEI PD CRLWD +  E+ DK  F +    L + Y E+ +RLG
Sbjct: 181 GVT---EEGEIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNLTDAYEEILKRLG 234


>gi|93004991|ref|YP_579428.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Psychrobacter cryohalolentis K5]
 gi|122416097|sp|Q1QEF9|PUR7_PSYCK RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|92392669|gb|ABE73944.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Psychrobacter cryohalolentis K5]
          Length = 237

 Score =  246 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 88/238 (36%), Positives = 140/238 (58%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y+ K K +YE  +   LI  F+DD    +  R   L  KGV+NNR + ++  +
Sbjct: 1   MQKQELLYKGKAKSVYETEDNDLLILHFRDDTSALDGKRIEQLARKGVVNNRFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +F ++++  E LV+ ++MIP+   VRN AAGSL +RL + EG +L     E 
Sbjct: 61  LADAGIETHFEKQLSDDEVLVKRLDMIPVECVVRNFAAGSLVRRLGLEEGQALTPPTYEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +Y  D+    +V+E    +  WAN +++ +M  LS ++N+ +T LF   ++ LVDF+++ 
Sbjct: 121 FYKDDALGDPMVNESISISLGWANDAQLVKMKELSHQVNEVLTALFDAGDLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G   D    RIVL DE  PD CR+WD + K++ DK RF +S   ++E Y EVA R+G+
Sbjct: 181 GVFHD----RIVLGDEFSPDGCRIWDKATKKKLDKDRFRQSLGDVIEAYEEVASRIGV 234


>gi|42779401|ref|NP_976648.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus ATCC 10987]
 gi|47569935|ref|ZP_00240600.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus G9241]
 gi|52144953|ref|YP_081875.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus E33L]
 gi|196034758|ref|ZP_03102166.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus W]
 gi|206974267|ref|ZP_03235184.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus H3081.97]
 gi|217957850|ref|YP_002336394.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus AH187]
 gi|218901481|ref|YP_002449315.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus AH820]
 gi|222094050|ref|YP_002528107.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus Q1]
 gi|228925536|ref|ZP_04088625.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228944088|ref|ZP_04106467.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228983532|ref|ZP_04143737.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|229089406|ref|ZP_04220677.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus Rock3-42]
 gi|229119938|ref|ZP_04249193.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus 95/8201]
 gi|229137116|ref|ZP_04265735.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus BDRD-ST26]
 gi|229154044|ref|ZP_04282169.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus ATCC 4342]
 gi|300118911|ref|ZP_07056622.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus SJ1]
 gi|81824409|sp|Q63GT6|PUR7_BACCZ RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|81831197|sp|Q73EN8|PUR7_BACC1 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|226723537|sp|B7JM82|PUR7_BACC0 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|226723540|sp|B7HS29|PUR7_BACC7 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|254783936|sp|B9J1K2|PUR7_BACCQ RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|42735317|gb|AAS39256.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus ATCC 10987]
 gi|47553381|gb|EAL11767.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus G9241]
 gi|51978422|gb|AAU19972.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Bacillus cereus E33L]
 gi|195992801|gb|EDX56761.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus W]
 gi|206747507|gb|EDZ58897.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus H3081.97]
 gi|217066658|gb|ACJ80908.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus AH187]
 gi|218537400|gb|ACK89798.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus AH820]
 gi|221238105|gb|ACM10815.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Bacillus cereus Q1]
 gi|228629324|gb|EEK86026.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus ATCC 4342]
 gi|228646288|gb|EEL02503.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus BDRD-ST26]
 gi|228663404|gb|EEL18989.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus 95/8201]
 gi|228693883|gb|EEL47575.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus Rock3-42]
 gi|228776128|gb|EEM24489.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|228815477|gb|EEM61719.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228834014|gb|EEM79562.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|298723527|gb|EFI64258.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus SJ1]
 gi|324324291|gb|ADY19551.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar finitimus YBT-020]
          Length = 239

 Score =  246 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 88/237 (37%), Positives = 133/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  +  T+ GKG LNN I+  +F +
Sbjct: 1   MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITGKGRLNNEITTLLFRK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+ +++  EQLV+ V +IPL +  RN  AGSL+KRL + EG  L   +VEF
Sbjct: 61  LQEVGIKTHFVEKLSETEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGTVLAEPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D     LV+E+HI   N A+  +V  +  ++++IN  +   F    ++LVDF+++ 
Sbjct: 121 YFKDDDLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVLIDHFASCRVRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     D   I+LADEI PD CRLWD +  E+ DK  F +    L + Y E+ +RLG
Sbjct: 181 GVT---DEGEIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNLTDAYEEILKRLG 234


>gi|325295465|ref|YP_004281979.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfurobacterium thermolithotrophum DSM 11699]
 gi|325065913|gb|ADY73920.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfurobacterium thermolithotrophum DSM 11699]
          Length = 241

 Score =  246 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 92/236 (38%), Positives = 138/236 (58%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K++Y+      L+Q+FKDD    +  +   L  KGV+N  IS  +F  
Sbjct: 1   MEKKEKLYEGKAKVLYKTDNKDLLVQYFKDDTTAFDGAKKEVLEDKGVINCSISTAIFEY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI  +F+ R++ RE LV+  E+IP+ + VRN AAGS ++R  + EG  L + LVE+
Sbjct: 61  LEKNGIKTHFVERLSSREMLVKGCEIIPVEVVVRNIAAGSFSRRYGVKEGTPLKKPLVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +Y  D     +V   H+  F WA + E+EEMT  ++++N+ +   F  I I LVDF+++ 
Sbjct: 121 FYKSDELHDPMVCPNHVYLFEWATKEELEEMTNTALKVNELLKKFFDEIGIILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR        ++LADEI PD CRLWD S  E  DK RF K   +++E Y E+ +R+
Sbjct: 181 GR----HNGEVILADEITPDSCRLWDKSSMEVLDKDRFRKDMGKVVESYKEIYKRI 232


>gi|110833640|ref|YP_692499.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Alcanivorax borkumensis SK2]
 gi|123149626|sp|Q0VRH1|PUR7_ALCBS RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|110646751|emb|CAL16227.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Alcanivorax borkumensis SK2]
          Length = 238

 Score =  246 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 83/241 (34%), Positives = 132/241 (54%), Gaps = 4/241 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R+ +Y  K K +Y   +   LI  F+DD    +  +   L  KG +NN+ +  +  +
Sbjct: 1   MEKRDELYAGKAKSVYTTDDEDMLIMLFRDDTSAFDGKKKEALARKGAVNNQFNAAIMEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP +F + ++  E LV+ ++MIP+   VRN AAGS+ +RL + EGL L     EF
Sbjct: 61  LKAAGIPCHFEKTLSATESLVKKLDMIPVECVVRNIAAGSICRRLGVEEGLELTPPTFEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D     +V++ HI +F WA+  +V +M  L+  +ND +  LFL   + LVD++++ 
Sbjct: 121 FLKDDDLGDPMVNDFHIRSFGWASDDQVAQMKTLTFAVNDVLKQLFLDGGMLLVDYKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           G         ++L DE  PD CRLWD   +E+ DK RF +    ++E Y EV +RLG+  
Sbjct: 181 GMF----KGEVLLGDEFSPDGCRLWDKDSREKLDKDRFRQGLGGVVEAYEEVGKRLGMTF 236

Query: 241 K 241
           +
Sbjct: 237 E 237


>gi|223040174|ref|ZP_03610453.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Campylobacter rectus RM3267]
 gi|222878535|gb|EEF13637.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Campylobacter rectus RM3267]
          Length = 238

 Score =  246 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 87/237 (36%), Positives = 131/237 (55%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +YE K K ++   +   LI  FKDD    +  +     GKG LNN+IS  +F  
Sbjct: 1   MQKKELIYEGKGKKMFATDDANLLIAEFKDDLTAFDAQKRGNEAGKGALNNKISTQLFHL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP + +  ++  EQLV+  ++IPL + VRN A GSL KRL I EG  LP +LVEF
Sbjct: 61  LKEKGIPTHLVETLSDTEQLVKKCKIIPLEVVVRNIATGSLTKRLAIKEGTVLPFTLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWA-NQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIK 179
           YY  D     L+++EH        ++++++ +  +   IN  +   F   N++LVDF+++
Sbjct: 121 YYKNDELHDPLINDEHCLIMGLVKSENDLDRLKHMGREINAILFKFFADRNLKLVDFKVE 180

Query: 180 CGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
            G   D     I+LADEI PD CR WD +  E+ DK RF +    +   Y EV +R+
Sbjct: 181 FGIDKD---GNILLADEISPDSCRFWDATTNEKLDKDRFRQDLGSVKVAYEEVLKRI 234


>gi|288554944|ref|YP_003426879.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           pseudofirmus OF4]
 gi|288546104|gb|ADC49987.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           pseudofirmus OF4]
          Length = 240

 Score =  246 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 94/237 (39%), Positives = 139/237 (58%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K IY       L   +KDD    N  + A L GK  LNN I+  +F  
Sbjct: 1   MEKRELLYEGKAKKIYRTDNESILWVSYKDDATAFNGEKKAQLEGKARLNNEITSLIFKN 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+  +F+ R++  +QLVR V+++PL + VRN  AGS+AKRL + EGL L R +VEF
Sbjct: 61  LEAEGLETHFVERLSETDQLVRKVDIVPLEVVVRNQVAGSMAKRLGLEEGLKLARPVVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    L++E+HI     A   EV+++ +++ ++N+ +  LF  I+I+L+DF+++ 
Sbjct: 121 YYKDDALGDPLITEDHIAILRAATPEEVDQLKSMARKVNEHLQKLFATIDIKLIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           GR    +   ++LADEI PD CRLWD+   E  DK  F ++   L  GY E+  RLG
Sbjct: 181 GRT---ESGELLLADEISPDTCRLWDMETNERFDKDLFRRNLGNLQAGYQEILTRLG 234


>gi|300867386|ref|ZP_07112042.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oscillatoria sp. PCC 6506]
 gi|300334637|emb|CBN57210.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oscillatoria sp. PCC 6506]
          Length = 253

 Score =  246 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 87/240 (36%), Positives = 131/240 (54%), Gaps = 7/240 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M P + +YE K KI+Y   +   L+ +FKDD    N  +  T+ GKG +N  +S ++F  
Sbjct: 12  MSPDSKLYEGKAKILYATDDSEILLTYFKDDATAFNAQKRGTIAGKGEINCAVSRHLFQL 71

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP +FI   +  E  VR V++ PL + VRN AAGSL ++  +  G  L  +LVEF
Sbjct: 72  LEAKGIPTHFIDCPSPNEMRVRRVQIFPLEVVVRNIAAGSLCQQTGLAVGTVLTPALVEF 131

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    L++ + +     A   ++EE+ A + +IN+ + G F    I LVDF+++ 
Sbjct: 132 YYKNDALGDPLLTRDRLLFMQLATPYQLEELQAAARQINEILKGFFNQCGITLVDFKLEF 191

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLS----KKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G   D    +++LADEI PD CRLWD S     K   DK RF +    +   Y +V +R+
Sbjct: 192 GLDRDR---KLILADEISPDTCRLWDQSETDPDKRVMDKDRFRRDLGSVETAYQQVLQRV 248


>gi|291483083|dbj|BAI84158.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           subtilis subsp. natto BEST195]
          Length = 241

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 89/238 (37%), Positives = 139/238 (58%), Gaps = 3/238 (1%)

Query: 3   PRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLG 62
               +YE K K IY+  +  TL   +KD     N  + A ++GKG LNN IS  +F  L 
Sbjct: 5   KNELLYEGKAKKIYKTDDENTLYVVYKDSATAFNGEKKAEISGKGRLNNEISSLIFKHLH 64

Query: 63  KIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYY 122
             GI ++FI RI+  EQL++ V ++PL + VRN  AGS++KRL IPEG  L + ++EFYY
Sbjct: 65  GKGINNHFIERISETEQLIKKVTIVPLEVVVRNVVAGSMSKRLGIPEGTELEQPIIEFYY 124

Query: 123 LPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGR 182
             D+    L++E+HI     A   +VE + +++  +N+ +  +F   +++L+DF+++ G 
Sbjct: 125 KDDALGDPLITEDHIWLLKAATPEQVETIKSITKTVNEELQSIFDDCHVRLIDFKLEFGL 184

Query: 183 LLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
             D    +++LADEI PD CRLWD    E+ DK  F ++   L + Y E+ +RLG   
Sbjct: 185 DAD---GQVLLADEISPDTCRLWDKETNEKLDKDLFRRNLGSLTDAYEEIFKRLGGIH 239


>gi|239992982|ref|ZP_04713506.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Alteromonas macleodii ATCC 27126]
          Length = 237

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 82/238 (34%), Positives = 133/238 (55%), Gaps = 3/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R+ +Y  K K +Y   +   LI  F++D    +  +   L  KG +NN+ + ++ T+
Sbjct: 1   MEKRDELYRGKAKTVYYTDDSDKLILHFRNDTSAFDGEKIEQLERKGEVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI       ++  E LV+ ++MIP+   VRN +AGSL +RL + EG  L   + EF
Sbjct: 61  LEEAGIATQVEALVSDTESLVKKLDMIPVECVVRNLSAGSLVRRLGVEEGKELNPPIFEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V++ HI +F WA ++++ EM AL+ ++N  +  LF    + LVD++++ 
Sbjct: 121 FLKNDALHDPMVNDYHILSFGWATEAQIAEMKALTFKVNSVLKALFDDAGMLLVDYKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G   D     IVL DE  PD CRLWD   +++ DK RF +    ++E Y EVA RLG+
Sbjct: 181 GVDKD---GNIVLGDEFTPDGCRLWDKETRKKMDKDRFRQGLGSVVETYIEVAERLGL 235


>gi|326577847|gb|EGE27714.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Moraxella
           catarrhalis O35E]
          Length = 236

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 86/238 (36%), Positives = 138/238 (57%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +YE      LI  F++D    N  +  +L+ KGV+NNR + ++  +
Sbjct: 1   MQKQALLYTGKAKSVYETDHSDYLILHFRNDASAFNGEKMESLDRKGVVNNRFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +F ++++  E LV+ ++MIP+   VRN AAG L KRL + EGL L     E 
Sbjct: 61  LADAGIETHFEKQLSDDEVLVKRLKMIPVEAVVRNYAAGGLMKRLGLSEGLPLLPPTYEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +Y  D+    ++SE    A  +A   E+ +M +L++++N+ ++ LF   ++ LVDF+++ 
Sbjct: 121 FYKDDTLGDPMLSESTAIALGYATADELAQMQSLTLKVNEVLSKLFDEADLMLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        R+VL DE  PD CRLWD   K++ DK RF +    ++EGY EVARR+G+
Sbjct: 181 GLF----QGRVVLGDEFSPDGCRLWDKQTKKKLDKDRFRQGLGDVVEGYEEVARRIGV 234


>gi|228913019|ref|ZP_04076658.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|228846424|gb|EEM91437.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
          Length = 258

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 88/237 (37%), Positives = 133/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  +  T+ GKG LNN I+  +F +
Sbjct: 20  MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITGKGRLNNEITTLLFRK 79

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+ +++  EQLV+ V +IPL +  RN  AGSL+KRL + EG  L   +VEF
Sbjct: 80  LQEVGIKTHFVEKLSETEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGTVLAEPIVEF 139

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D     LV+E+HI   N A+  +V  +  ++++IN  +   F    ++LVDF+++ 
Sbjct: 140 YFKDDDLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVLIDHFASCRVRLVDFKLEF 199

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     D   I+LADEI PD CRLWD +  E+ DK  F +    L + Y E+ +RLG
Sbjct: 200 GVT---DEGAIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNLTDAYEEILKRLG 253


>gi|326790570|ref|YP_004308391.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium lentocellum DSM 5427]
 gi|326541334|gb|ADZ83193.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium lentocellum DSM 5427]
          Length = 234

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 83/236 (35%), Positives = 135/236 (57%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +++  +    I  +KDD    N  +  T+ GKGV+NNR+S  M   
Sbjct: 1   MEKREQLYEGKAKKVFKTDDERYYIVSYKDDATAFNGEKKGTIVGKGVVNNRMSNIMCRM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  + +  +N RE +V+ VE++PL + VRN AAGS +KR  + EG  L    +EF
Sbjct: 61  LEQNGIETHLVEELNDRETVVKAVEIVPLEVIVRNVAAGSFSKRFGVEEGTVLKNPTLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
               D+    ++++  I A + A + E++ M+ ++ +IN+ +   FL I ++L+DF+I+ 
Sbjct: 121 CLKDDALGDPMINDYQILALDIATEEELKVMSEMTFKINELLKAYFLKIGVKLIDFKIEL 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR+      +I+LADEI PD CR WD    ++ DK RF +    + E Y+E+  R+
Sbjct: 181 GRV----DGKIILADEISPDTCRFWDAETNKKLDKDRFRRDLGGVEEVYAEMLARV 232


>gi|260889160|ref|ZP_05900423.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Leptotrichia hofstadii F0254]
 gi|260861220|gb|EEX75720.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Leptotrichia hofstadii F0254]
          Length = 238

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 87/241 (36%), Positives = 127/241 (52%), Gaps = 3/241 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  VYE K K I+   +   +I +FKDD    N  +   L  KG+LNN+IS  ++  
Sbjct: 1   MEKREQVYEGKAKSIFSTDKADEIIMYFKDDATAFNGVKKDQLEDKGILNNKISTLLYGY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+  ++I  +N REQL + +E++PL + +RN A GS  KR    EG    R   E 
Sbjct: 61  LIKNGVKTHWIETLNDREQLCKKLEIVPLEVIIRNRATGSFVKRYGAEEGKIFKRPTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L++++H  A     + E+ E+   +  IND ++ LF  +N+ LVD++I+ 
Sbjct: 121 SYKNDDLGDPLLNDDHALALELVTEDELAEIKKQTFLINDLLSKLFDKMNLILVDYKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR        I+LADEI PD  RLWD    ++ DK RF +    ++  Y EV RRL    
Sbjct: 181 GRD---KEGNILLADEISPDSMRLWDKDTLKKLDKDRFRQDLGDVMGAYREVLRRLEEVL 237

Query: 241 K 241
           K
Sbjct: 238 K 238


>gi|193214916|ref|YP_001996115.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chloroherpeton thalassium ATCC 35110]
 gi|229485915|sp|B3QYX5|PUR7_CHLT3 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|193088393|gb|ACF13668.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chloroherpeton thalassium ATCC 35110]
          Length = 235

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 83/236 (35%), Positives = 131/236 (55%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+  N +YE K K I+    P  +IQ FKDD    N  +  T+ GKGV+NN +S ++F+ 
Sbjct: 1   MKKGNMIYEGKAKKIFATDNPDLVIQEFKDDASAFNALKKGTILGKGVVNNEVSCHLFSH 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  +GI ++F+ +++ RE L + +E+I   + +RN AAGSL KR  + E   LP  + E 
Sbjct: 61  LAGLGIENHFVEKLSEREMLCKKLEIIKAEVVMRNIAAGSLVKRYGLQEAQVLPFPIAEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y   D+    L+++ H  A   A+  E++ +   + ++N  +   FL   ++LVDF+++ 
Sbjct: 121 YLKDDALGDPLMNDAHAVAMGIASAEEIQFVKQEASKVNAALQVFFLERGLKLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR       +I+L DEI PD CRLWD    ++ DK RF      + E Y EV  R+
Sbjct: 181 GR----HNGKILLGDEISPDTCRLWDAETMKKLDKDRFRFDLGDVEEAYIEVRHRV 232


>gi|300854041|ref|YP_003779025.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium ljungdahlii DSM 13528]
 gi|300434156|gb|ADK13923.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium ljungdahlii DSM 13528]
          Length = 235

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 86/236 (36%), Positives = 135/236 (57%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +YE  +   +I ++KDD    N  +   ++ KGVLNN I+  +F  
Sbjct: 1   MEKGKMIYEGKAKKVYETEDKDKVIIYYKDDATAFNGEKKGQISDKGVLNNTITSMLFEL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI  +F +++N REQL + VE++PL + VRN AAGS+AKRL + EG +L  ++ E 
Sbjct: 61  LEKHGIETHFEQKLNDREQLCKKVEIVPLEVIVRNVAAGSMAKRLGLEEGSALKTTVYEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H      A   E++ +  ++  IN+ +   FL   I+L+DF+++ 
Sbjct: 121 SYKNDELGDPLINDYHAVGIGAATFDELKTIYKMTESINNILKEFFLRQGIKLIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+  +    +I+LADEI PD CRLWD    E+ DK RF +    + E Y E+ +R+
Sbjct: 181 GKFNE----KILLADEISPDTCRLWDAKTNEKLDKDRFRRDMGNVKEAYVEILKRI 232


>gi|78043284|ref|YP_359917.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Carboxydothermus hydrogenoformans Z-2901]
 gi|77995399|gb|ABB14298.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Carboxydothermus hydrogenoformans Z-2901]
          Length = 236

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 86/236 (36%), Positives = 132/236 (55%), Gaps = 5/236 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K KI+Y    P  ++ ++KD     +  +   +  KG LN +IS Y+F  
Sbjct: 1   MEK-KFLYEGKAKIVYATENPDEVVVYYKDAATAFDGKKKGEIENKGYLNAQISAYIFKY 59

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI  +F+  +  REQ V+ + +IP+ + VRN AAGSL+KRL +PEG  LP  +VE 
Sbjct: 60  LEKQGIKTHFLELVGEREQRVKRLSIIPVEVVVRNIAAGSLSKRLGLPEGTDLPFPVVEL 119

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +++  H+ A N A   E++ M   ++++N  +   F  +NI LVDF+++ 
Sbjct: 120 YYKNDELGDPMINHYHVQALNLATPEEIKYMEDTALKVNSLLKEFFDSLNILLVDFKLEF 179

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR        I+L DEI PD CR WD   +E+ DK RF +    + E Y+E+ +R+
Sbjct: 180 GRF----KKEILLGDEISPDTCRFWDKDTREKLDKDRFRRDLGGVTEAYAEILKRI 231


>gi|225016369|ref|ZP_03705561.1| hypothetical protein CLOSTMETH_00272 [Clostridium methylpentosum
           DSM 5476]
 gi|224950865|gb|EEG32074.1| hypothetical protein CLOSTMETH_00272 [Clostridium methylpentosum
           DSM 5476]
          Length = 236

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 82/236 (34%), Positives = 133/236 (56%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K +Y   +P  +I  +KDD    N  +  T+ GKGV+NNR++ +    
Sbjct: 1   MKKLEQLYEGKAKKVYATDDPNCVIVDYKDDATAFNGEKKGTIVGKGVINNRLTNHFMKM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+P + +  I+ RE +V+ VE+I L + +RN AAGS +KR  + EG  L +   EF
Sbjct: 61  LEENGVPTHLVEEISDRETVVKKVEIIKLEVIIRNIAAGSFSKRFGVEEGTVLKQPSFEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
               D     L+++ H+ +   A Q E++ + A++ ++ND +       +I+LVDF+++ 
Sbjct: 121 SLKNDDLGDPLINDYHVLSIGVATQEEIDTIKAMAFKVNDLLKDYLKKFDIELVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+  D    +IVLADEI PD CR WD++  E+ DK RF +        Y E+ RR+
Sbjct: 181 GKTND---GQIVLADEISPDTCRFWDVNTHEKLDKDRFRRDMGGEEHAYQEMLRRV 233


>gi|49479097|ref|YP_034613.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|81828421|sp|Q6HPA7|PUR7_BACHK RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|49330653|gb|AAT61299.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Bacillus thuringiensis serovar konkukian
           str. 97-27]
          Length = 239

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 88/237 (37%), Positives = 133/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  +  T+ GKG LNN I+  +F +
Sbjct: 1   MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITGKGRLNNEITTLLFRK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+ +++  EQLV+ V +IPL +  RN  AGSL+KRL + EG  L   +VEF
Sbjct: 61  LQEVGIKTHFVEKLSETEQLVKKVSIIPLEVVTRNVLAGSLSKRLGMEEGTVLAEPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D     LV+E+HI   N A+  +V  +  ++++IN  +   F    ++LVDF+++ 
Sbjct: 121 YFKDDDLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVLIDHFASCRVRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     D   I+LADEI PD CRLWD +  E+ DK  F +    L + Y E+ +RLG
Sbjct: 181 GVT---DEGAIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNLTDAYEEILKRLG 234


>gi|300870746|ref|YP_003785617.1| phosphoribosylamidoimidazole succinocarboxamide synthase
           [Brachyspira pilosicoli 95/1000]
 gi|300688445|gb|ADK31116.1| phosphoribosylamidoimidazole succinocarboxamide synthase
           [Brachyspira pilosicoli 95/1000]
          Length = 238

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 82/238 (34%), Positives = 129/238 (54%), Gaps = 3/238 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             +  +YE K K +Y       +I ++KDD    N  +  ++  KGV+NN I+  +F  L
Sbjct: 4   EKKEMIYEGKAKKVYSTDNADEIIVYYKDDATAFNGEKKGSIKDKGVMNNEITTLLFKML 63

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            K G+  +FI +++ REQL + V++ PL + VRN  AGS+AKRL I EG   P ++ E  
Sbjct: 64  EKNGVKTHFIEKLSDREQLCQKVKIFPLEVIVRNLIAGSMAKRLGIEEGTVPPNTIFEIC 123

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D+    L+++ H  A N A   E++ +  ++ ++N+ +      I I LVDF+++ G
Sbjct: 124 YKNDAYGDPLINDHHAVALNLATYDELKYIYEVTSKVNNLLKEALDKIGITLVDFKVEFG 183

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
           +        I+LADEI PD CR WD +  ++ DK RF +    + E Y EV  RL   
Sbjct: 184 KN---SKGEILLADEITPDTCRFWDKATGKKLDKDRFRRDLGSIEEAYIEVLNRLNNM 238


>gi|332968752|gb|EGK07802.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Psychrobacter sp. 1501(2011)]
          Length = 239

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 86/237 (36%), Positives = 137/237 (57%), Gaps = 4/237 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
           + ++ +Y+ K K +YE   P  LI  F+DD    N  R   L  KG +NNR + ++  +L
Sbjct: 4   QKQDLLYKGKAKSVYETENPDYLILHFRDDTSAFNGERIEQLGRKGQVNNRFNAFIMQKL 63

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            + GI  +F ++++  E LV+ ++MIP+   VRN AAGSL +RL + EG +L     E +
Sbjct: 64  DEAGIETHFEKQLSDDEVLVKRLDMIPVECVVRNFAAGSLVRRLGLEEGQALTPPTYELF 123

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           +  D+    +V+E    A  WA   ++++M  L+ ++ND +  LF    + LVDF+++ G
Sbjct: 124 FKDDALGDPMVNESLSVALGWATPEQLDKMKELTFKVNDVLKELFDAGGLMLVDFKLEFG 183

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
              D    RIVL DE  PD CR+WD   K++ DK RF +S   ++E Y EVA+R+G+
Sbjct: 184 VFQD----RIVLGDEFSPDGCRIWDKETKKKLDKDRFRQSLGDVIESYEEVAQRIGV 236


>gi|89896677|ref|YP_520164.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfitobacterium hafniense Y51]
 gi|122481283|sp|Q24QH2|PUR7_DESHY RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|89336125|dbj|BAE85720.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 238

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 97/241 (40%), Positives = 137/241 (56%), Gaps = 4/241 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +Y   + G     +KDD    N  +  T+  KG++NNR+S  +F  
Sbjct: 1   MEKGQMLYEGKAKKVYTTDQEGIYWVEYKDDATAFNGEKKGTIGDKGIVNNRLSALLFEV 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GIP +FI  +N RE LVR +EMIPL + VRN AAGSLAKRL + EGL L R +VE 
Sbjct: 61  LEKTGIPTHFIELLNDREMLVRKLEMIPLEVVVRNIAAGSLAKRLGVAEGLKLSRPVVEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+     V+E H  A  WA + +++E+  L ++IN  +  +     I LVDF+++ 
Sbjct: 121 YYKDDALGDPFVNESHSLAMGWAEERDLKEIQELGLKINGELQKILDQAGIILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           G+       ++ L DEI PD CR WD   +E+ DK RF +   ++ E Y+EV RR+    
Sbjct: 181 GK----AEGKVYLGDEISPDTCRFWDKETQEKLDKDRFRRDLGKVEEAYAEVYRRVKEVL 236

Query: 241 K 241
           K
Sbjct: 237 K 237


>gi|326795249|ref|YP_004313069.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Marinomonas mediterranea MMB-1]
 gi|326546013|gb|ADZ91233.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Marinomonas mediterranea MMB-1]
          Length = 238

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 78/238 (32%), Positives = 129/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K ++   +P  ++  F+DD    +  +   LN KG++NN+ + ++  +
Sbjct: 1   MEKRQELYAGKAKSVFRTDDPDKMVLVFRDDTSAFDGKKVEQLNRKGMVNNKFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP +F   ++  E LV+ ++M+P+   VRN AAGSL +RL + EG  L     E 
Sbjct: 61  LEDAGIPTHFESLLSDNESLVKRLDMMPVECVVRNVAAGSLCRRLGVEEGAKLTPPTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D     +++E H+ +F WA  + + E   L+ ++ND +  LF    + LVD++++ 
Sbjct: 121 FLKNDELGDPMINESHVESFGWAEATHLAEAKTLTYKVNDVLKALFAEGGMTLVDYKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        ++VL DE  PD CRLWD    E+ DK RF +    ++E Y +V RR+GI
Sbjct: 181 GIF----DGKVVLGDEFSPDGCRLWDAKTNEKLDKDRFRQGLGGVIEAYEDVGRRIGI 234


>gi|167035171|ref|YP_001670402.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas putida GB-1]
 gi|189038192|sp|B0KSY0|PUR7_PSEPG RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|166861659|gb|ABZ00067.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas putida GB-1]
          Length = 236

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 83/238 (34%), Positives = 135/238 (56%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R+ +Y  K K +++  +   LI  F++D    +  R   L+ KG++NN+ + ++  +
Sbjct: 1   MEKRDELYRGKAKSVFKTDDADRLILLFRNDTSAFDGKRIEQLDRKGMVNNKFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+P  F + +   E LV+ ++MIP+   VRN AAGSL KRL + EG+ L  S  E 
Sbjct: 61  LEEAGVPTQFDKLLGDNECLVKKLDMIPVECVVRNYAAGSLVKRLGVEEGIKLEPSTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D      ++E H+ AF W    ++ EM  LS+++N+ ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDEKGDPFINESHVVAFGWGTAEQLVEMKKLSLKVNEVLSKLFDDAGLLLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        +IVL DE  PD CRLWD   +++ DK RF +    ++E Y EVA+RLG+
Sbjct: 181 GVFH----GQIVLGDEFSPDGCRLWDKETRKKMDKDRFRQGLGDVIEAYEEVAKRLGV 234


>gi|86604964|ref|YP_473727.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Synechococcus sp. JA-3-3Ab]
 gi|123507922|sp|Q2JXL8|PUR7_SYNJA RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|86553506|gb|ABC98464.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Synechococcus sp. JA-3-3Ab]
          Length = 256

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 86/255 (33%), Positives = 135/255 (52%), Gaps = 7/255 (2%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
            P+  +YE K K IY   +P   +  +KDD    N  +  ++ GKG +N  +S ++F  L
Sbjct: 4   SPQELLYEGKAKRIYRTADPRVYLCQYKDDATAFNAQKRGSIAGKGEVNCTVSSHVFAYL 63

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            + GIP++F+ +    E  VR + ++PL + VRN  AGSL +RL + +GL +   LVEFY
Sbjct: 64  AQQGIPNHFLAQTGPTEMQVRALHILPLEVVVRNRTAGSLCQRLGLEQGLPIEPPLVEFY 123

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D+    LV+ +HI   + A   +VE++ +L++ +N  +   +    ++LVDF+++ G
Sbjct: 124 YKNDALGDPLVTPDHIRLLHLATPEQVEKLGSLALAVNTHLGNFWRRCRLELVDFKLEFG 183

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEE--CDKKRFSKSNDQLLEGYSEVARRLGIF 239
                +  +I LADEI PD CRLWDL   E    DK  F         GY EV +R  + 
Sbjct: 184 LD---EEGQIWLADEISPDTCRLWDLQGTEPRVLDKDLFRFDLGDPAAGYQEVLQR--VL 238

Query: 240 KKNEPALKENLILNR 254
           +  +P L       R
Sbjct: 239 QATDPNLPSPAARER 253


>gi|294102151|ref|YP_003554009.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Aminobacterium colombiense DSM 12261]
 gi|293617131|gb|ADE57285.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Aminobacterium colombiense DSM 12261]
          Length = 239

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 88/236 (37%), Positives = 138/236 (58%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K +Y+  +P  +I  +K+D    N  +  ++ GKG LNN IS  +F  
Sbjct: 1   MVKKELLYEGKAKKMYKTDDPNMIIVEYKNDLTAFNALKKDSIEGKGSLNNAISASLFEY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           + + GIP++FI++I+   Q+V+ V ++P+ + VRN   G+L KRL I E + LPR L+EF
Sbjct: 61  MNENGIPNHFIQKIDDTHQIVKKVRILPVEVVVRNITTGTLCKRLGIEENIRLPRPLIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     L+ E+H   F WA + ++  M   S+++N  M+  F  +NI LVDF+++ 
Sbjct: 121 YYKNDQLGDPLILEDHAELFGWATKEQISFMKETSLKVNTLMSAYFDTLNIILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G   +     I+LADE+ PD CR WD +  ++ DK RF K    +L  Y E+ RR+
Sbjct: 181 GVDAN---GTILLADEMSPDTCRFWDKTTMKKLDKDRFRKDLGDVLGAYREIWRRI 233


>gi|89101012|ref|ZP_01173855.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           sp. NRRL B-14911]
 gi|89084273|gb|EAR63431.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           sp. NRRL B-14911]
          Length = 239

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 86/237 (36%), Positives = 135/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +Y   +   +   +KD     N  + A + GKG LNN I+  +F++
Sbjct: 1   MEKRAQLYEGKAKKVYLTDDENIVWLEYKDSATAFNGEKKAEIAGKGRLNNEITSLLFSE 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI  +FI +++  EQLV+ VE+IP+ + VRN AAGS+AKRL + EG  L ++LVEF
Sbjct: 61  LHKKGISSHFIEKVSATEQLVQKVEIIPIEVVVRNVAAGSMAKRLGMEEGALLKKTLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y   DS    +++++H+     A+  E   +   ++ +N F++  F  + I+L+DF+++ 
Sbjct: 121 YLKDDSLGDPIMTDDHVIELELASPEEAALLKRKALEVNAFLSSFFKEMGIRLIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G+        I+LADEI PD CRLWD+    + DK  F +    L + Y  +  RLG
Sbjct: 181 GKN---AAGDILLADEISPDTCRLWDMETNAKLDKDVFRRDLGSLTDAYENILTRLG 234


>gi|308172530|ref|YP_003919235.1| phosphoribosylaminoimidazole succinocarboxamide synthetase
           [Bacillus amyloliquefaciens DSM 7]
 gi|307605394|emb|CBI41765.1| phosphoribosylaminoimidazole succinocarboxamide synthetase
           [Bacillus amyloliquefaciens DSM 7]
          Length = 239

 Score =  246 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 89/236 (37%), Positives = 139/236 (58%), Gaps = 3/236 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
              N +YE K K IY+  +   L   +KD     N  + A + GKG LNN IS  +F  L
Sbjct: 4   AKNNLLYEGKAKRIYQTEDEQILRVVYKDSATAFNGEKKAEITGKGRLNNEISSLIFKHL 63

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
              GI ++F+ R++  EQL++ V +IPL + VRN AAG ++KRL IPEG  LP+ ++EFY
Sbjct: 64  HAKGIDNHFVERVSESEQLIKKVSIIPLEVVVRNIAAGGMSKRLGIPEGTELPQPIIEFY 123

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D+    L++E+HI     A+  +VE + +++ ++N  +  +F    ++L+DF+++ G
Sbjct: 124 YKDDALGDPLITEDHIWLLKAASSEQVETIKSITRQVNKELQHIFEDCGVRLIDFKLEFG 183

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
              +    R++LADEI PD CRLWD    E+ DK  F ++   L + Y E+ +RLG
Sbjct: 184 LDAE---GRVLLADEISPDTCRLWDKDTNEKLDKDLFRRNLGSLTDAYEEIFKRLG 236


>gi|262038152|ref|ZP_06011550.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Leptotrichia goodfellowii F0264]
 gi|261747835|gb|EEY35276.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Leptotrichia goodfellowii F0264]
          Length = 235

 Score =  246 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 80/237 (33%), Positives = 125/237 (52%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K +Y   +   +I  +KDD    N  +  T+  KG++NN+I+  +F+ 
Sbjct: 1   MEKKEFIYEGKAKQVYSTDDENLVIIHYKDDATAGNGVKKGTIKDKGIINNKITAKLFSV 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI  +F   +N R+QL   +E++PL + VRN   GS+AKR+ I +G     ++ E 
Sbjct: 61  LEKNGIRTHFKEMLNERDQLCEKLEIVPLEVIVRNVITGSMAKRVGIKDGTIPKTTIFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A       E++ +   + +IND +  +F    I LVDF+I+ 
Sbjct: 121 CYKNDEYGDPLINDYHAVAMGLTTFDELKYIYETTSKINDLLKKVFDEEGITLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G+        I+LADEI PD CRLWD    ++ DK RF +    + E Y E+  RL 
Sbjct: 181 GKN---SKGEILLADEITPDTCRLWDKETGKKLDKDRFRQDLGGIEEAYIEILNRLE 234


>gi|302390056|ref|YP_003825877.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermosediminibacter oceani DSM 16646]
 gi|302200684|gb|ADL08254.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermosediminibacter oceani DSM 16646]
          Length = 234

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 87/238 (36%), Positives = 134/238 (56%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K +Y   +    +  FKDD    N  +  T+  KG LNN+IS  +F  
Sbjct: 1   MKKTAMIYEGKAKKVYRTDDDKLFVMEFKDDATAFNGQKRGTIRDKGELNNKISAVLFEI 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI  +F++ ++ RE LV+ V+++PL + VRN AAGS+AKRL + EGL L R ++EF
Sbjct: 61  LEKNGIKTHFVKLLSDREMLVKAVKILPLEVIVRNIAAGSMAKRLGLEEGLELKRPVLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     +++  H+ A + A + E+  +   S+R+N+ +    +   I LVDF+++ 
Sbjct: 121 CYKSDELGDPMINAYHVLAMDLAAEDEIRFIEETSLRVNEILKEYLIKKGIVLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR        I+LADEI PD CR WD   +E+ DK RF +    + E Y E+  R+ +
Sbjct: 181 GRF----DGEILLADEISPDTCRFWDAKTREKLDKDRFRRDLGGVEEAYREILSRVKV 234


>gi|194016039|ref|ZP_03054654.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           pumilus ATCC 7061]
 gi|194012394|gb|EDW21961.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           pumilus ATCC 7061]
          Length = 240

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 90/235 (38%), Positives = 141/235 (60%), Gaps = 3/235 (1%)

Query: 3   PRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLG 62
            +  +YE K K IY+  +   L   +KD     N  + A + GKG LNN IS  +F  L 
Sbjct: 4   KQELLYEGKAKKIYQTDDEQILYVEYKDSATAFNGEKKAEIEGKGRLNNEISSLIFQMLH 63

Query: 63  KIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYY 122
           + GI ++F++R++  EQL++ V+++PL + VRN  AGS++KRL IPEG  L   L+EFYY
Sbjct: 64  EKGINNHFVKRLSETEQLIQKVQIVPLEVVVRNVVAGSMSKRLGIPEGTKLDTPLIEFYY 123

Query: 123 LPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGR 182
             D+    L++E+HI   + A   +VEEM  ++ ++N+ +  +F   ++ L+DF+++ G 
Sbjct: 124 KDDALGDPLITEDHIRILDAATPEQVEEMKQITRQVNEELKQIFSDCHVNLIDFKLEFGI 183

Query: 183 LLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
             ++   RI+LADEI PD CRLWD    E+ DK  F ++   L   Y E+ +RLG
Sbjct: 184 DHEN---RILLADEISPDTCRLWDKDTNEKLDKDVFRRNLGGLTNAYEEIFKRLG 235


>gi|205372439|ref|ZP_03225252.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           coahuilensis m4-4]
          Length = 241

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 94/237 (39%), Positives = 135/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K I+      T+   +K+     N  + A + GK  LNN I+  +F +
Sbjct: 1   MEKGQLLYEGKAKRIFATDNQETVWIEYKNSATAFNGEKKAEIQGKARLNNEITSLLFEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +FI+RI+  EQ+V+ V +IPL + VRN AAGSLAKR+   EG  LP ++VEF
Sbjct: 61  LKEKGIQSHFIKRISSTEQVVKRVSIIPLEVVVRNIAAGSLAKRIGWEEGTELPCTIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     L+++EHI+    A   E+  +  + +++ND +  LFL I I LVDF+++ 
Sbjct: 121 YYKDDELGDPLLTDEHISLVGVATPEELGRLRDMGLQVNDVLQELFLEIGITLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G+    +   I+LADEI PD CRLWD    E+ DK  F +    L E YS +  RLG
Sbjct: 181 GKD---EKGNILLADEISPDTCRLWDKETNEKLDKDVFRRDLGSLTEVYSIILSRLG 234


>gi|77165980|ref|YP_344505.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nitrosococcus oceani ATCC 19707]
 gi|254436337|ref|ZP_05049843.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nitrosococcus oceani AFC27]
 gi|123593572|sp|Q3J871|PUR7_NITOC RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|76884294|gb|ABA58975.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nitrosococcus oceani ATCC 19707]
 gi|207088027|gb|EDZ65300.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nitrosococcus oceani AFC27]
          Length = 238

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 87/237 (36%), Positives = 137/237 (57%), Gaps = 4/237 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
           + ++ +Y  K K +Y   +P  LI +F+DD    +  +    + KG +NN+ + ++  +L
Sbjct: 4   KKQSELYSGKAKTVYITDDPTQLILYFRDDTSAFDGKKIERFSRKGEINNKFNAFIMEKL 63

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
              GIP +F R ++ +E LV+ +EM P+   VRN A GSL +RL + +GL L   + EF+
Sbjct: 64  AAAGIPTHFERLLSEQESLVKRLEMFPIECVVRNIATGSLCRRLGVQDGLDLDPPVFEFF 123

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
              D+    +++E HI  F WAN  +VE+M   + RIND +  LFL   + LVD++++ G
Sbjct: 124 LKDDARHDPMINEYHIRTFGWANPKQVEQMKEYTFRINDILKVLFLEAGLLLVDYKLEFG 183

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
               D   +++L DE  PD CRLWD+  +E+ DK RF      + E Y EVARRLG+
Sbjct: 184 ----DVQGQVLLGDEFTPDGCRLWDVKTREKLDKDRFRHGLGGVTEAYEEVARRLGM 236


>gi|150015941|ref|YP_001308195.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium beijerinckii NCIMB 8052]
 gi|189038236|sp|A6LSA9|PUR7_CLOB8 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|149902406|gb|ABR33239.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium beijerinckii NCIMB 8052]
          Length = 235

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 86/236 (36%), Positives = 132/236 (55%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K IY   +   +I ++KDD    N  +   +  KG++NN I+  +F  
Sbjct: 1   MEKLEMLYEGKAKKIYATDKADEVIVYYKDDATAFNGEKKGQIEDKGIMNNAITSVLFEI 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+  +FI ++N REQL + VE++PL + VRN AAGS+AKRL + EG  L  ++ E 
Sbjct: 61  LEKAGVKTHFIEKLNDREQLCKKVEIVPLEVIVRNVAAGSMAKRLGLEEGFKLKTTVFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  DS    L+++ H          E++ +  ++ +IND +  +F   NI L+DF+++ 
Sbjct: 121 SYKDDSLGDPLINDYHAVGIGATTFEELKVIYDMTAKINDTLKAVFKEQNINLIDFKVEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR  D     IVLADEI PD CR WD +  E+ DK RF +    + + Y E+ +R+
Sbjct: 181 GRCAD---GTIVLADEISPDTCRFWDATTGEKLDKDRFRRDLGNVKDAYVEILKRI 233


>gi|34763395|ref|ZP_00144346.1| Phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Fusobacterium nucleatum subsp. vincentii ATCC 49256]
 gi|27886940|gb|EAA24061.1| Phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Fusobacterium nucleatum subsp. vincentii ATCC 49256]
          Length = 239

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 86/236 (36%), Positives = 131/236 (55%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +YE  +   +I  +KDD    N  +  T++ KG++NN I+  +F  
Sbjct: 3   MEKGKFIYEGKAKQLYETDDKDLVIVHYKDDATAGNGAKKGTIHNKGIMNNEITTLIFNM 62

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K  I  +F++++N R+QL + V++ PL + VRN  AGS+AKRL I EG  +  ++ E 
Sbjct: 63  LEKNEIKTHFVKKLNDRDQLCQRVKIFPLEVIVRNIIAGSMAKRLGIKEGTKINNTIFEI 122

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A   A   E+ ++  ++ +IN+ +   F  I I LVDF+I+ 
Sbjct: 123 CYKNDEYGDPLINDHHAVALGIATYDELNKIYEITAKINNLLKEKFNKIGITLVDFKIEF 182

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+        I+LADEI PD CRLWD    E+ DK RF +    + E Y EV +RL
Sbjct: 183 GKN---SKGEILLADEITPDTCRLWDKKTGEKLDKDRFRRDLGNIEEAYIEVVKRL 235


>gi|300113314|ref|YP_003759889.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nitrosococcus watsonii C-113]
 gi|299539251|gb|ADJ27568.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nitrosococcus watsonii C-113]
          Length = 238

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 87/237 (36%), Positives = 136/237 (57%), Gaps = 4/237 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
           + ++ +Y  K K +Y   +P  LI  F+DD    +  +   L+ KG +NN+ + ++  +L
Sbjct: 4   KKQSELYSGKAKTVYTTDDPTLLILHFRDDTSAFDGKKIEQLSRKGEINNKFNAFIMEKL 63

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
              GIP +F R ++ +E LV+ +EM P+   VRN A GSL +RL + +GL L   + EF+
Sbjct: 64  AAAGIPTHFERLLSGQESLVKRLEMFPIECVVRNIATGSLCRRLGVQDGLDLVPPVFEFF 123

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
              D+    +++E HI  F WAN  +VE M   + +IND +  LFL   + LVD++++ G
Sbjct: 124 LKDDARHDPMINEYHIRTFGWANLEQVERMKEYTFKINDILKVLFLEAELLLVDYKLEFG 183

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
               D   +++L DE  PD CRLWD+  +E+ DK RF      + E Y EVARRLG+
Sbjct: 184 ----DARGQVLLGDEFTPDGCRLWDVETREKLDKDRFRHGLGGVTEAYEEVARRLGM 236


>gi|311067118|ref|YP_003972041.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           atrophaeus 1942]
 gi|310867635|gb|ADP31110.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           atrophaeus 1942]
          Length = 238

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 88/235 (37%), Positives = 140/235 (59%), Gaps = 3/235 (1%)

Query: 3   PRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLG 62
            +  +YE K K IY+  +  TL   +KD     N  + A ++GKG LNN IS  +F  L 
Sbjct: 5   KKELLYEGKAKRIYKTDDENTLYVVYKDSATAFNGEKKAEISGKGRLNNEISSLIFKYLH 64

Query: 63  KIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYY 122
             GI ++F+ RI+  EQL++ V ++PL + VRN  AGS++KRL IPEG  L + ++EFYY
Sbjct: 65  DKGINNHFVERISETEQLIQKVTIVPLEVVVRNVVAGSMSKRLGIPEGTELEQPIIEFYY 124

Query: 123 LPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGR 182
             D+    L++E+HI     A   +VE++ +++  +N  +  +F   N++L+DF+++ G 
Sbjct: 125 KDDALGDPLITEDHIWLLKAATPEQVEKIKSITKTVNKELQVIFNDCNVRLIDFKLEFGL 184

Query: 183 LLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
             +    +++LADEI PD CRLWD    E+ DK  F ++   L + Y E+ +RLG
Sbjct: 185 DTE---GQVLLADEISPDTCRLWDKDTNEKLDKDVFRRNLGGLTDAYEEIFKRLG 236


>gi|37526634|ref|NP_929978.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|39931727|sp|Q7N3H3|PUR7_PHOLL RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|36786066|emb|CAE15118.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           (5'-phosphoribosyl-5-aminoimidazole-4-N-
           succinocarboxamide synthase) [Photorhabdus luminescens
           subsp. laumondii TTO1]
          Length = 237

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 82/241 (34%), Positives = 134/241 (55%), Gaps = 4/241 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y   +P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKKAELYRGKAKTVYTTDDPDLLVLEFRNDTSALDGERIEQFDRKGMVNNKFNHFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   VRN AAGSL +RL I EGL L   L + 
Sbjct: 61  LAEAGIPTQMERLLSDTEVLVKKLDMVPVECVVRNRAAGSLVRRLGIEEGLVLNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  + EM  LS++ N+ ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAKHDPMVNESYCETFGWVSKEHLAEMKELSLKANEVLSKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           G        +IVL DE  PD  RLWD    ++ DK RF +S   L+E Y EVARR+G+  
Sbjct: 181 GLF----KGQIVLGDEFSPDGSRLWDKETLDKMDKDRFRQSLGGLIEAYEEVARRIGVIL 236

Query: 241 K 241
            
Sbjct: 237 D 237


>gi|323706018|ref|ZP_08117588.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534632|gb|EGB24413.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 235

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 96/237 (40%), Positives = 135/237 (56%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M   N +YE K K +Y+  +    I  +KDD    N  +  T+  KGVLNN IS  +F  
Sbjct: 1   MEKLNMLYEGKAKKVYKTTDEDYYIIEYKDDATAFNGIKKGTIQNKGVLNNEISAILFEL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GIP ++++++N RE LV+  ++ P+ + +RN AAGS++KRL I EG  L R+++EF
Sbjct: 61  LEKEGIPTHYVKKLNDREMLVKSAKIYPIEVLIRNYAAGSISKRLGIEEGTKLKRTVLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D      ++E HI A   A + EVE +   S +IND ++  F   NI LVDF+++ 
Sbjct: 121 CYKNDELGDPFINEYHIEAMELATKEEVETIKEYSFKINDILSKFFTSKNIILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G+  D     IVLADEI PD CR WD   KE+ DK RF +    +   Y EV  RL 
Sbjct: 181 GKSKDG----IVLADEISPDTCRFWDSVTKEKLDKDRFRRDLGNVEGAYVEVLNRLE 233


>gi|16077713|ref|NP_388527.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           subtilis subsp. subtilis str. 168]
 gi|221308481|ref|ZP_03590328.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           subtilis subsp. subtilis str. 168]
 gi|221312803|ref|ZP_03594608.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           subtilis subsp. subtilis str. NCIB 3610]
 gi|221317727|ref|ZP_03599021.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           subtilis subsp. subtilis str. JH642]
 gi|221322005|ref|ZP_03603299.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           subtilis subsp. subtilis str. SMY]
 gi|131631|sp|P12046|PUR7_BACSU RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase; AltName:
           Full=Vegetative protein 286A; Short=VEG286A
 gi|143367|gb|AAA22677.1| phosphoribosyl aminoidazole succinocarboxamide synthetase (PUR-C;
           gtg start codon) [Bacillus subtilis]
 gi|2632959|emb|CAB12465.1| phosphoribosylaminoimidazole succinocarboxamide synthetase
           [Bacillus subtilis subsp. subtilis str. 168]
          Length = 241

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 88/238 (36%), Positives = 138/238 (57%), Gaps = 3/238 (1%)

Query: 3   PRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLG 62
               +YE K K IY+  +  TL   +KD     N  + A ++GKG LNN IS  +F  L 
Sbjct: 5   KNELLYEGKAKKIYKTDDENTLYVVYKDSATAFNGEKKAEISGKGRLNNEISSLIFKHLH 64

Query: 63  KIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYY 122
             GI ++FI RI+  EQL++ V ++PL + VRN  AGS++KRL IPEG  L + ++EFYY
Sbjct: 65  AKGINNHFIERISETEQLIKKVTIVPLEVVVRNVVAGSMSKRLGIPEGTELEQPIIEFYY 124

Query: 123 LPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGR 182
             D+    L++E+HI     A   +VE + +++  +N+ +  +F   +++L+DF+++ G 
Sbjct: 125 KDDALGDPLITEDHIWLLKAATPEQVETIKSITTIVNEELQSIFDDCHVRLIDFKLEFGL 184

Query: 183 LLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
             +    +++LADEI PD CRLWD    E+ DK  F ++   L + Y E+  RLG   
Sbjct: 185 DAE---GQVLLADEISPDTCRLWDKETNEKLDKDLFRRNLGSLTDAYEEIFNRLGGIH 239


>gi|260655581|ref|ZP_05861069.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Jonquetella anthropi E3_33 E1]
 gi|260630029|gb|EEX48223.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Jonquetella anthropi E3_33 E1]
          Length = 251

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 88/232 (37%), Positives = 134/232 (57%), Gaps = 3/232 (1%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K K I+   +P  L+  +KD     N  +     GKG LNN IS ++FT L K 
Sbjct: 16  ELLYEGKAKKIFSTDDPNVLLVQYKDSLTAFNAKKRDEKAGKGHLNNVISSWIFTWLAKK 75

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
           G+  +FI++++   QL+R VE+IPL   VRN   GSL +RL + EG  L R ++EF Y  
Sbjct: 76  GVESHFIKQVDETHQLIRKVEIIPLETIVRNVTTGSLCRRLGVEEGKKLSRPIIEFSYKS 135

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D+ +  L++++H     WA + EV  + ++++++N  +T LF  + + LVDF+++ GR  
Sbjct: 136 DALDDPLINDDHAIVLGWATEEEVATIKSIALKVNKLLTELFASVGVLLVDFKLEFGRD- 194

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
             +  R++LADEI PD CR WD    +  DK RF K    +L  Y E+ RRL
Sbjct: 195 --EKGRVLLADEISPDTCRFWDSKTHDHLDKDRFRKDLGDVLGAYEEIWRRL 244


>gi|256845267|ref|ZP_05550725.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fusobacterium sp. 3_1_36A2]
 gi|256718826|gb|EEU32381.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fusobacterium sp. 3_1_36A2]
          Length = 237

 Score =  245 bits (626), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 86/236 (36%), Positives = 132/236 (55%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +YE  +   +I  +KDD    N  +  T++ KG++NN I+  +F  
Sbjct: 1   MEKGKFIYEGKAKQLYETDDKDLVIVHYKDDATAGNGAKKGTIHNKGIMNNEITTLIFNM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K  I  +F++++N R+QL + V++ PL + VRN  AGS+AKRL I EG  +  ++ E 
Sbjct: 61  LEKNEIKTHFVKKLNDRDQLCQRVKIFPLEVIVRNIIAGSMAKRLGIKEGTKINNTIFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A   A   E++++  ++ +IN+ +   F  I I LVDF+I+ 
Sbjct: 121 CYKNDEYGDPLINDHHAVALGIATYDELKKIYEITAKINNLLKEKFDKIGITLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+        I+LADEI PD CRLWD    E+ DK RF +    + E Y EV +RL
Sbjct: 181 GKN---SKGEILLADEITPDTCRLWDKKTGEKLDKDRFRRDLGNIEEAYIEVVKRL 233


>gi|223986141|ref|ZP_03636163.1| hypothetical protein HOLDEFILI_03471 [Holdemania filiformis DSM
           12042]
 gi|223961899|gb|EEF66389.1| hypothetical protein HOLDEFILI_03471 [Holdemania filiformis DSM
           12042]
          Length = 240

 Score =  245 bits (626), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 76/239 (31%), Positives = 132/239 (55%), Gaps = 3/239 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +Y   +P  +I  +KDD    N  +  ++  KGVLNN+I+  +F +
Sbjct: 1   MEKLEMMYEGKAKQVYATDDPDRVIIHYKDDATAFNGLKKDSIRNKGVLNNKITTILFAE 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  ++I  +N R+QL + V ++PL + VRN  AGS+AK+  I EG  L   + E 
Sbjct: 61  LNRRGIATHWIETLNDRDQLCKKVRIVPLEVIVRNVVAGSMAKKFGIDEGTELKTPVYEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     ++++ H      A + E++++ A++ ++N+ +  +   I I+L+DF+++ 
Sbjct: 121 CYKNDELGDPMINDTHAVGLGLATREELDQIYAITAQVNEALKEILDQIGIRLIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
           G+       R++LADEI PD CR W+    ++ DK RF +    ++  Y E+  RL  +
Sbjct: 181 GKD---STGRVLLADEISPDTCRFWEKGTDKKLDKDRFRRDMGDVIGAYEEIYGRLSQW 236


>gi|30260464|ref|NP_842841.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis str. Ames]
 gi|47525554|ref|YP_016903.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis str. 'Ames Ancestor']
 gi|49183306|ref|YP_026558.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis str. Sterne]
 gi|65317716|ref|ZP_00390675.1| COG0152: Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR)
           synthase [Bacillus anthracis str. A2012]
 gi|165871359|ref|ZP_02216007.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis str. A0488]
 gi|167634193|ref|ZP_02392515.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis str. A0442]
 gi|167640165|ref|ZP_02398432.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis str. A0193]
 gi|170688344|ref|ZP_02879553.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis str. A0465]
 gi|170708749|ref|ZP_02899186.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis str. A0389]
 gi|177653698|ref|ZP_02935837.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis str. A0174]
 gi|190567409|ref|ZP_03020323.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis Tsiankovskii-I]
 gi|190567556|ref|ZP_03020469.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis Tsiankovskii-I]
 gi|196040089|ref|ZP_03107391.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Bacillus
           cereus NVH0597-99]
 gi|196045322|ref|ZP_03112554.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus 03BB108]
 gi|225862330|ref|YP_002747708.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus 03BB102]
 gi|227812956|ref|YP_002812965.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis str. CDC 684]
 gi|228931781|ref|ZP_04094678.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|229182674|ref|ZP_04309915.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus BGSC 6E1]
 gi|229601459|ref|YP_002864909.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Bacillus
           anthracis str. A0248]
 gi|254686675|ref|ZP_05150533.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis str. CNEVA-9066]
 gi|254724751|ref|ZP_05186534.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis str. A1055]
 gi|254739100|ref|ZP_05196802.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis str. Western North America USA6153]
 gi|254742278|ref|ZP_05199964.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis str. Kruger B]
 gi|254756054|ref|ZP_05208083.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis str. Vollum]
 gi|254761871|ref|ZP_05213720.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis str. Australia 94]
 gi|301052003|ref|YP_003790214.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Bacillus
           anthracis CI]
 gi|39931875|sp|Q81ZH5|PUR7_BACAN RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|254783933|sp|C3PBM7|PUR7_BACAA RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|254783934|sp|C3L529|PUR7_BACAC RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|254783935|sp|C1EV60|PUR7_BACC3 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|30253832|gb|AAP24327.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Bacillus
           anthracis str. Ames]
 gi|47500702|gb|AAT29378.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis str. 'Ames Ancestor']
 gi|49177233|gb|AAT52609.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis str. Sterne]
 gi|164712843|gb|EDR18372.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis str. A0488]
 gi|167511976|gb|EDR87355.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis str. A0193]
 gi|167530507|gb|EDR93222.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis str. A0442]
 gi|170126328|gb|EDS95218.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis str. A0389]
 gi|170667676|gb|EDT18430.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis str. A0465]
 gi|172081278|gb|EDT66353.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis str. A0174]
 gi|190561343|gb|EDV15315.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis Tsiankovskii-I]
 gi|190561536|gb|EDV15507.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           anthracis Tsiankovskii-I]
 gi|196023906|gb|EDX62581.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus 03BB108]
 gi|196028944|gb|EDX67549.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Bacillus
           cereus NVH0597-99]
 gi|225786998|gb|ACO27215.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Bacillus
           cereus 03BB102]
 gi|227005117|gb|ACP14860.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Bacillus
           anthracis str. CDC 684]
 gi|228600759|gb|EEK58338.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           cereus BGSC 6E1]
 gi|228827881|gb|EEM73618.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|229265867|gb|ACQ47504.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Bacillus
           anthracis str. A0248]
 gi|300374172|gb|ADK03076.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Bacillus
           cereus biovar anthracis str. CI]
          Length = 239

 Score =  245 bits (626), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 88/237 (37%), Positives = 133/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY       +   +KD     N  +  T+ GKG LNN I+  +F +
Sbjct: 1   MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITGKGRLNNEITTLLFRK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L ++GI  +F+ +++  EQLV+ V +IPL +  RN  AGSL+KRL + EG  L   +VEF
Sbjct: 61  LQEVGIKTHFVEKLSETEQLVKKVSIIPLEVVTRNVIAGSLSKRLGMEEGTVLAEPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  D     LV+E+HI   N A+  +V  +  ++++IN  +   F    ++LVDF+++ 
Sbjct: 121 YFKDDDLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVLIDHFASCRVRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G     D   I+LADEI PD CRLWD +  E+ DK  F +    L + Y E+ +RLG
Sbjct: 181 GVT---DEGAIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNLTDAYEEILKRLG 234


>gi|134300208|ref|YP_001113704.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfotomaculum reducens MI-1]
 gi|172044324|sp|A4J726|PUR7_DESRM RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|134052908|gb|ABO50879.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfotomaculum reducens MI-1]
          Length = 236

 Score =  245 bits (626), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 79/236 (33%), Positives = 131/236 (55%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +Y    P      +KDD    N  +  T++ KGV+NN++S   F  
Sbjct: 1   MEKLEMIYEGKAKKVYRTDNPDFYWVEYKDDATAFNGQKKGTIDNKGVVNNKVSAVFFKL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           +   GI  +F+  +N RE +V+ +++I + + VRN  AG+LAKR+ +PEG  LP++++E+
Sbjct: 61  MESKGITTHFVELVNDREMIVKALDIIKVEVVVRNIVAGTLAKRVGLPEGTILPKTVLEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    L++  HI A + A   ++  +   ++++ND M      +NI L+D++++ 
Sbjct: 121 YYKDDNLGDPLINASHIAALDLATPEQMAFIKETALKVNDIMREYLAPVNIDLIDYKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G        +++L DEI PD CR WD +  E+ DK RF +    +   Y EV RRL
Sbjct: 181 GL----HKGQVLLGDEISPDTCRFWDKTTGEKLDKDRFRRDLGNVEGAYQEVLRRL 232


>gi|148653923|ref|YP_001281016.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Psychrobacter sp. PRwf-1]
 gi|259546908|sp|A5WHC5|PUR7_PSYWF RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|148573007|gb|ABQ95066.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Psychrobacter sp. PRwf-1]
          Length = 239

 Score =  245 bits (626), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 85/237 (35%), Positives = 134/237 (56%), Gaps = 4/237 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
           + ++ +Y+ K K +YE      LI  F+DD    N  R   L  KG +NNR + ++  +L
Sbjct: 4   QKQDLLYKGKAKSVYETENSDYLILHFRDDTSAFNGERIEQLGRKGQVNNRFNAFIMQKL 63

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            + GI  +F ++++  E LV+ +EMIP+   VRN AAGSL +RL + EG  L     E +
Sbjct: 64  AEAGIETHFEKQLSDDEVLVKRLEMIPVECVVRNFAAGSLVRRLGLEEGQPLTPPTYELF 123

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           +  D+    +V+E    +  WA   ++ +M  L+ ++ND +  LF    + LVDF+++ G
Sbjct: 124 FKDDALGDPMVNESLSVSLGWATPEQLAKMKELTFKVNDVLKELFDAGGLMLVDFKLEFG 183

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
              D    RIVL DE  PD CR+WD   K++ DK RF +S   ++E Y EVA+R+G+
Sbjct: 184 VFQD----RIVLGDEFSPDGCRIWDKETKKKLDKDRFRQSLGDVIESYEEVAQRIGV 236


>gi|150388748|ref|YP_001318797.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Alkaliphilus metalliredigens QYMF]
 gi|149948610|gb|ABR47138.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Alkaliphilus metalliredigens QYMF]
          Length = 236

 Score =  245 bits (626), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 85/235 (36%), Positives = 139/235 (59%), Gaps = 4/235 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
                +YE K K +Y       +I  +KDD    N  +  T+  KG++NN++S  +F  L
Sbjct: 5   EKLEMLYEGKAKKVYGTQNVDQVIVEYKDDATAFNGEKKGTIETKGIVNNQMSAIIFEML 64

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
             +GI ++F++ ++ RE LV+ V+++P+ + +RN AAGS+AKRL I EG  L  +++EF 
Sbjct: 65  TTMGIENHFVKLLSEREMLVKSVKILPVEVIIRNIAAGSMAKRLGIEEGHVLKSTVLEFC 124

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     L++E HI A  +A + E+E + A++ +IN+ +   FL  +++LVDF+++ G
Sbjct: 125 YKNDELGDPLINEYHIEALGFATKEEIESIKAMTFQINEILKEFFLTKDLKLVDFKLEFG 184

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
                    ++LADE+ PD CRLWD+   E+ DK RF +    + E Y E+ RRL
Sbjct: 185 LY----KGMVILADEVSPDTCRLWDVHTNEKLDKDRFRRDLGNVKEAYEEILRRL 235


>gi|258514045|ref|YP_003190267.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Desulfotomaculum acetoxidans DSM 771]
 gi|257777750|gb|ACV61644.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Desulfotomaculum acetoxidans DSM 771]
          Length = 246

 Score =  245 bits (626), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 81/236 (34%), Positives = 126/236 (53%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K +Y+   P      FKDD    N  +  T++ KGVLN +IS Y F  
Sbjct: 1   MQKLQMLYEGKAKRVYKTDHPECFWVEFKDDATAFNGAKKGTIDNKGVLNTQISAYFFNL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP +F+     R+ +V+ ++++ + + VRN AAGSL+KR+ +PEG  L   +VEF
Sbjct: 61  LAEKGIPSHFVSLQGDRDMIVKALKILMVEVVVRNIAAGSLSKRVGLPEGTLLDFPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  DS    L++++H      A   +++ M    +++N  +       +I LVDF+++ 
Sbjct: 121 YYKNDSLNDPLINDDHARVLKLATPEQLQLMRQTGLQVNRILLEHLSDKDIYLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G        + +L DEI PD CR WD    E+ DK RF +    +   Y E+ RRL
Sbjct: 181 GI----HNGKFLLGDEISPDTCRFWDKHTGEKLDKDRFRRDLGDVEAAYREIYRRL 232


>gi|257058271|ref|YP_003136159.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cyanothece sp. PCC 8802]
 gi|256588437|gb|ACU99323.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cyanothece sp. PCC 8802]
          Length = 243

 Score =  245 bits (626), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 85/236 (36%), Positives = 127/236 (53%), Gaps = 7/236 (2%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K KI+Y   +P  L+  FKDD    N  +  T+ GKG +N  IS  +F  LG  
Sbjct: 2   EKLYEGKAKILYTTEDPEILLTQFKDDATAFNALKRGTIQGKGEINCAISSALFQWLGTK 61

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
           GI  +FI +    +  VR V++IPL + VRN AAGSL ++  +PEG  LP  LVEFY   
Sbjct: 62  GITTHFIDQPAPTQMRVRAVKIIPLEVVVRNIAAGSLCRQTGLPEGKILPFPLVEFYLKN 121

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D     L++ + +     A   ++E++  L+ +IN ++   F    I LVDF+++ G   
Sbjct: 122 DELGDPLLTRDRLLILELATAEQLEQLQTLAQQINQYLREFFATCQITLVDFKLEFGLD- 180

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEE----CDKKRFSKSNDQLLEGYSEVARRL 236
                +++LADEI PD CRLWD  K +      DK RF +   ++   Y +V +R+
Sbjct: 181 --SQGKLLLADEISPDTCRLWDQQKNDPQERVLDKDRFRRDLGEVESAYQQVQQRV 234


>gi|297172464|gb|ADI23437.1| phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [uncultured gamma proteobacterium HF0770_33G18]
          Length = 242

 Score =  245 bits (625), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 86/238 (36%), Positives = 135/238 (56%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+   P+Y  K K ++    P  L+  F+DD    +  R   L+ KG +NNR + ++  +
Sbjct: 1   MKKTGPLYSGKAKSVFLTENPKLLVMEFRDDTSAFDGERIEKLDRKGTVNNRFNAFVLEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+  +F + ++  E LV+ +EMIP+   +RN A GSL KR  I +GL L     EF
Sbjct: 61  LESTGVATHFEKLLSDTESLVKRLEMIPVECVIRNIATGSLCKRYGIDDGLELDPPTFEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    L+++ HI +F WA+ +EVE M  ++ R+ND +  LF    + LVDF+++ 
Sbjct: 121 FLKDDARHDPLINDYHIESFGWASPAEVEVMKKVTFRVNDVLGELFRSEGMILVDFKVEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR  D     ++L DE  PD CRLWD+  +++ DK RF +    ++E Y EVA RLG+
Sbjct: 181 GRFGD----ELLLGDEFTPDGCRLWDMETRKKLDKDRFRRGLGGVVEAYEEVAARLGV 234


>gi|294785432|ref|ZP_06750720.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Fusobacterium sp. 3_1_27]
 gi|294487146|gb|EFG34508.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Fusobacterium sp. 3_1_27]
          Length = 237

 Score =  245 bits (625), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 86/236 (36%), Positives = 132/236 (55%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +YE  +   +I  +KDD    N  +  T++ KG++NN I+  +F  
Sbjct: 1   MEKGKFIYEGKAKQLYETDDKDLVIVHYKDDATAGNGAKKGTIHNKGIMNNEITTLIFNM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K  I  +F++++N R+QL + V++ PL + VRN  AGS+AKRL I EG  +  ++ E 
Sbjct: 61  LEKNEIKTHFVKKLNDRDQLCQRVKIFPLEVIVRNIIAGSMAKRLGIKEGTKINNTIFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A   A   E++++  ++ +IN+ +   F  I I LVDF+I+ 
Sbjct: 121 CYKNDEYGDPLINDHHAVALGIATYDELKKIYEITSKINNLLKEKFDKIGITLVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+        I+LADEI PD CRLWD    E+ DK RF +    + E Y EV +RL
Sbjct: 181 GKN---SKGEILLADEITPDTCRLWDKKTGEKLDKDRFRRDLGNIEEAYIEVVKRL 233


>gi|313896330|ref|ZP_07829883.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Selenomonas sp. oral taxon 137 str. F0430]
 gi|312975129|gb|EFR40591.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 248

 Score =  245 bits (625), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 82/236 (34%), Positives = 137/236 (58%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K KI+Y    P  ++ ++KDD    N  +  T+  KG++NN+++ + F  
Sbjct: 12  MERKEALYEGKAKIMYATDRPDEILVYYKDDATAGNGAKKGTIAHKGIMNNKMTAFFFDL 71

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+ H++I   + RE LV+ + +IPL + +RN AAGSLA+RL + EG+ +P  ++E+
Sbjct: 72  LAKEGVAHHYISMPSEREMLVKKLTIIPLEVIIRNVAAGSLAQRLGLEEGVPMPFPVIEY 131

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     +++  HI A   A  +E++E+  +S+++ND +T       + L+DF+++ 
Sbjct: 132 CYKNDDLGDPMLNRYHIRAMKIATDAELDEIERISLKVNDVLTKFLKTKRVDLIDFKLEF 191

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+        I+LADEI PD CR WD   KE+ DK RF +    + + Y E+  RL
Sbjct: 192 GKD---AAGHIILADEISPDNCRFWDSDTKEKLDKDRFRRDLGNVEDAYKEMLHRL 244


>gi|328552294|gb|AEB22786.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           amyloliquefaciens TA208]
 gi|328910638|gb|AEB62234.1| phosphoribosylaminoimidazole succinocarboxamide synthetase
           [Bacillus amyloliquefaciens LL3]
          Length = 239

 Score =  245 bits (625), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 89/235 (37%), Positives = 140/235 (59%), Gaps = 3/235 (1%)

Query: 3   PRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLG 62
             N +YE K K IY+  +   L   +KD     N  + A + GKG LNN IS  +F  L 
Sbjct: 5   KSNLLYEGKAKRIYQTEDEQILRVVYKDSATAFNGEKKAEITGKGRLNNEISSLIFKHLH 64

Query: 63  KIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYY 122
             GI ++F+ R++  EQL++ V ++PL + VRN AAGS++KRL IPEG  LP+ ++EFYY
Sbjct: 65  AKGIDNHFVERVSESEQLIKKVSIVPLEVVVRNIAAGSMSKRLGIPEGTELPQPIIEFYY 124

Query: 123 LPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGR 182
             D+    L++E+HI     A+  +VE + +++ ++N  +  +F    ++L+DF+++ G 
Sbjct: 125 KDDALGDPLITEDHIWLLKAASSEQVETIKSITRQVNKELQLIFEDCGVRLIDFKLEFGL 184

Query: 183 LLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
             +    R++LADEI PD CRLWD    E+ DK  F ++   L + Y E+ +RLG
Sbjct: 185 DAE---GRVLLADEISPDTCRLWDKDTNEKLDKDLFRRNLGSLTDAYEEIFKRLG 236


>gi|313893752|ref|ZP_07827318.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Veillonella sp. oral taxon 158 str. F0412]
 gi|313441316|gb|EFR59742.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Veillonella sp. oral taxon 158 str. F0412]
          Length = 242

 Score =  245 bits (625), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 87/235 (37%), Positives = 129/235 (54%), Gaps = 4/235 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
                +YE K K +Y+       I  +KDD    N  +  T+ GKGVLNN+IS + F  L
Sbjct: 7   ETLTLLYEGKAKQVYQTDNKDEYIVHYKDDATAFNGEKHDTILGKGVLNNKISSFFFELL 66

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            K G+P +F+RR + R Q V  +++IPL + VRN AAGS+AKR  I EG  L   ++EF 
Sbjct: 67  KKEGVPTHFVRREDDRNQTVLTLDIIPLEVIVRNIAAGSMAKRFGIEEGTPLKHPILEFC 126

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D       +E  ITA  WA Q +++ ++ +++++ND +       N+ LVDF+++ G
Sbjct: 127 YKNDELGDPFANESQITALGWATQEQLDIISTITLKVNDILKKFLATKNVTLVDFKLEFG 186

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
                    ++L DEI PD CR WD +  E+ DK RF +    + E Y E+  RL
Sbjct: 187 ----THNGEVLLGDEISPDTCRFWDATTGEKLDKDRFRRDLGNIEEAYKEMLFRL 237


>gi|320529172|ref|ZP_08030264.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Selenomonas artemidis F0399]
 gi|320138802|gb|EFW30692.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Selenomonas artemidis F0399]
          Length = 237

 Score =  245 bits (625), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 81/236 (34%), Positives = 138/236 (58%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K KI+Y    P  ++ ++KDD    N  +  T+  KG++NN+++ + F  
Sbjct: 1   MERKEALYEGKAKIMYATDRPDEILVYYKDDATAGNGAKKGTIAHKGIMNNKMTAFFFDL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+ H++I   + RE LV+ + +IPL + +RN AAGSLA+RL + EG+ +P  ++E+
Sbjct: 61  LAKEGVAHHYISMPSEREMLVKKLTIIPLEVIIRNVAAGSLAQRLGLEEGVPMPFPVIEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     +++  HI A   A  +E++E+  +S+++ND +T       + L+DF+++ 
Sbjct: 121 CYKNDDLGDPMLNRYHIRAMKIATDAELDEIERISLKVNDVLTKFLKTKRVDLIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+  +     ++LADEI PD CR WD   KE+ DK RF +    + + Y E+  RL
Sbjct: 181 GKDAE---GHVILADEISPDNCRFWDSDTKEKLDKDRFRRDLGNVEDAYKEMLHRL 233


>gi|331005418|ref|ZP_08328799.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [gamma
           proteobacterium IMCC1989]
 gi|330420778|gb|EGG95063.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [gamma
           proteobacterium IMCC1989]
          Length = 236

 Score =  245 bits (624), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 78/238 (32%), Positives = 130/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K +Y   +   L+  F++D    +      L+ KG++NN+ + ++  +
Sbjct: 1   MEKRQELYAGKAKSVYTTDDADLLVLHFRNDTSAFDGKIIEQLDRKGMVNNKFNAFIMEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP +F + ++  E LV+ ++MIP+   VRN AAGSL +RL + EG+ L     EF
Sbjct: 61  LEAAGIPTHFEKLLSDEECLVKKMDMIPVECVVRNIAAGSLCRRLGVEEGIDLTPPTFEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D     ++++ HI +F WA   ++  M  L+ ++N+ +  LFL  N+ LVD +++ 
Sbjct: 121 FLKNDELGDPMINDYHIESFGWATAEQLSVMKKLTFQVNEILKALFLEGNMLLVDSKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         ++L DE  PD CRLWD   +E+ DK RF +    ++E Y  V +RLG+
Sbjct: 181 GIYH----GEVILGDEFSPDGCRLWDKDTREKLDKDRFRQGLGNVIESYEMVGKRLGL 234


>gi|293400634|ref|ZP_06644779.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291305660|gb|EFE46904.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 235

 Score =  245 bits (624), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 86/238 (36%), Positives = 138/238 (57%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K ++   +   +I  +KDD    N  +  T+ GKG +NNRI+ ++F +
Sbjct: 1   MKECTLLYEGKAKKVFTTEDADAVIVDYKDDATAFNGLKKGTIQGKGSMNNRITNFLFQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP + I+ ++ R+ LV+ V++IPL + VRN  AGS AKRL + EG  +   ++EF
Sbjct: 61  LEEQGIPTHLIKELDDRKTLVKKVDIIPLEVIVRNKVAGSFAKRLGLEEGTEIKSPILEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     +++     A   A + E++ +T ++ +IN+ +  +F   +I+L+DF+I+ 
Sbjct: 121 SYKNDELGDPMINSYMAIAIGIATREEIDTITDMTFKINNTLKDIFAKADIELIDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G+  D     IVLADEI PD CRLWD+   E  DK RF +    + + Y EV +RL I
Sbjct: 181 GKFHDT----IVLADEISPDTCRLWDMHSHEHLDKDRFRRDLGNVEDAYQEVCKRLHI 234


>gi|163781691|ref|ZP_02176691.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882911|gb|EDP76415.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Hydrogenivirga sp. 128-5-R1-1]
          Length = 235

 Score =  245 bits (624), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 86/234 (36%), Positives = 123/234 (52%), Gaps = 3/234 (1%)

Query: 3   PRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLG 62
               +YE K K++YE  +P  LI  FKD     +  + A L GKG LNN IS  +F  L 
Sbjct: 4   KTKKLYEGKAKVVYETDDPDKLILVFKDTATAFDGVKKAELKGKGALNNTISSLIFEILH 63

Query: 63  KIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYY 122
           K GI  ++I +++  E LV   E   + + VRN AAGS+ KRL   EG    + L+EF+Y
Sbjct: 64  KSGIKTHYIEKLSDTEMLVWKAERFLVEVVVRNVAAGSVVKRLGFKEGDRFEKPLLEFFY 123

Query: 123 LPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGR 182
             D     LV + HI     A    +  M   ++++N+ ++  F    I LVDF+++ GR
Sbjct: 124 KNDELHDPLVCDAHIELMKLAPMEALPLMRDTALKVNEVLSQFFQEHGIILVDFKLEFGR 183

Query: 183 LLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           L D     I + DEI PD  RLWD    E+ DK RF      LLEGY ++ +++
Sbjct: 184 LPD---GSIGIVDEISPDSMRLWDARTGEKLDKDRFRFDLGDLLEGYRKILKQI 234


>gi|309775492|ref|ZP_07670493.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Erysipelotrichaceae bacterium 3_1_53]
 gi|308916750|gb|EFP62489.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Erysipelotrichaceae bacterium 3_1_53]
          Length = 234

 Score =  245 bits (624), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 83/238 (34%), Positives = 138/238 (57%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K ++    P  +I  +KDD    N  +  T+ GKG +NN+++ ++F +
Sbjct: 1   MKELEMLYEGKAKKVFATENPDQVIVDYKDDATAFNGQKKGTILGKGAVNNKMTNFLFKK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP + +  ++ R  LV+ VE++PL + +RN  AGS AKR+ + EG+ L   ++EF
Sbjct: 61  LEEKGIPTHLVEELDDRRTLVKKVEIVPLEVIIRNKVAGSFAKRMGLQEGMELKCPILEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     ++++    A   + Q E++E+T L+  +N+ +  +F  ++I+L+DF+++ 
Sbjct: 121 SYKDDDLGDPMINDYMALAVGISTQEEIDEITRLAFAVNEELKSIFAAVDIELIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR        IVLADEI PD CR WD+   +  DK RF +    + + Y EV RRLGI
Sbjct: 181 GRY----KGGIVLADEISPDTCRFWDIHTHDHLDKDRFRRDLGNVEDAYQEVYRRLGI 234


>gi|209525463|ref|ZP_03274003.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Arthrospira maxima CS-328]
 gi|209494143|gb|EDZ94458.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Arthrospira maxima CS-328]
          Length = 245

 Score =  245 bits (624), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 81/237 (34%), Positives = 128/237 (54%), Gaps = 7/237 (2%)

Query: 4   RNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGK 63
           R  +YE K KI+Y   +P  L+ ++KDD    N  +  T+ GKG +NN +S ++F  L  
Sbjct: 7   RQQLYEGKAKIVYTTDDPEVLLAYYKDDATAFNAQKRGTIKGKGEINNTMSGHLFKLLEA 66

Query: 64  IGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYL 123
            G+P ++I   +  E  ++ V+++P+ + VRN AAGSL K+  IP G  L   LVEF Y 
Sbjct: 67  AGVPTHYIDTPSPNEMRIKRVKIVPVEVIVRNIAAGSLCKQTGIPLGTVLQPPLVEFCYK 126

Query: 124 PDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRL 183
            D     L++ + +   N A   +++ M  LS +I+  ++  F    I LVDF+++ G  
Sbjct: 127 NDQLGDPLLTRDRLLVMNLATPEQLKSMEDLSRQIDQILSDFFSECGITLVDFKLEFGIT 186

Query: 184 LDDDILRIVLADEIFPDCCRLWDLSKKEE----CDKKRFSKSNDQLLEGYSEVARRL 236
            D    +++LADEI PD CRLWD ++ +      DK RF      +   Y +V  R+
Sbjct: 187 SD---GQLILADEISPDTCRLWDQAETDPNLRVMDKDRFRNDLGNVESAYQQVLARI 240


>gi|242238520|ref|YP_002986701.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Dickeya
           dadantii Ech703]
 gi|242130577|gb|ACS84879.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Dickeya
           dadantii Ech703]
          Length = 237

 Score =  245 bits (624), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 129/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y   +P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKLAELYRGKAKTVYTTDDPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP   ++ ++  E LV+ ++M+P+   VRN AAGSL KRL I EG  L   L + 
Sbjct: 61  LADAGIPTQMVQLLSDNEVLVKKLDMVPVECVVRNRAAGSLVKRLGIKEGEILNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCKTFGWVSEENLARMKELTYKANDVLSKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    ++ DK RF +S   L+E Y EVARRLG+
Sbjct: 181 GLF----KGEVVLGDEFSPDGSRLWDKETLDKMDKDRFRQSLGGLIEAYEEVARRLGV 234


>gi|218245239|ref|YP_002370610.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cyanothece sp. PCC 8801]
 gi|218165717|gb|ACK64454.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cyanothece sp. PCC 8801]
          Length = 243

 Score =  245 bits (624), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 85/236 (36%), Positives = 128/236 (54%), Gaps = 7/236 (2%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K KI+Y   +P  L+  FKDD    N  +  T+ GKG +N  IS  +F  LG  
Sbjct: 2   EKLYEGKAKILYTTEDPEILLTQFKDDATAFNALKRGTIQGKGEINCAISSALFQWLGTK 61

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
           GI  +FI +    +  VR V++IPL + VRN AAGSL ++  +PEG  LP  LVEFY   
Sbjct: 62  GITTHFIDQPAPTQMRVRAVKIIPLEVVVRNIAAGSLCRQTGLPEGKILPFPLVEFYLKN 121

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D+    L++ + +     A   ++E++  L+ +IN ++   F    I LVDF+++ G   
Sbjct: 122 DALGDPLLTRDRLLILELATAEQLEQLQTLAQQINQYLREFFATCQITLVDFKLEFGLD- 180

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEE----CDKKRFSKSNDQLLEGYSEVARRL 236
                +++LADEI PD CRLWD  K +      DK RF +   ++   Y +V +R+
Sbjct: 181 --SQGKLLLADEISPDTCRLWDQQKNDPQERVLDKDRFRRDLGEVESAYQQVQQRV 234


>gi|295401713|ref|ZP_06811679.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Geobacillus thermoglucosidasius C56-YS93]
 gi|312112479|ref|YP_003990795.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Geobacillus sp. Y4.1MC1]
 gi|294976200|gb|EFG51812.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Geobacillus thermoglucosidasius C56-YS93]
 gi|311217580|gb|ADP76184.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Geobacillus sp. Y4.1MC1]
          Length = 240

 Score =  245 bits (624), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 90/236 (38%), Positives = 137/236 (58%), Gaps = 3/236 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
                +YE K K +Y   +   L   +KD+    N  + AT+ GKG LNN I+  +F++L
Sbjct: 3   NKLALLYEGKAKKVYTTDDANILWIEYKDNATAFNGEKKATIAGKGRLNNEITSLLFSKL 62

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            + GIP++FI++++  EQLV+ V +IPL + VRN  AGSLAKRL IPEG  L + L+EFY
Sbjct: 63  HEAGIPNHFIQKLSATEQLVKKVTIIPLEVVVRNVVAGSLAKRLGIPEGTRLEKPLIEFY 122

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     L+ E+HI     A   ++  +  L+++++D +T  F    ++L+DF+++ G
Sbjct: 123 YKNDDLGDPLLLEDHIAILKLATSEQIAVLKELALQVDDVLTKHFAERRVRLIDFKLEFG 182

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
                    I+LADEI PD CRLWD+   E+ DK  F +    L + Y  + +RLG
Sbjct: 183 ID---SEGAILLADEISPDTCRLWDMDTDEKLDKDVFRRDLGNLTDAYETILQRLG 235


>gi|271499682|ref|YP_003332707.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Dickeya
           dadantii Ech586]
 gi|270343237|gb|ACZ76002.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Dickeya
           dadantii Ech586]
          Length = 237

 Score =  245 bits (624), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 82/238 (34%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y   +P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKLAELYRGKAKTVYTTEDPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP   +  ++  E LV+ +EM+P+   VRN AAGSL KRL I EG  L   L + 
Sbjct: 61  LEEAGIPTQMVSLLSDTEVLVKKLEMVPVECVVRNRAAGSLVKRLGITEGEILNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  LS + N+ ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCKTFGWVSEENLARMKELSYKANEVLSKLFGDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK RF +S   L+E Y EVARRLG+
Sbjct: 181 GLF----KGEVVLGDEFSPDGSRLWDKETLNKMDKDRFRQSLGGLIEAYEEVARRLGV 234


>gi|149182717|ref|ZP_01861183.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           sp. SG-1]
 gi|148849577|gb|EDL63761.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           sp. SG-1]
          Length = 241

 Score =  245 bits (624), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 98/237 (41%), Positives = 137/237 (57%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K +Y       +   +KD     N  + A + GKGVLNN IS  +F++
Sbjct: 1   MGKQGLLYEGKAKRVYSTENSDEVWVEYKDSATAFNGEKKAEIGGKGVLNNEISSLLFSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +FI RI+  EQLV+ V++IPL + VRN AAGSLAKRL + EG +L  S+VEF
Sbjct: 61  LKDKGIGSHFIERISENEQLVKRVDIIPLEVVVRNVAAGSLAKRLGLEEGTALRHSIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     L++E H+     A + EVE +    ++IN  +T +F  I I+L+DF+++ 
Sbjct: 121 YYKDDDLGDPLLTEAHVELLELAGREEVEFLKNQGLKINAVLTEIFEKIGIKLIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G+  D     I+LADEI PD CRLWD    E+ DK  F +    L + YS +  RLG
Sbjct: 181 GKDRD---GNIMLADEISPDTCRLWDKDTNEKFDKDVFRRDLGNLTDVYSIILERLG 234


>gi|260886376|ref|ZP_05897639.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Selenomonas sputigena ATCC 35185]
 gi|330838855|ref|YP_004413435.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Selenomonas sputigena ATCC 35185]
 gi|260863897|gb|EEX78397.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Selenomonas sputigena ATCC 35185]
 gi|329746619|gb|AEB99975.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Selenomonas sputigena ATCC 35185]
          Length = 237

 Score =  244 bits (623), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 89/236 (37%), Positives = 132/236 (55%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K KI+YE   P  L+ ++KDD    N  +  T+  KGV+NN+I+ + F  
Sbjct: 1   MSK-KVLYEGKAKIMYEMENPDELLVYYKDDATAGNGAKKGTIVDKGVMNNKITAFFFDL 59

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI H+ I   + RE +V+ +E+IPL + VRN AAGSLA+RL + EG  +   +VE 
Sbjct: 60  LKKNGIDHHCISMPSDREMIVKKLEIIPLEVVVRNIAAGSLAERLGLEEGTKMAIPIVEL 119

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +++  H+ A   A   E+ E+   ++++N+ M        I LVDF+++ 
Sbjct: 120 YYKSDELGDPMINHYHVKAMAMATDEEIREIERQALKVNEIMMAHLKTKKITLVDFKLEF 179

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR  +     I+LADEI PD CR WD    E+ DK RF +    + + Y E+ RRL
Sbjct: 180 GRDKN---GTIILADEISPDNCRFWDSDTNEKLDKDRFRRDLGNVEDAYKEILRRL 232


>gi|85059702|ref|YP_455404.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Sodalis
           glossinidius str. 'morsitans']
 gi|123519107|sp|Q2NS76|PUR7_SODGM RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|84780222|dbj|BAE74999.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Sodalis
           glossinidius str. 'morsitans']
          Length = 237

 Score =  244 bits (623), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 79/241 (32%), Positives = 131/241 (54%), Gaps = 4/241 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y   +P  LI  F++D    +  R    + KG++NN  + ++ T+
Sbjct: 1   MQKLAELYRGKAKTVYTTEDPDLLILTFRNDTSALDGQRIEQFDRKGMINNNFNYFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP   +R ++  E LV+ + M+P+   VRN AAGSL KRL + EGL L   L + 
Sbjct: 61  LAEAGIPTQIVRLLSDNEMLVKKLAMVPVECVVRNRAAGSLVKRLGVEEGLVLDPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +++E + T F W ++  +  M  L+ + ND ++ +F    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMINESYCTTFGWVSEPHLARMKQLTYQANDVLSKIFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           G         IVL DE  PD  RLWD +  ++ DK RF ++   ++E Y EVA+R+G+  
Sbjct: 181 GLF----NGEIVLGDEFSPDGSRLWDKTTLDKMDKDRFRQNLGGVIEAYEEVAKRIGVTL 236

Query: 241 K 241
            
Sbjct: 237 D 237


>gi|88608255|ref|YP_506719.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Neorickettsia sennetsu str. Miyayama]
 gi|123491443|sp|Q2GCS7|PUR7_NEOSM RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|88600424|gb|ABD45892.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Neorickettsia sennetsu str. Miyayama]
          Length = 240

 Score =  244 bits (623), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 105/244 (43%), Positives = 148/244 (60%), Gaps = 5/244 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLE-PGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFT 59
           MR R  +YE K KI++   + P  + Q FKDD    NN + + + GKGV+NN IS +   
Sbjct: 1   MRERRKIYEGKAKILFSFPDNPNLVTQHFKDDVTAYNNRKHSVIPGKGVINNYISAFFMQ 60

Query: 60  QLGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVE 119
            L  +GI  +F++ +NMREQLV+  E+IP+ + +RN  AG LAKRL + EG+ L   L+E
Sbjct: 61  NLQNVGIKTHFVKVLNMREQLVKKAELIPIEVVIRNIVAGGLAKRLGLEEGMILDAPLIE 120

Query: 120 FYYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIK 179
            YY  DS    +V+++HI +FNW   SE+EEM  ++ RINDF++G      I LVD +++
Sbjct: 121 TYYKSDSLGDPMVTDDHILSFNWLKLSEIEEMKVMAWRINDFLSGALSSAGIILVDLKLE 180

Query: 180 CGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
            G   D    +I+L DEI PD CR WD   KE+ DK RF +    + + Y EVARRLGI 
Sbjct: 181 FGFYDD----QIILIDEISPDTCRFWDTETKEKMDKDRFRRDLGGVSKYYREVARRLGIL 236

Query: 240 KKNE 243
             + 
Sbjct: 237 NGSF 240


>gi|254519736|ref|ZP_05131792.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium sp. 7_2_43FAA]
 gi|226913485|gb|EEH98686.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium sp. 7_2_43FAA]
          Length = 234

 Score =  244 bits (623), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 85/236 (36%), Positives = 132/236 (55%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY   +   +I ++KDD    N  +   +  KGVLNN I+  +F  
Sbjct: 1   MKKLEMMYEGKAKKIYATEKADEVIVYYKDDATAFNGEKKGQIEEKGVLNNSITSMIFEM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +FI +++ REQL + VE++PL + VRN AAGS+AKRL + EG  L  ++ E 
Sbjct: 61  LNENGIKTHFIEKLSEREQLCKKVEIVPLEVIVRNVAAGSMAKRLGLEEGFELKTTVFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  DS    L+++ H          E+ ++  ++ +IND +   F+  NI+L+DF+++ 
Sbjct: 121 SYKDDSLGDPLINDYHAVGIGATTFEELNKIYEMTAKINDLLKEFFIKQNIRLIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR        I+LADEI PD CR WD +  E+ DK RF +    + + Y E+  R+
Sbjct: 181 GRY----NGEILLADEISPDTCRFWDATTGEKLDKDRFRRDLGNVKDAYVEILNRI 232


>gi|312875874|ref|ZP_07735864.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caldicellulosiruptor lactoaceticus 6A]
 gi|311797355|gb|EFR13694.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caldicellulosiruptor lactoaceticus 6A]
          Length = 239

 Score =  244 bits (623), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 92/237 (38%), Positives = 138/237 (58%), Gaps = 4/237 (1%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K K +YE   P  ++  +KDD    +  +   +N KGV+NN +S + F  L   
Sbjct: 7   KLLYEGKAKKVYETDNPDVVVIEYKDDATAFDGTKRGIINNKGVVNNLVSNHFFKILESN 66

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
            IP +FI +I+ R+ +V+ V++IP+ + VRN AAGSL+KRL + EG  L R ++EF Y  
Sbjct: 67  KIPTHFIEQIDERKTVVKRVQIIPVEVIVRNIAAGSLSKRLGLEEGAILKRPILEFCYKN 126

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D+     V++ HI A   A + E+ ++   S +IND +      +NI LVDF+++ GR  
Sbjct: 127 DALHDPQVNQYHILALELATEEEIRKIEEYSFKINDVLRNYLKQVNIDLVDFKLEFGRY- 185

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKK 241
                 ++LADEI PD CR WD + KE+ DK RF +    + E Y E+ RRLG+ KK
Sbjct: 186 ---KGEVILADEISPDTCRFWDTTTKEKLDKDRFRRDLGNVEEAYMEILRRLGLDKK 239


>gi|313205751|ref|YP_004044928.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Riemerella anatipestifer DSM 15868]
 gi|312445067|gb|ADQ81422.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Riemerella anatipestifer DSM 15868]
 gi|315022853|gb|EFT35877.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Riemerella anatipestifer RA-YM]
 gi|325336807|gb|ADZ13081.1| Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [Riemerella anatipestifer RA-GD]
          Length = 239

 Score =  244 bits (622), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 88/235 (37%), Positives = 138/235 (58%), Gaps = 3/235 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
           +    +YE K K ++   +   +I  FKDD    N  +   ++ KG +NN I+  +F  L
Sbjct: 3   QKGAMLYEGKAKQVFATDKADEVIVRFKDDATAFNAQKKGQVDKKGQMNNAITTLIFQYL 62

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            + GIP +FI++++ REQLV+ V++IPL + VRN +AGS+A+RL + EG+  P ++ +  
Sbjct: 63  NEKGIPTHFIKQLDDREQLVKKVDIIPLEMVVRNYSAGSMAQRLGMEEGIKSPITIFDIC 122

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     L+++ H      A + E++EM +L+ RIN  +  LF  +NI LVDF+I+ G
Sbjct: 123 YKKDELGDPLINDYHAIFLGAATREELDEMYSLTGRINQILIELFDKMNIILVDFKIELG 182

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           +  D    +I+LADEI PD CRLWD    ++ DK RF +    + E Y E+  RL
Sbjct: 183 KTSD---GQIILADEISPDTCRLWDKDTMKKLDKDRFRRDLGGVTEAYEEIYERL 234


>gi|255322212|ref|ZP_05363358.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Campylobacter showae RM3277]
 gi|255300585|gb|EET79856.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Campylobacter showae RM3277]
          Length = 238

 Score =  244 bits (622), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 88/237 (37%), Positives = 129/237 (54%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +YE K K ++   +   LI  FKDD    +  +     GKG LNN+IS  +F  
Sbjct: 1   MQKKELIYEGKGKKMFATDDANLLIAEFKDDLTAFDAQKRGNEAGKGALNNKISTQLFHL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP + +  ++  EQLV+  E+IPL + VRN A GSL KRL I EG  L   LVEF
Sbjct: 61  LKEKGIPTHLVETLSDTEQLVKKCEIIPLEVVVRNIATGSLTKRLAIKEGTVLSFPLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWA-NQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIK 179
           YY  D     LV++EH        ++++++ +  +   IN  +   F   N++LVDF+++
Sbjct: 121 YYKNDDLHDPLVNDEHCLIMGLVKSENDLDRLKHMGREINAILFKFFADRNLKLVDFKVE 180

Query: 180 CGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
            G   D     I+LADEI PD CR WD +  E+ DK RF +    +   Y EV +R+
Sbjct: 181 FGVDKD---GNILLADEISPDSCRFWDATTNEKLDKDRFRQDLGSVKVAYEEVLKRI 234


>gi|154174764|ref|YP_001408299.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Campylobacter curvus 525.92]
 gi|166229533|sp|A7GYK7|PUR7_CAMC5 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|112803200|gb|EAU00544.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Campylobacter curvus 525.92]
          Length = 236

 Score =  244 bits (622), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 92/237 (38%), Positives = 126/237 (53%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ R  +YE K K +Y   +   LI  FKDD    +  +     GKG LNN+IS  +F  
Sbjct: 1   MQKRELIYEGKGKKMYATDDANLLIAEFKDDLTAFDAQKRGNEAGKGALNNKISTQIFKI 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI    +  I+  EQLV+  E+IPL + VRN A GSL KRL I EG  LP  LVEF
Sbjct: 61  LKEKGIETDLVETISDTEQLVKKCEIIPLEVVVRNIATGSLTKRLAIKEGTVLPFPLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWA-NQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIK 179
           Y+  D     LV++EH        ++ +++ +  L+  IN  +   F    ++LVDF+I+
Sbjct: 121 YFKNDELHDPLVTDEHCLVMGLVKSEKDLQTLRHLAREINSILFKFFEERKLKLVDFKIE 180

Query: 180 CGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
            G   D     I+LADEI PD CR WD    E+ DK RF +    +   Y EV RR+
Sbjct: 181 FGMDKD---GNILLADEISPDSCRFWDADTNEKLDKDRFRQDLGSVKVAYEEVLRRI 234


>gi|21673788|ref|NP_661853.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chlorobium tepidum TLS]
 gi|30913159|sp|Q8KDT4|PUR7_CHLTE RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|21646917|gb|AAM72195.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chlorobium tepidum TLS]
          Length = 235

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 83/236 (35%), Positives = 129/236 (54%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     ++E K K +++   P  +IQ FKDD    NN +  ++  KGV NN I+  +FT 
Sbjct: 1   MNKVTLLHEGKAKKVWQTDNPDLIIQEFKDDATAFNNKKKGSIADKGVTNNAIASRLFTM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+ GIP +F+ ++N R+ L + ++++ + +  RN AAGSL +R    EG  L + +VE 
Sbjct: 61  LGENGIPTHFVGKLNDRDMLCKKLDILLIEVVTRNIAAGSLVRRYGFKEGTVLSKPIVEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y   D  +  L++E+H  A       EV  + A++ +IN  +   F    ++LVDF+++ 
Sbjct: 121 YLKNDELDDPLMNEDHAVALGLGTCEEVAHLKAMAKKINSLLVPWFAERKLRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR        I+L DEI PD CR WD    E+ DK RF      + + YSEV RR+
Sbjct: 181 GR----HKGEILLGDEISPDTCRFWDAESGEKLDKDRFRLDLGGVEDAYSEVKRRV 232


>gi|253989278|ref|YP_003040634.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253780728|emb|CAQ83890.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Photorhabdus asymbiotica]
          Length = 237

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 81/241 (33%), Positives = 132/241 (54%), Gaps = 4/241 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y   +P  LI  F++D    +  R    + KG++NN+ + ++  +
Sbjct: 1   MQKKAELYRGKAKTVYTTDDPDRLILEFRNDTSALDGERIEQFDRKGMVNNKFNHFIMNK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   +RN AAGSL +RL + EGL L   L + 
Sbjct: 61  LEEAGIPTQMERLLSDTEVLVKKLDMVPVECVIRNRAAGSLVRRLGVEEGLVLSPPLFDQ 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  + EM  LS + N+ ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDALHDPMVNESYCETFGWVSKEHLAEMKNLSYKANEILSKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           G        +IVL DE  PD CRLWD    ++ DK RF +S   L+E Y EVA R+G+  
Sbjct: 181 GLF----KGQIVLGDEFSPDGCRLWDKETLDKMDKDRFRQSLGGLIEAYEEVAHRIGVVL 236

Query: 241 K 241
            
Sbjct: 237 D 237


>gi|269122846|ref|YP_003305423.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Streptobacillus moniliformis DSM 12112]
 gi|268314172|gb|ACZ00546.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Streptobacillus moniliformis DSM 12112]
          Length = 237

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 83/236 (35%), Positives = 128/236 (54%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M   N +YE K K +Y   +   +I  +KDD    N  +  ++  KG+LNN I+  +F  
Sbjct: 1   MEKTNFLYEGKAKQLYLTDDENLVIVLYKDDATAGNGIKKGSIKNKGILNNDITTLIFNL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +F++++N REQL + V++ PL + VRN  AGS+A+RL I EG     ++ E 
Sbjct: 61  LEDHGIKTHFVKKLNEREQLCQKVDIFPLEVIVRNVIAGSMAERLGIKEGTKPINTIFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  +   A   E+ E+ +++ +IN  +   F  + I LVDF+I+ 
Sbjct: 121 CYKNDKYGDPLINDHHAVSLGLATYDELREIYSITDKINKLLKEKFDELGIILVDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+        I+LADEI PD CR WD    E+ DK RF +    + E Y E+ +RL
Sbjct: 181 GKN---SKGEILLADEITPDTCRFWDKETGEKLDKDRFRRDLGNIEEAYLEIFKRL 233


>gi|254262179|emb|CAZ90507.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Enterobacter turicensis]
          Length = 237

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 127/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP      ++  E LV+ +EM+P+   +RN AAGSL KRL   EG+ L   L + 
Sbjct: 61  LEEAGIPTQLEALLSDTESLVKKLEMVPVECVIRNRAAGSLVKRLGTEEGIELSPPLFDM 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ R ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDALHDPMVNESYCETFGWVSKENLARMKELTYRANDVLFKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    ++ DK RF +S   L+E Y EVARRLG+
Sbjct: 181 GLF----NGEVVLGDEFSPDGARLWDKQTMDKMDKDRFRQSLGGLIEAYEEVARRLGV 234


>gi|251790562|ref|YP_003005283.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Dickeya
           zeae Ech1591]
 gi|247539183|gb|ACT07804.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Dickeya
           zeae Ech1591]
          Length = 237

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 127/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y   +P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKLAELYRGKAKTVYTTEDPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP   +  ++  E LV+ +EM+P+   VRN AAGSL KRL I EG  L   L + 
Sbjct: 61  LEEAGIPTQMVSLLSDTEVLVKKLEMVPVECVVRNRAAGSLVKRLGITEGEVLNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  LS + N+ ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCKTFGWVSEENLARMKELSYKANEVLSKLFGDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK RF +S   L+E Y EVA RLG+
Sbjct: 181 GLF----KGEVVLGDEFSPDGSRLWDKETLNKMDKDRFRQSLGGLIEAYEEVAHRLGV 234


>gi|15894670|ref|NP_348019.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium acetobutylicum ATCC 824]
 gi|22001865|sp|Q97J95|PUR7_CLOAB RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|15024329|gb|AAK79359.1|AE007651_2 Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [Clostridium acetobutylicum ATCC 824]
 gi|325508807|gb|ADZ20443.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium acetobutylicum EA 2018]
          Length = 235

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 84/236 (35%), Positives = 132/236 (55%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K +Y   +P  ++ ++KDD    N  +   +  KGVLNN I+  +F  
Sbjct: 1   MEKKEMMYEGKAKKVYSTEDPEKVVIYYKDDATAFNGEKKGQIEDKGVLNNNITSMLFEL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+  +F ++++ REQL + VE++PL + VRN AAGS+AKRL + EG  L  ++ E 
Sbjct: 61  LEKHGVKTHFEKKLSDREQLCKKVEIVPLEVIVRNVAAGSMAKRLGLEEGYELKTTVFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D+    L+++ H  A       E++++ A +  +ND +   F    I+L+DF+I+ 
Sbjct: 121 SYKDDALGDPLINDTHAVAIGATTFEELDKIYAATKTVNDVLKEFFHKQGIKLIDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR        ++LADEI PD CRLWD    E+ DK RF +    + E Y E+  R+
Sbjct: 181 GRY----NGEVLLADEISPDTCRLWDEKTNEKLDKDRFRRDMGNVKEAYVEILNRI 232


>gi|146297004|ref|YP_001180775.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|145410580|gb|ABP67584.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 236

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 93/237 (39%), Positives = 137/237 (57%), Gaps = 4/237 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
           + +  +YE K K IYE      +I  +KDD    +  +   +N KG++NN+IS + F  L
Sbjct: 4   QMKGLLYEGKAKKIYETDVDDIVIIEYKDDATAFDGTKRGIINEKGIVNNKISNHFFKLL 63

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
              GIP +FI +I+ R   V+ VE+IP+ + VRN AAGSL KRL + EG +L R ++EF 
Sbjct: 64  ESKGIPTHFIEQIDERRTAVKKVEIIPVEVIVRNIAAGSLCKRLGLEEGTALKRPVLEFC 123

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D+     ++E HI A   A + E+ ++   S +IN  +      +NI LVDF+++ G
Sbjct: 124 YKNDALHDPQINEYHILALELATEEEINKVKEYSFKINQILREYLKEVNIDLVDFKLEFG 183

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           R        I+LADEI PD CR WD++ KE+ DK RF +    + E Y EV +RLG+
Sbjct: 184 RYKSS----IILADEISPDTCRFWDMNTKEKLDKDRFRRDLGNVEEAYKEVLKRLGL 236


>gi|312793629|ref|YP_004026552.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312180769|gb|ADQ40939.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 239

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 90/234 (38%), Positives = 135/234 (57%), Gaps = 4/234 (1%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K K +YE   P  ++  +KDD    +  +   +N KGV+NN +S + F  L   
Sbjct: 7   KLLYEGKAKKVYETDNPDVVVIEYKDDATAFDGTKRGIINNKGVVNNLVSNHFFKILESN 66

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
            IP +FI +I+ R+  V+ V++IP+ + VRN AAGSL+KRL + EG  L R ++EF Y  
Sbjct: 67  EIPTHFIEQIDERKTAVKRVQIIPVEVIVRNIAAGSLSKRLGLEEGAILKRPILEFCYKN 126

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D+     V++ HI A   A + E+ ++   S +IND +      +NI LVDF+++ GR  
Sbjct: 127 DALHDPQVNQYHILALELATEEEIRKIEEYSFKINDVLRNYLKQVNIDLVDFKLEFGRY- 185

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
                 ++LADEI PD CR WD + KE+ DK RF +    + E Y E+ RRLG+
Sbjct: 186 ---KGEVILADEISPDTCRFWDTTTKEKLDKDRFRRDLGNVEEAYMEILRRLGL 236


>gi|304317530|ref|YP_003852675.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302779032|gb|ADL69591.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 235

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 95/237 (40%), Positives = 135/237 (56%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M   + +YE K K ++   +    I  +KDD    N  +  T+  KG+LNN IS  +F  
Sbjct: 1   MEKLSMLYEGKAKKVFRTSDEDFYIIEYKDDATAFNGIKKGTIQNKGILNNEISTILFEL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+P +F++R+N RE LV+ VE+ P+ + +RN AAGS++KRL I EG  L R+++EF
Sbjct: 61  LEKEGVPTHFVKRLNDREMLVKKVEIYPIEVLIRNYAAGSISKRLGIEEGAKLKRTVLEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D      ++E HI A   A + EVE +   S +IND ++  F+  NI LVDF+++ 
Sbjct: 121 CYKNDELGDPFINEYHIEAMELATKDEVETIKNYSFKINDILSKYFISKNIILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G+  D     IVLADEI PD CR WD    E+ DK RF +    +   Y EV  RL 
Sbjct: 181 GKSKDG----IVLADEISPDTCRFWDSVTMEKLDKDRFRRDLGNVEGAYVEVLNRLE 233


>gi|311278611|ref|YP_003940842.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterobacter cloacae SCF1]
 gi|308747806|gb|ADO47558.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterobacter cloacae SCF1]
          Length = 237

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 129/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP      ++  E LV+ +EM+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LAQAGIPTQMEALLSDTECLVKKLEMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKANDVLKQLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        ++VL DE  PD  RLWD    ++ DK RF +S   L+E Y EVARRLG+
Sbjct: 181 GLY----KGQVVLGDEFSPDGSRLWDKETMDKMDKDRFRQSLGGLIEAYEEVARRLGV 234


>gi|153955306|ref|YP_001396071.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium kluyveri DSM 555]
 gi|219855727|ref|YP_002472849.1| hypothetical protein CKR_2384 [Clostridium kluyveri NBRC 12016]
 gi|189038235|sp|A5N0Q4|PUR7_CLOK5 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|254783944|sp|B9E4L0|PUR7_CLOK1 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|146348164|gb|EDK34700.1| PurC [Clostridium kluyveri DSM 555]
 gi|219569451|dbj|BAH07435.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 235

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 88/236 (37%), Positives = 136/236 (57%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y+ K K +YE  +   +I ++KDD    N  +   +  KG+LNN I+  +F  
Sbjct: 1   MKKGEMIYQGKAKKVYETDDKDKVIIYYKDDATAFNGEKKGQITDKGILNNNITSSLFEL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K  IP +F +++N REQL + V++IPL + VRN AAGS+AKRL + EG  L  ++ E 
Sbjct: 61  LEKNNIPTHFEKKLNDREQLCKKVDIIPLEVIVRNVAAGSMAKRLGLEEGTPLKTTVFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  DS    ++++ H  A   A   E++ +  ++  IND +   F  + I+L+DF+++ 
Sbjct: 121 SYKDDSLGDPIINDYHAVAIGIATWDELKTIYDMTASINDILELFFRKLGIKLIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+  D    +IVLADEI PD CRLWD    E+ DK RF +    + E Y E+ RR+
Sbjct: 181 GKFKD----KIVLADEISPDTCRLWDAVTNEKLDKDRFRRDMGNVKEAYEEILRRI 232


>gi|69246323|ref|ZP_00603896.1| SAICAR synthetase [Enterococcus faecium DO]
 gi|257878087|ref|ZP_05657740.1| saicar synthetase [Enterococcus faecium 1,230,933]
 gi|257881127|ref|ZP_05660780.1| saicar synthetase [Enterococcus faecium 1,231,502]
 gi|257889714|ref|ZP_05669367.1| saicar synthetase [Enterococcus faecium 1,231,410]
 gi|257892347|ref|ZP_05672000.1| saicar synthetase [Enterococcus faecium 1,231,408]
 gi|258616419|ref|ZP_05714189.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterococcus faecium DO]
 gi|260559137|ref|ZP_05831323.1| saicar synthetase [Enterococcus faecium C68]
 gi|261207671|ref|ZP_05922356.1| saicar synthetase [Enterococcus faecium TC 6]
 gi|289565789|ref|ZP_06446232.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterococcus faecium D344SRF]
 gi|293563733|ref|ZP_06678173.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterococcus faecium E1162]
 gi|293569368|ref|ZP_06680665.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterococcus faecium E1071]
 gi|294615902|ref|ZP_06695744.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterococcus faecium E1636]
 gi|294620314|ref|ZP_06699631.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterococcus faecium E1679]
 gi|294621303|ref|ZP_06700484.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterococcus faecium U0317]
 gi|314938739|ref|ZP_07846014.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Enterococcus faecium TX0133a04]
 gi|314941159|ref|ZP_07848056.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Enterococcus faecium TX0133C]
 gi|314947890|ref|ZP_07851295.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Enterococcus faecium TX0082]
 gi|314953057|ref|ZP_07856016.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Enterococcus faecium TX0133A]
 gi|314993314|ref|ZP_07858685.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Enterococcus faecium TX0133B]
 gi|314997623|ref|ZP_07862554.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Enterococcus faecium TX0133a01]
 gi|68195337|gb|EAN09787.1| SAICAR synthetase [Enterococcus faecium DO]
 gi|257812315|gb|EEV41073.1| saicar synthetase [Enterococcus faecium 1,230,933]
 gi|257816785|gb|EEV44113.1| saicar synthetase [Enterococcus faecium 1,231,502]
 gi|257826074|gb|EEV52700.1| saicar synthetase [Enterococcus faecium 1,231,410]
 gi|257828726|gb|EEV55333.1| saicar synthetase [Enterococcus faecium 1,231,408]
 gi|260074894|gb|EEW63210.1| saicar synthetase [Enterococcus faecium C68]
 gi|260078054|gb|EEW65760.1| saicar synthetase [Enterococcus faecium TC 6]
 gi|289162427|gb|EFD10284.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterococcus faecium D344SRF]
 gi|291587894|gb|EFF19745.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterococcus faecium E1071]
 gi|291591288|gb|EFF22955.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterococcus faecium E1636]
 gi|291593455|gb|EFF25012.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterococcus faecium E1679]
 gi|291599141|gb|EFF30177.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterococcus faecium U0317]
 gi|291604311|gb|EFF33805.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterococcus faecium E1162]
 gi|313588340|gb|EFR67185.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Enterococcus faecium TX0133a01]
 gi|313592216|gb|EFR71061.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Enterococcus faecium TX0133B]
 gi|313594859|gb|EFR73704.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Enterococcus faecium TX0133A]
 gi|313600019|gb|EFR78862.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Enterococcus faecium TX0133C]
 gi|313641952|gb|EFS06532.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Enterococcus faecium TX0133a04]
 gi|313645659|gb|EFS10239.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Enterococcus faecium TX0082]
          Length = 242

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 87/243 (35%), Positives = 135/243 (55%), Gaps = 4/243 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K IY   +   +   + D     N  R   ++GKG LNN+I+  +F  
Sbjct: 1   MEKKELLYEGKAKKIYLTSDENLIWIEYLDQATALNGARKDQISGKGELNNQITSAIFRY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI ++FI +++  EQL + V++IPL + +RN AAGS +KRL +PEG    + ++EF
Sbjct: 61  LTQRGIKNHFIEQLSKTEQLAKKVQIIPLEVVIRNIAAGSFSKRLGVPEGKEFIKPIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D  +   ++EEHI     A   E+ E+ A ++ IN+ +T LF  + + LVDF+++ 
Sbjct: 121 YYKDDQLDDPFINEEHIYFLQLAKPEEISELKAQALAINEILTELFAKVGLVLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR       +I+LADE+ PD CRLWD    E  DK  + +    L+  Y EV  RL    
Sbjct: 181 GR----SNGQILLADEVTPDTCRLWDERTNEHMDKDVYRRDLGDLIPVYQEVYNRLSELT 236

Query: 241 KNE 243
           + +
Sbjct: 237 EEK 239


>gi|261822420|ref|YP_003260526.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pectobacterium wasabiae WPP163]
 gi|261606433|gb|ACX88919.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pectobacterium wasabiae WPP163]
          Length = 237

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 80/238 (33%), Positives = 129/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y   +P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKLAELYRGKAKTVYTTEDPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP   +  ++  E LV+ +EM+P+   VRN AAGSL KRL I EG++L   L + 
Sbjct: 61  LEEAGIPTQMVSLLSDNEVLVKKLEMVPVECVVRNRAAGSLVKRLGIEEGIALNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  LS + ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCKTFGWVSEENLARMKELSYKANDVLSKLFGDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK RF +S   L+E Y EVA R+G+
Sbjct: 181 GLF----KGEVVLGDEFSPDGSRLWDKETLNKMDKDRFRQSLGGLIEAYEEVAHRIGV 234


>gi|50120203|ref|YP_049370.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pectobacterium atrosepticum SCRI1043]
 gi|81827184|sp|Q6D7R1|PUR7_ERWCT RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|49610729|emb|CAG74174.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pectobacterium atrosepticum SCRI1043]
          Length = 237

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 80/238 (33%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y   +P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKLAELYRGKAKTVYTTEDPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP   +  ++  E LV+ +EM+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LEEAGIPTQMVSLLSDNEVLVKKLEMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  LS + ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCKTFGWVSEENLARMKELSYKANDVLSKLFGDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK RF +S   L+E Y EVA R+G+
Sbjct: 181 GLF----NGEVVLGDEFSPDGSRLWDKETLNKMDKDRFRQSLGGLIEAYEEVAHRIGV 234


>gi|237756065|ref|ZP_04584644.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237691782|gb|EEP60811.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 232

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 86/233 (36%), Positives = 132/233 (56%), Gaps = 3/233 (1%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K KI+Y+   P  +I +FKD+    N  +   + GKG+LNN+IS   FT L + 
Sbjct: 2   EKLYEGKAKIVYQTENPNHVIIYFKDEATAFNAQKKDIIEGKGILNNKISSIFFTLLNQA 61

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
           G+  +FI++I+ RE L    ++IP+ + VRN A GS+ KRL IPE      SL+EFYY  
Sbjct: 62  GVKTHFIKQISDREMLAYKTKIIPIEVVVRNLATGSIVKRLGIPEKTEFNPSLIEFYYKN 121

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D+    ++  EH+     A + +V+ +  +++++N  +    +  +I LVDF+++ G+L 
Sbjct: 122 DALGDPIICYEHVLVMKLATEEDVKTIKEMALKVNQILRDFLIKHDIILVDFKLEFGKLD 181

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           D     IV+ADEI PD CR WD    E  DK RF  +   L + Y EV  R+ 
Sbjct: 182 D---GTIVVADEISPDTCRFWDAKTGERMDKDRFRLNLGDLAKYYQEVLERIE 231


>gi|154685142|ref|YP_001420303.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           amyloliquefaciens FZB42]
 gi|154350993|gb|ABS73072.1| PurC [Bacillus amyloliquefaciens FZB42]
          Length = 239

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 90/234 (38%), Positives = 140/234 (59%), Gaps = 3/234 (1%)

Query: 4   RNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGK 63
            N +YE K K IY+  +   L   +KD     N  + A ++GKG LNN IS  +F  L  
Sbjct: 6   NNLLYEGKAKRIYQTEDEQILRVVYKDSATAFNGEKKAEISGKGRLNNEISSLIFKHLHA 65

Query: 64  IGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYL 123
            GI ++F+ R++  EQL++ V +IPL + VRN AAGS++KRL IPEG  LP+ ++EFYY 
Sbjct: 66  KGIDNHFVERVSESEQLIKKVSIIPLEVVVRNIAAGSMSKRLGIPEGTKLPQPIIEFYYK 125

Query: 124 PDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRL 183
            D+    L++E+HI     A   +VE + +++ ++N  +  +F    ++L+DF+++ G  
Sbjct: 126 DDALGDPLITEDHIWLLKAAAPEQVETIKSITKQVNQELQHIFEDCGVRLIDFKLEFGLD 185

Query: 184 LDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
            +    R++LADEI PD CRLWD    E+ DK  F ++   L + Y E+ +RLG
Sbjct: 186 AE---GRVLLADEISPDTCRLWDKDTNEKLDKDLFRRNLGSLTDAYEEIFKRLG 236


>gi|78187056|ref|YP_375099.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chlorobium luteolum DSM 273]
 gi|123582981|sp|Q3B3M5|PUR7_PELLD RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|78166958|gb|ABB24056.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chlorobium luteolum DSM 273]
          Length = 239

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 84/236 (35%), Positives = 131/236 (55%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    ++E K K ++   E   +IQ FKDD    NN +  T+  KGV+NN IS  +FT 
Sbjct: 1   MKKTTLLHEGKAKKVFLTDEADLVIQEFKDDATAFNNKKKGTIAEKGVVNNAISCKLFTM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+  + + +++ R+ L + +++I + + VRN AAGSL KR    EG  L   +VEF
Sbjct: 61  LEGEGVRTHLVEKLSDRDMLCKKLDIIKVEVVVRNIAAGSLVKRYGFTEGSVLREPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y   D  +  L++E H  A   A+  E+  +   ++R+N+ +   F G+ ++LVDF+++ 
Sbjct: 121 YLKNDDLDDPLMNESHAVALGVASLDELAVLGTRALRVNEVLKPFFAGVKLKLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR        I+L DEI PD CR WDL   E+ DK RF      + + YSEV +R+
Sbjct: 181 GRHH----GEILLGDEISPDTCRFWDLETNEKLDKDRFRLDLGGIEDAYSEVQKRV 232


>gi|304312915|ref|YP_003812513.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [gamma
           proteobacterium HdN1]
 gi|301798648|emb|CBL46880.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [gamma
           proteobacterium HdN1]
          Length = 237

 Score =  243 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 78/238 (32%), Positives = 133/238 (55%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  ++ +Y+ K K +Y   +   L+  F++D    +  +   L+ KG++NN+ + ++  +
Sbjct: 1   MEKKDELYKGKAKSVYATDDAKRLVMLFRNDTSAFDGKKKEALDRKGMVNNKFNAFIMEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +F + +N +E LV+ + M+P+   VRN +AGS+ +RL + EGL L     EF
Sbjct: 61  LEAAGIETHFEKLLNDQESLVKRLTMLPVECVVRNISAGSICRRLGVQEGLDLNPPTFEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D     +++E HI +F WA   +VE M AL+ ++N  +  LF    + LVD++++ 
Sbjct: 121 FLKNDDLGDPMINEFHIQSFGWATPEQVEIMKALAFKVNGVLKALFDAAGLLLVDYKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        R++L DE  PD CRLWD   +++ DK RF +    ++E Y EV  RLG+
Sbjct: 181 GVY----EGRVILGDEFTPDGCRLWDKETRKKLDKDRFRQGLGGVVEAYEEVGHRLGV 234


>gi|313897351|ref|ZP_07830894.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium sp. HGF2]
 gi|312957721|gb|EFR39346.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium sp. HGF2]
          Length = 235

 Score =  243 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 85/238 (35%), Positives = 139/238 (58%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K ++    P  +I  +KDD    N  +  T+ GKGV+NN+++ ++F +
Sbjct: 1   MKELEMLYEGKAKKVFATENPDQVIVDYKDDATAFNGQKKGTILGKGVVNNKMTNFLFKK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP + I  ++ R  LV+ VE++PL + +RN  AGS AKR+ + EG+ L   ++EF
Sbjct: 61  LEDKGIPTHLIEELDDRRTLVKKVEIVPLEVIIRNKVAGSFAKRMGLKEGMELKCPILEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     ++++    A   + Q E++E+T L+  +N+ +  +F  ++I+L+DF+++ 
Sbjct: 121 SYKDDDLGDPMINDYMALAVGISTQEEIDEITRLAFAVNEELKSIFAAVDIELIDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR        IVLADEI PD CR WD+   +  DK RF ++   + + Y EV RRLGI
Sbjct: 181 GRF----KGGIVLADEISPDTCRFWDIHTHDHLDKDRFRRNLGNVEDAYQEVYRRLGI 234


>gi|312622325|ref|YP_004023938.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caldicellulosiruptor kronotskyensis 2002]
 gi|312202792|gb|ADQ46119.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caldicellulosiruptor kronotskyensis 2002]
          Length = 239

 Score =  243 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 90/237 (37%), Positives = 136/237 (57%), Gaps = 4/237 (1%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K K +YE   P  ++  +KDD    +  +   +N KGV+NN +S + F  L   
Sbjct: 7   KLLYEGKAKKVYETDNPNVVVIEYKDDATAFDGTKRGIINNKGVVNNLVSNHFFKILESN 66

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
            IP +FI +I+ R+  V+ V++IP+ + VRN AAGSL+KRL + EG  L R ++EF Y  
Sbjct: 67  NIPTHFIEQIDERKTAVKRVQIIPVEVIVRNIAAGSLSKRLGLEEGSILKRPILEFCYKN 126

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D      V++ HI A   A + E+ ++   S ++ND +      +NI L+DF+++ GR  
Sbjct: 127 DELHDPQVNQYHILALELATEEEISKIEEYSFKVNDVLRNYLKQVNIDLIDFKLEFGRYR 186

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKK 241
                 ++LADEI PD CR WD + KE+ DK RF +    + E Y E+ RRLG+ KK
Sbjct: 187 ----GDVILADEISPDTCRFWDTTTKEKLDKDRFRRDLGNVEEAYMEILRRLGLDKK 239


>gi|52079129|ref|YP_077920.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           licheniformis ATCC 14580]
 gi|52784497|ref|YP_090326.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           licheniformis ATCC 14580]
 gi|52002340|gb|AAU22282.1| phosphoribosylaminoimidazole succinocarboxamide synthetase
           [Bacillus licheniformis ATCC 14580]
 gi|52346999|gb|AAU39633.1| PurC [Bacillus licheniformis ATCC 14580]
          Length = 238

 Score =  243 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 89/237 (37%), Positives = 142/237 (59%), Gaps = 3/237 (1%)

Query: 3   PRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLG 62
               +YE K K IY   +  TL   +K+     N  + A ++GKG LNN IS  +FT+L 
Sbjct: 5   KNELLYEGKAKKIYRTDDDNTLFVEYKNSATAFNGEKKAEIDGKGRLNNEISSLIFTRLH 64

Query: 63  KIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYY 122
           + GI ++F+ RI+  EQL++ V +IPL + VRN  AGS++KRL IPEG  L + ++EFYY
Sbjct: 65  EKGINNHFVERISETEQLIKKVTIIPLEVVVRNVVAGSMSKRLGIPEGTELGQPIIEFYY 124

Query: 123 LPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGR 182
             D+    L++E+HI     A   +VE++ +++ ++N+ +  +F   +++L+DF+++ G 
Sbjct: 125 KDDALGDPLITEDHIRILKAAEPEQVEKIKSITRQVNEELQTIFAACDVRLIDFKLEFGL 184

Query: 183 LLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
             D     ++LADEI PD CRLWD    E+ DK  F ++   L + Y E+ +RLG  
Sbjct: 185 DKD---GEVLLADEISPDTCRLWDQETNEKLDKDVFRRNLGGLTDAYEEIFKRLGGM 238


>gi|293375938|ref|ZP_06622199.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Turicibacter sanguinis PC909]
 gi|325837357|ref|ZP_08166381.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Turicibacter sp. HGF1]
 gi|292645460|gb|EFF63509.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Turicibacter sanguinis PC909]
 gi|325491015|gb|EGC93311.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Turicibacter sp. HGF1]
          Length = 236

 Score =  243 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 88/237 (37%), Positives = 133/237 (56%), Gaps = 4/237 (1%)

Query: 1   MRPRN-PVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFT 59
           M P    +YE K K I++  +   +I  +KDD    N  + +++  KG+LNN I+  +F 
Sbjct: 1   MNPTRVMLYEGKAKQIFKTDDDHKVIIHYKDDATAFNGVKKSSIANKGILNNAITTIIFE 60

Query: 60  QLGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVE 119
            L K G+  +FI ++N R+QL   VE++PL I VRN  AGS+AKRL I EG      + E
Sbjct: 61  MLEKRGVKTHFIEKLNDRDQLCHKVEIVPLEIIVRNIIAGSMAKRLGIEEGTIPSNVVYE 120

Query: 120 FYYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIK 179
             Y  D+    L++E+H  A + A   E+ ++  +++ IN  +   F   +I+L+DF+I+
Sbjct: 121 LCYKNDAYGDPLINEDHAVALDLATYEELAKIKEMTLEINKALIEFFDAQDIRLIDFKIE 180

Query: 180 CGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
            GR  +     IVLADEI PD CRLWD    E+ DK RF +    + E Y E+  R+
Sbjct: 181 FGRTKN---GEIVLADEISPDTCRLWDKKTNEKLDKDRFRRDLGNVEEAYIEILNRV 234


>gi|193212902|ref|YP_001998855.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chlorobaculum parvum NCIB 8327]
 gi|229485913|sp|B3QP02|PUR7_CHLP8 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|193086379|gb|ACF11655.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chlorobaculum parvum NCIB 8327]
          Length = 235

 Score =  243 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 82/236 (34%), Positives = 130/236 (55%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     ++E K K +++  +P  +IQ FKDD    NN +  ++  KGV NN I+  +FT 
Sbjct: 1   MNKLTLLHEGKAKKVWQTDDPDLIIQEFKDDATAFNNKKKGSIADKGVTNNAIASRLFTM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+ GIP +F+ ++N R+ L + ++++ + +  RN AAGSL +R    EG  L + +VE 
Sbjct: 61  LGENGIPTHFVSKLNDRDMLCKKLDILLIEVVTRNVAAGSLVRRYGFAEGTVLEKPIVEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y   D  +  L++E+H  A       EV ++  ++ +IN  +   F    ++LVDF+++ 
Sbjct: 121 YLKNDDLDDPLMNEDHAVALGLGTYEEVAQLKDMAEKINSLLVPWFAERKLRLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR        I+L DEI PD CR WD    E+ DK RF      + + YSEV RR+
Sbjct: 181 GR----HKGEILLGDEISPDTCRFWDAESGEKLDKDRFRLDLGGVEDAYSEVKRRV 232


>gi|291277151|ref|YP_003516923.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Helicobacter mustelae 12198]
 gi|290964345|emb|CBG40195.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Helicobacter mustelae 12198]
          Length = 240

 Score =  243 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 85/243 (34%), Positives = 126/243 (51%), Gaps = 4/243 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K I+   + G +I  FKDD    N  +     GKG LN  IS  +F  
Sbjct: 1   MEKKQLLYEGKGKRIFATEDAGLVIAEFKDDLTAFNAQKKGQEVGKGALNCAISSLLFAL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K  IP ++ + ++    L + VE+IP+ + VRN A GSL+KRL I EG  LP SLVEF
Sbjct: 61  LEKNHIPTHYKKTLDSTHMLCQKVEIIPIEVVVRNVATGSLSKRLGIEEGKVLPFSLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWA-NQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIK 179
           YY  D     L+++EH        NQ ++E +     +IN  +   F   +++L+DF+++
Sbjct: 121 YYKDDELGDPLINDEHCRILGITQNQEDLEFLKNQGRKINGILQEFFAAKSLRLIDFKLE 180

Query: 180 CGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
            G+        I+LADEI PD CR WD    ++ DK  F +    +   Y EV  R+   
Sbjct: 181 FGK---SAQGEILLADEISPDSCRFWDKDTNQKLDKDIFRQDLGDVYAAYEEVFYRIRSA 237

Query: 240 KKN 242
            ++
Sbjct: 238 NES 240


>gi|327438535|dbj|BAK14900.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Solibacillus silvestris StLB046]
          Length = 236

 Score =  242 bits (618), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 93/237 (39%), Positives = 138/237 (58%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +Y   +   L   +KD     N  + A + GKG LNN+I+  +F +
Sbjct: 1   MNKGQLLYEGKAKRLYTTEDTEILFVEYKDSATAFNGEKKAEIAGKGNLNNQITTLLFEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +F++R++  EQLVR VE+IP+ +  RN AAGSLAKRL + EG  L R +VEF
Sbjct: 61  LQANGIESHFVKRLSANEQLVRKVEIIPIEVVTRNIAAGSLAKRLGLDEGTPLKRPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    +++ EHI   N A   EVE++   ++ +N+ +  +F  + + LVDF+++ 
Sbjct: 121 YYKDDALGDPIITTEHIDVLNIATPIEVEQLYNAALHVNEVLRPIFTAVGVTLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           GR  D     I+LADEI PD CRLWD + K++ DK  F +    L E Y  + ++LG
Sbjct: 181 GRDKD---GNILLADEISPDTCRLWDSTTKQKLDKDVFRRDLGNLTEVYEIILQKLG 234


>gi|225620077|ref|YP_002721334.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Brachyspira hyodysenteriae WA1]
 gi|225214896|gb|ACN83630.1| Phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Brachyspira hyodysenteriae WA1]
          Length = 238

 Score =  242 bits (618), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 84/238 (35%), Positives = 127/238 (53%), Gaps = 3/238 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             +  +YE K K IY       +I ++KDD    N  +  ++  KGV+NN I+  +F  L
Sbjct: 4   EKKEMMYEGKAKKIYATDNADEIIVYYKDDATAFNGEKKGSIKDKGVMNNEITTLLFKML 63

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            K GI  +FI +++ REQL + V++ PL + VRN  AGS+AKRL I EG   P ++ E  
Sbjct: 64  EKNGIKTHFIEKLSDREQLCQKVKIFPLEVIVRNLIAGSMAKRLGIEEGTVPPNTIFEIC 123

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     L+++ H  A   A   E++ +  ++ ++N+ +      I I LVDF+++ G
Sbjct: 124 YKNDEYGDPLINDHHAVALKLATYDELKYIYEVTAKVNNLLKDALDKIGITLVDFKVEFG 183

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
           +    D   I+LADEI PD CR WD    ++ DK RF +    + E Y EV  RL   
Sbjct: 184 KN---DKGEILLADEITPDTCRFWDKETGKKLDKDRFRRDLGSIEEAYIEVLNRLNNL 238


>gi|22299039|ref|NP_682286.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermosynechococcus elongatus BP-1]
 gi|39931950|sp|Q8DIT5|PUR7_THEEB RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|22295221|dbj|BAC09048.1| phosphoribosyl aminoidazole succinocarboxamide synthetase
           [Thermosynechococcus elongatus BP-1]
          Length = 243

 Score =  242 bits (618), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 85/240 (35%), Positives = 131/240 (54%), Gaps = 7/240 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M   +P+YE K KIIY   +P  L+  FKDD    N  +  ++  KGV+N  I+ ++F  
Sbjct: 1   MTQFSPLYEGKAKIIYATADPDVLLAEFKDDATAFNAQKRGSIQNKGVMNCAIASHLFQY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI ++FI ++   +  +R VE+IPL + VRN AAGSL ++  +P GL+L   LVEF
Sbjct: 61  LAAQGITNHFIAQVAPNKMHIRRVEIIPLEVVVRNQAAGSLCRQTGLPLGLALNPPLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y   D     L++ + +     A   EV ++  +++ +N  ++  F    I LVDF+++ 
Sbjct: 121 YLKNDDLGDPLLTPDRLRLLQVATDEEVIQIRQMALAVNTHLSHFFAECGITLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLS----KKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR        I+LADEI PD CRLW+      +K   DK RF +    + E Y+ V +R+
Sbjct: 181 GR---RPTGEILLADEISPDSCRLWNRDESDPEKRILDKDRFRQDLGAIEEAYALVMQRV 237


>gi|119483336|ref|ZP_01618750.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Lyngbya
           sp. PCC 8106]
 gi|119458103|gb|EAW39225.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Lyngbya
           sp. PCC 8106]
          Length = 244

 Score =  242 bits (618), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 82/240 (34%), Positives = 127/240 (52%), Gaps = 7/240 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K KI+Y   +P  L+  FKDD    N  +  T+ GKG +NN IS ++F +
Sbjct: 1   MSAPQKLYEGKAKIVYTTDDPEILLAHFKDDATAFNAQKRGTIQGKGEINNTISTHLFQR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+P +FI      E  V+ V+++P+ + +RN AAGSL K+  I  G  L  +LVE+
Sbjct: 61  LEAEGVPTHFIDTPTANEMRVKRVKIVPIEVIIRNIAAGSLCKQTGIEVGTILEPTLVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L++ + +     A   +++E+  LS++IN  ++  F    I LVDF+++ 
Sbjct: 121 CYKNDQLGDPLLTIDRLLLLKLATPEQLDEIKTLSLKINQVLSEFFEQCRITLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEE----CDKKRFSKSNDQLLEGYSEVARRL 236
           G   D    ++VLADEI PD CRLW+  + +      DK RF      +   Y +V  R+
Sbjct: 181 GYTSD---GKLVLADEISPDTCRLWNKGETDPNLRVMDKDRFRHDLGNVESAYQQVLERV 237


>gi|300817764|ref|ZP_07097979.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 107-1]
 gi|300529752|gb|EFK50814.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 107-1]
          Length = 237

 Score =  242 bits (618), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LAEAGIPTQMERMLSDTECLVKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKANDVLKKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    E+ DK RF +S   L+E Y  VARRLG+
Sbjct: 181 GLY----KGEVVLGDEFSPDGSRLWDKETLEKMDKDRFRQSLGGLIEAYEAVARRLGV 234


>gi|164686997|ref|ZP_02211025.1| hypothetical protein CLOBAR_00623 [Clostridium bartlettii DSM
           16795]
 gi|164603882|gb|EDQ97347.1| hypothetical protein CLOBAR_00623 [Clostridium bartlettii DSM
           16795]
          Length = 231

 Score =  242 bits (618), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 86/232 (37%), Positives = 136/232 (58%), Gaps = 3/232 (1%)

Query: 6   PVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIG 65
            +YE K K +Y        + ++KDD    N  + A++  KG+LNN+I   MF  L K G
Sbjct: 2   LLYEGKAKQVYSTENENEYVVYYKDDATAFNGEKKASIASKGILNNKICTIMFETLEKAG 61

Query: 66  IPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPD 125
           I  +FI+ ++ REQLV+ V ++PL + +RN  AGS  KR  + EG+ L + + E  Y  D
Sbjct: 62  IKTHFIKALSDREQLVKKVTILPLEVIIRNITAGSFCKRYGVEEGIVLDKPIFEMSYKND 121

Query: 126 SSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLLD 185
                L++++H  A   A Q E++ +   +++IN+ M   FL ++++LVDF+++ G+  D
Sbjct: 122 EYGDPLINDDHAVALKLATQEEIDYIREQTLKINEIMKEFFLKMDLKLVDFKLEFGKDAD 181

Query: 186 DDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
                I+LADEI PD CRLWD++  E+ DK RF +    L++GY EV  R+ 
Sbjct: 182 ---GNIILADEISPDTCRLWDVNTNEKLDKDRFRRDLGDLVQGYEEVLSRMN 230


>gi|270047866|pdb|3KRE|A Chain A, Crystal Structure Of Phosphoribosylaminoimidazole-
           Succinocarboxamide Synthase From Ehrlichia Chaffeensis
           At 1.8a Resolution
          Length = 263

 Score =  242 bits (618), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 97/240 (40%), Positives = 148/240 (61%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K KII+  L P  +IQ FKD+    NN + A ++ KG+LNN IS ++  +
Sbjct: 22  MENKEKIYEGKAKIIFATLNPLEVIQHFKDEITAFNNKKAAIIHEKGILNNYISSFLMKK 81

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +FI  +N REQLV+ + +IP+ + +RN AAG+ +KR  I +G      ++EF
Sbjct: 82  LIDKGIKTHFISLLNQREQLVKKITIIPIEVVIRNLAAGNFSKRFQIADGTPFKSPIIEF 141

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSE HI +F W    E+E++  LS++IN+ ++ LF  + I+LVDF+++ 
Sbjct: 142 YYKNDELSDPMVSEGHILSFQWLTNQELEKIKILSLKINNILSELFFNVGIKLVDFKLEF 201

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           G+L +D+   + LADEI PD CRLWD+S  +  DK R+  +   ++EGY EVA +L    
Sbjct: 202 GKLHNDEQSDLFLADEISPDTCRLWDISTNKRLDKDRYRLNLGNVIEGYREVAHKLNAIP 261


>gi|307130021|ref|YP_003882037.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase [Dickeya
           dadantii 3937]
 gi|306527550|gb|ADM97480.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase [Dickeya
           dadantii 3937]
          Length = 237

 Score =  242 bits (617), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 82/238 (34%), Positives = 127/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y   +P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKLAELYRGKAKTVYTTEDPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP   +  ++  E LV+ +EM+P+   VRN AAGSL KRL I EG  L   L + 
Sbjct: 61  LEEAGIPTQMVSLLSDTEVLVKKLEMVPVECVVRNRAAGSLVKRLGITEGEILNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W N+  +  M  LS + N+ ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCKTFGWVNEENLARMKELSYKANEVLSKLFGDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK RF +S   L+E Y EVA RLG+
Sbjct: 181 GLF----KGEVVLGDEFSPDGSRLWDKETLNKMDKDRFRQSLGGLIEAYEEVAHRLGV 234


>gi|229822926|ref|ZP_04448996.1| hypothetical protein GCWU000282_00218 [Catonella morbi ATCC 51271]
 gi|229787739|gb|EEP23853.1| hypothetical protein GCWU000282_00218 [Catonella morbi ATCC 51271]
          Length = 235

 Score =  242 bits (617), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 82/233 (35%), Positives = 130/233 (55%), Gaps = 3/233 (1%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K K +++   P  +   +K+     N  +    + KG LNN I+  +FT L + 
Sbjct: 2   KLLYEGKAKQLFDTGNPEEVYVHYKNSATAFNGVKKEEFDDKGGLNNAITSLIFTYLAEQ 61

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
           GIP +FI+++N  +Q+ R V +IPL +  RN  AGS+AK+  + EG  L + + E  Y  
Sbjct: 62  GIPTHFIKQVNETDQVCRHVTIIPLEVITRNIVAGSMAKKYGLEEGRQLAKPVFELSYKN 121

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D     L++++H  A     ++E+ ++  L+ RIN  +  LFL  N+ LVDF+I+ G+  
Sbjct: 122 DELGDPLINDDHAVALELVTEAELAQIKDLTARINRALQDLFLAANLILVDFKIEFGKTS 181

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           D    +I+LADEI PD CRLWD   +++ DK RF +    ++  Y EV  RL 
Sbjct: 182 D---GQIILADEISPDTCRLWDKDTRDKLDKDRFRRDLGDVMAAYKEVLGRLE 231


>gi|16761404|ref|NP_457021.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           CT18]
 gi|16765807|ref|NP_461422.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|29140899|ref|NP_804241.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           Ty2]
 gi|56412631|ref|YP_149706.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. ATCC 9150]
 gi|62181052|ref|YP_217469.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161612763|ref|YP_001586728.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Paratyphi B
           str. SPB7]
 gi|167549498|ref|ZP_02343257.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|167991792|ref|ZP_02572891.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168232033|ref|ZP_02657091.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|168238207|ref|ZP_02663265.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168243260|ref|ZP_02668192.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|168261478|ref|ZP_02683451.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|168466770|ref|ZP_02700624.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|168817762|ref|ZP_02829762.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|194446216|ref|YP_002041746.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194450217|ref|YP_002046550.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|194469697|ref|ZP_03075681.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194737675|ref|YP_002115549.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197250243|ref|YP_002147438.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
 gi|197262008|ref|ZP_03162082.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197361566|ref|YP_002141202.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. AKU_12601]
 gi|198243232|ref|YP_002216554.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|204929617|ref|ZP_03220691.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205353590|ref|YP_002227391.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|207857898|ref|YP_002244549.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Enteritidis
           str. P125109]
 gi|213023835|ref|ZP_03338282.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           404ty]
 gi|213425359|ref|ZP_03358109.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E02-1180]
 gi|213583284|ref|ZP_03365110.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E98-0664]
 gi|224582981|ref|YP_002636779.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|238913624|ref|ZP_04657461.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Tennessee
           str. CDC07-0191]
 gi|289806226|ref|ZP_06536855.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           AG3]
 gi|289829328|ref|ZP_06546940.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E98-3139]
 gi|54038935|sp|P65890|PUR7_SALTI RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|54041751|sp|P65889|PUR7_SALTY RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|81309628|sp|Q57LM4|PUR7_SALCH RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|81821572|sp|Q5PLR9|PUR7_SALPA RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|189038197|sp|A9N2Z5|PUR7_SALPB RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229568614|sp|B5F0L3|PUR7_SALA4 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229568615|sp|B5FQH7|PUR7_SALDC RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229568616|sp|B5RCV7|PUR7_SALG2 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229568618|sp|B4TR59|PUR7_SALSV RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229568619|sp|B5BB18|PUR7_SALPK RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229568620|sp|B4T0L4|PUR7_SALNS RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229568621|sp|B4TD62|PUR7_SALHS RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229568622|sp|B5R4J4|PUR7_SALEP RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|254783973|sp|C0PYS1|PUR7_SALPC RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|25293575|pir||AC0817 phosphoribosylaminoimidazole-succinocarboxamide synthase [imported]
           - Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)
 gi|16421029|gb|AAL21381.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|16503704|emb|CAD02687.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29136524|gb|AAO68090.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           Ty2]
 gi|56126888|gb|AAV76394.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. ATCC 9150]
 gi|62128685|gb|AAX66388.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase (SAICAR
           synthetase) [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161362127|gb|ABX65895.1| hypothetical protein SPAB_00462 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404879|gb|ACF65101.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194408521|gb|ACF68740.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|194456061|gb|EDX44900.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194713177|gb|ACF92398.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195630834|gb|EDX49426.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|197093042|emb|CAR58480.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. AKU_12601]
 gi|197213946|gb|ACH51343.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
 gi|197240263|gb|EDY22883.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197288954|gb|EDY28327.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197937748|gb|ACH75081.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|204321336|gb|EDZ06536.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205273371|emb|CAR38343.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|205325238|gb|EDZ13077.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205329903|gb|EDZ16667.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205333712|gb|EDZ20476.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|205337622|gb|EDZ24386.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|205344980|gb|EDZ31744.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|205349366|gb|EDZ35997.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|206709701|emb|CAR34051.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Enteritidis
           str. P125109]
 gi|224467508|gb|ACN45338.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|261247686|emb|CBG25513.1| SAICAR synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267994597|gb|ACY89482.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. 14028S]
 gi|301159039|emb|CBW18552.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. SL1344]
 gi|312913475|dbj|BAJ37449.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. T000240]
 gi|320086979|emb|CBY96749.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
 gi|321222811|gb|EFX47882.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|322613774|gb|EFY10713.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 315996572]
 gi|322619483|gb|EFY16359.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-1]
 gi|322624988|gb|EFY21817.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-3]
 gi|322629569|gb|EFY26345.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-4]
 gi|322634001|gb|EFY30738.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 515920-1]
 gi|322635561|gb|EFY32272.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 515920-2]
 gi|322639943|gb|EFY36617.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 531954]
 gi|322644385|gb|EFY40926.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. NC_MB110209-0054]
 gi|322652088|gb|EFY48450.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. OH_2009072675]
 gi|322655251|gb|EFY51560.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. CASC_09SCPH15965]
 gi|322658298|gb|EFY54564.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 19N]
 gi|322664298|gb|EFY60495.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 81038-01]
 gi|322669466|gb|EFY65615.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MD_MDA09249507]
 gi|322673193|gb|EFY69299.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 414877]
 gi|322676584|gb|EFY72652.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 366867]
 gi|322683335|gb|EFY79349.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 413180]
 gi|322685779|gb|EFY81772.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 446600]
 gi|322715535|gb|EFZ07106.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
 gi|323130817|gb|ADX18247.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. 4/74]
 gi|323192544|gb|EFZ77773.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 609458-1]
 gi|323199589|gb|EFZ84680.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 556150-1]
 gi|323201253|gb|EFZ86321.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 609460]
 gi|323208083|gb|EFZ93028.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 507440-20]
 gi|323210194|gb|EFZ95095.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 556152]
 gi|323217060|gb|EGA01782.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB101509-0077]
 gi|323220601|gb|EGA05050.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB102109-0047]
 gi|323225479|gb|EGA09710.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB110209-0055]
 gi|323229251|gb|EGA13375.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB111609-0052]
 gi|323235434|gb|EGA19518.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 2009083312]
 gi|323237380|gb|EGA21443.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 2009085258]
 gi|323245135|gb|EGA29136.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 315731156]
 gi|323248838|gb|EGA32764.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2009159199]
 gi|323253125|gb|EGA36957.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008282]
 gi|323258713|gb|EGA42374.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008283]
 gi|323260618|gb|EGA44228.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008284]
 gi|323266394|gb|EGA49882.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008285]
 gi|323269775|gb|EGA53225.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008287]
 gi|326624309|gb|EGE30654.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Dublin str.
           3246]
 gi|326628687|gb|EGE35030.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 9]
 gi|332989415|gb|AEF08398.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. UK-1]
          Length = 237

 Score =  242 bits (617), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 79/238 (33%), Positives = 126/238 (52%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ +EM+P+   VRN AAGSL KRL + EG+ L   + + 
Sbjct: 61  LAEAGIPTQMERLLSDTECLVKKLEMVPVECVVRNRAAGSLVKRLGVEEGMELNPPIFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+  +   F W +Q  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDALHDPMVNSSYCETFGWVSQENLARMKELTYKANDVLKKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    ++ DK RF +S   L+E Y  VA RLG+
Sbjct: 181 GLY----KGEVVLGDEFSPDGSRLWDKETLDKMDKDRFRQSLGGLIEAYEAVAHRLGV 234


>gi|118444268|ref|YP_878496.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium novyi NT]
 gi|171472988|sp|A0Q1J4|PUR7_CLONN RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|118134724|gb|ABK61768.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium novyi NT]
          Length = 235

 Score =  242 bits (617), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 86/236 (36%), Positives = 136/236 (57%), Gaps = 5/236 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +YE  +   +I ++KDD    N  + + ++ KG+LNN I+  +F  
Sbjct: 1   MEK-KMLYEGKAKKVYEAEDKDHVIIYYKDDATAFNGAKKSQIDHKGILNNNITSAIFEM 59

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +F +++N REQL + VE++PL + VRN AAGS+AKRL + EG  L  ++ E 
Sbjct: 60  LHEKGIETHFEKKLNEREQLCKKVEIVPLEVIVRNVAAGSMAKRLGVSEGKELNTTIFEI 119

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A   A   E++E+  ++  +N+ +   FL  NI+L+DF+++ 
Sbjct: 120 CYKNDELGDPLINDYHAVALGLATFDELKEIYNITSNVNNILKEFFLKQNIKLIDFKLEF 179

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR       +I+LADEI PD CR WD +  E+ DK RF +    + E Y E+  R+
Sbjct: 180 GRF----NGKIILADEISPDTCRFWDATTNEKLDKDRFRRDMGNVEEAYIEILNRI 231


>gi|227328303|ref|ZP_03832327.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pectobacterium carotovorum subsp. carotovorum WPP14]
          Length = 237

 Score =  242 bits (617), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 127/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y   +P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKLAELYRGKAKTVYTTEDPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP   +  ++  E LV+ +EM+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LEEAGIPTQMVSLLSDNEVLVKKLEMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D     +V+E +   F W N+  +  M  LS + ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDEMHDPMVNESYCKTFGWVNEENLARMKELSYKANDVLSKLFGDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK RF +S   L+E Y EVA R+G+
Sbjct: 181 GLF----KGEVVLGDEFSPDGSRLWDKETLNKMDKDRFRQSLGGLIEAYEEVAHRIGV 234


>gi|188996787|ref|YP_001931038.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188931854|gb|ACD66484.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 232

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 85/233 (36%), Positives = 131/233 (56%), Gaps = 3/233 (1%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K KI+Y+   P  +I +FKD+    N  +   + GKG+LNN+IS   FT L + 
Sbjct: 2   EKLYEGKAKIVYQSESPNHVIIYFKDEATAFNAQKKDVIEGKGILNNKISSIFFTLLNQA 61

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
           G+  +FI++I+ RE L    ++IP+ + VRN A GS+ KRL IPE       L+EFYY  
Sbjct: 62  GVKTHFIKQISDREMLAYKTKIIPIEVVVRNLATGSIVKRLGIPEKTEFNPPLIEFYYKN 121

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D+    ++  EH+     A + +V+ +  +++++N  +    +  +I LVDF+++ G+L 
Sbjct: 122 DALGDPIICYEHVLVMKLATEEDVKTIKEMALKVNQILRDFLIKHDIILVDFKLEFGKLY 181

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           D     IV+ADEI PD CR WD    E  DK RF  +   L + Y EV  R+ 
Sbjct: 182 D---GTIVVADEISPDTCRFWDAKTGERMDKDRFRLNLGDLAKFYQEVLERIE 231


>gi|294635438|ref|ZP_06713926.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Edwardsiella tarda ATCC 23685]
 gi|291091171|gb|EFE23732.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Edwardsiella tarda ATCC 23685]
          Length = 237

 Score =  241 bits (616), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 84/241 (34%), Positives = 129/241 (53%), Gaps = 4/241 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y    P  LI  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKLAELYRGKAKTVYATDNPDLLILSFRNDTSALDGQRIEQFDRKGMVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ +EM+P+   +RN AAGSL KRL I EG  L   L + 
Sbjct: 61  LEEAGIPTQMERLLSDTEVLVKKLEMVPVECVIRNRAAGSLVKRLGIEEGKVLNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W + + + +M ALS R N+ ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCRTFGWVSDAHLAQMKALSYRANEVLSQLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           G         +VL DE  PD  RLWD    E+ DK RF ++   L+E Y EVA RLG+  
Sbjct: 181 GLF----KGEVVLGDEFSPDGSRLWDKVTLEKMDKDRFRQNLGGLIEAYEEVAHRLGVAL 236

Query: 241 K 241
            
Sbjct: 237 D 237


>gi|253687535|ref|YP_003016725.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|259546892|sp|C6DBS2|PUR7_PECCP RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|251754113|gb|ACT12189.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 237

 Score =  241 bits (616), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y   +P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKLAELYRGKAKTVYTTEDPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP   +  ++  E LV+ +EM+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LEEAGIPTQMVSLLSDNEVLVKKLEMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W N+  +  M  LS + ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCKTFGWVNEENLARMKELSYKANDVLSKLFGDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK RF +S   L+E Y EVA R+G+
Sbjct: 181 GLF----KGEVVLGDEFSPDGSRLWDKETLNKMDKDRFRQSLGGLIEAYEEVAHRIGV 234


>gi|161502362|ref|YP_001569474.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|189038196|sp|A9MHQ4|PUR7_SALAR RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|160863709|gb|ABX20332.1| hypothetical protein SARI_00395 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 237

 Score =  241 bits (616), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEKFDRKGMVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ +EM+P+   VRN AAGSL KRL + EG+ L   + + 
Sbjct: 61  LAEAGIPTQMERLLSDTECLVKKLEMVPVECVVRNRAAGSLVKRLGVEEGMELNPPIFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+  +   F W +Q  +  M AL+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDALHDPMVNSSYCETFGWVSQENLARMKALTYKANDVLKKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    ++ DK RF +S   L+E Y  VARRLG+
Sbjct: 181 GLY----KGEVVLGDEFSPDGSRLWDKETLDKMDKDRFRQSLGGLIEAYEAVARRLGV 234


>gi|227115378|ref|ZP_03829034.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pectobacterium carotovorum subsp. brasiliensis PBR1692]
          Length = 237

 Score =  241 bits (616), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 80/238 (33%), Positives = 127/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y   +P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKLAELYRGKAKTVYTTEDPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP   +  ++  E LV+ ++M+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LEEAGIPTQMVSLLSDNEVLVKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D     +V+E +   F W N+  +  M  LS + ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDEMHDPMVNESYCKTFGWVNEENLARMKELSYKANDVLSKLFGDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK RF +S   L+E Y EVA R+G+
Sbjct: 181 GLF----KGEVVLGDEFSPDGSRLWDKETLNKMDKDRFRQSLGGLIEAYEEVAHRIGV 234


>gi|312127498|ref|YP_003992372.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caldicellulosiruptor hydrothermalis 108]
 gi|311777517|gb|ADQ07003.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caldicellulosiruptor hydrothermalis 108]
          Length = 240

 Score =  241 bits (616), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 88/234 (37%), Positives = 134/234 (57%), Gaps = 4/234 (1%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K K +YE   P  ++  +KDD    +  +   +N KGV+NN ++ + F  L   
Sbjct: 7   KLLYEGKAKKVYETENPDVVVIEYKDDATAFDGTKRGIINNKGVVNNLVANHFFKILETN 66

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
            IP +FI +I+ R+  V+ V++IP+ + VRN AAGSL KRL + EG  L R ++EF Y  
Sbjct: 67  KIPTHFIEQIDERKTAVKKVQIIPVEVIVRNVAAGSLCKRLGLEEGAILKRPILEFCYKN 126

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D+     V++ HI A   A + E+ ++   S +IND +      +NI L+DF+++ GR  
Sbjct: 127 DALHDPQVNQYHILALELATEGEIRKIEEYSFKINDVLRNYLKQVNIDLIDFKLEFGRY- 185

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
                 ++LADEI PD CR WD + KE+ DK RF +    + E Y E+ RRLG+
Sbjct: 186 ---KGEVILADEISPDTCRFWDTTTKEKLDKDRFRRDLGNVEEAYMEILRRLGL 236


>gi|82544924|ref|YP_408871.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           boydii Sb227]
 gi|123559029|sp|Q31Y15|PUR7_SHIBS RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|81246335|gb|ABB67043.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Shigella boydii Sb227]
 gi|320185169|gb|EFW59949.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           flexneri CDC 796-83]
 gi|332092957|gb|EGI98023.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           boydii 3594-74]
          Length = 237

 Score =  241 bits (616), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 80/238 (33%), Positives = 127/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LAEAGIPTQMERLLSDTECLVKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND +   F    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKANDVLKKRFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    E+ DK RF +S   L+E Y  VARRLG+
Sbjct: 181 GLY----KGEVVLGDEFSPDGSRLWDKETLEKMDKDRFRQSLGGLIEAYEAVARRLGV 234


>gi|320539570|ref|ZP_08039237.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Serratia symbiotica str. Tucson]
 gi|320030423|gb|EFW12435.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Serratia symbiotica str. Tucson]
          Length = 237

 Score =  241 bits (616), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 83/238 (34%), Positives = 130/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y    P  L+  F++D    +  R      KG++NN+ + ++  +
Sbjct: 1   MQKLAELYRGKAKTVYTTENPDLLVLEFRNDTSALDGQRIEQFARKGMVNNKFNHFIMNK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ +EM+P+   +RN AAGSL KRL I EG  L   L + 
Sbjct: 61  LQEAGIPTQMERLLSDNEVLVKKLEMVPVECVIRNHAAGSLVKRLGIEEGQVLTPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W +++ +  M  LS + ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCETFGWVSKAHLARMRELSYQANDVLSKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G   D     +VL DE  PD CRLWD +  ++ DK RF +S   L+E Y EVARR+G+
Sbjct: 181 GLFND----EVVLGDEFSPDGCRLWDKTTLDKMDKDRFRQSLGGLIEAYEEVARRIGV 234


>gi|255534938|ref|YP_003095309.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Flavobacteriaceae bacterium 3519-10]
 gi|255341134|gb|ACU07247.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Flavobacteriaceae bacterium 3519-10]
          Length = 239

 Score =  241 bits (616), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 92/242 (38%), Positives = 138/242 (57%), Gaps = 3/242 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K ++E   P  +I  FKDD    N  +  +++ KG +NN I+  +F  
Sbjct: 1   MKKGAMLYEGKAKQVFETDHPDEVIVRFKDDATAFNAQKRGSVDLKGEMNNAITTLIFEY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GIP +FI++I+ REQLV+ V +IPL + VRN +AGS+A+RL + EG+  P ++ + 
Sbjct: 61  LNKKGIPTHFIKQIDEREQLVKKVNIIPLEMVVRNYSAGSMAQRLGVAEGIKSPVTIFDI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H      A   E++EM  L+  IND +  LF  +NI LVDF+I+ 
Sbjct: 121 CYKKDELGDPLINDHHAVFLGAATYEELDEMYELTSDINDILIELFDSMNIILVDFKIEL 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           G+  +    +I+LADEI PD CRLWD    ++ DK RF +    + E Y E+  RL    
Sbjct: 181 GKTSN---GKIILADEISPDTCRLWDKDTMKKLDKDRFRRDLGGVTEAYVEIYERLKKVL 237

Query: 241 KN 242
             
Sbjct: 238 DK 239


>gi|15802999|ref|NP_289029.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 EDL933]
 gi|15832592|ref|NP_311365.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. Sakai]
 gi|16130401|ref|NP_416971.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli str. K-12 substr. MG1655]
 gi|30063855|ref|NP_838026.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           flexneri 2a str. 2457T]
 gi|56480114|ref|NP_708315.2| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           flexneri 2a str. 301]
 gi|89109282|ref|AP_003062.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli str. K-12 substr. W3110]
 gi|110642650|ref|YP_670380.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli 536]
 gi|110806409|ref|YP_689929.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           flexneri 5 str. 8401]
 gi|157156219|ref|YP_001463800.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli E24377A]
 gi|157161937|ref|YP_001459255.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli HS]
 gi|168748470|ref|ZP_02773492.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC4113]
 gi|168756243|ref|ZP_02781250.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC4401]
 gi|168761080|ref|ZP_02786087.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC4501]
 gi|168768563|ref|ZP_02793570.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC4486]
 gi|168773615|ref|ZP_02798622.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC4196]
 gi|168778437|ref|ZP_02803444.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC4076]
 gi|168787817|ref|ZP_02812824.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC869]
 gi|168798842|ref|ZP_02823849.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC508]
 gi|170019239|ref|YP_001724193.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli ATCC 8739]
 gi|170082086|ref|YP_001731406.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli str. K-12 substr. DH10B]
 gi|170683399|ref|YP_001744659.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli SMS-3-5]
 gi|170767381|ref|ZP_02901834.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia albertii TW07627]
 gi|187731713|ref|YP_001881268.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           boydii CDC 3083-94]
 gi|188494463|ref|ZP_03001733.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli 53638]
 gi|191167636|ref|ZP_03029446.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli B7A]
 gi|191172955|ref|ZP_03034490.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli F11]
 gi|193064737|ref|ZP_03045815.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli E22]
 gi|193068310|ref|ZP_03049273.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli E110019]
 gi|194427345|ref|ZP_03059895.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli B171]
 gi|194437659|ref|ZP_03069755.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli 101-1]
 gi|195936618|ref|ZP_03082000.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC4024]
 gi|208806413|ref|ZP_03248750.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC4206]
 gi|208812719|ref|ZP_03254048.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC4045]
 gi|208821492|ref|ZP_03261812.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC4042]
 gi|209396021|ref|YP_002271945.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC4115]
 gi|209919951|ref|YP_002294035.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli SE11]
 gi|215487780|ref|YP_002330211.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O127:H6 str. E2348/69]
 gi|217327576|ref|ZP_03443659.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. TW14588]
 gi|218548090|ref|YP_002381881.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia fergusonii ATCC 35469]
 gi|218555002|ref|YP_002387915.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli IAI1]
 gi|218559412|ref|YP_002392325.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli S88]
 gi|218690603|ref|YP_002398815.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli ED1a]
 gi|218696105|ref|YP_002403772.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli 55989]
 gi|218705975|ref|YP_002413494.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli UMN026]
 gi|227887515|ref|ZP_04005320.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli 83972]
 gi|238901641|ref|YP_002927437.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli BW2952]
 gi|253772632|ref|YP_003035463.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254162451|ref|YP_003045559.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli B str. REL606]
 gi|254794421|ref|YP_003079258.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. TW14359]
 gi|256017380|ref|ZP_05431245.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           sp. D9]
 gi|256021838|ref|ZP_05435703.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia sp. 4_1_40B]
 gi|260845110|ref|YP_003222888.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli O103:H2 str. 12009]
 gi|260856571|ref|YP_003230462.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli O26:H11 str. 11368]
 gi|260869166|ref|YP_003235568.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli O111:H- str. 11128]
 gi|261223091|ref|ZP_05937372.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. FRIK2000]
 gi|261259357|ref|ZP_05951890.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. FRIK966]
 gi|291283696|ref|YP_003500514.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O55:H7 str. CB9615]
 gi|293405912|ref|ZP_06649904.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli FVEC1412]
 gi|293410871|ref|ZP_06654447.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli B354]
 gi|293446831|ref|ZP_06663253.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli B088]
 gi|297520533|ref|ZP_06938919.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli OP50]
 gi|298381660|ref|ZP_06991259.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli FVEC1302]
 gi|300820862|ref|ZP_07101012.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 119-7]
 gi|300897645|ref|ZP_07116049.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 198-1]
 gi|300903484|ref|ZP_07121409.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 84-1]
 gi|300921406|ref|ZP_07137766.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 115-1]
 gi|300922180|ref|ZP_07138317.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 182-1]
 gi|300930088|ref|ZP_07145514.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 187-1]
 gi|300940282|ref|ZP_07154879.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 21-1]
 gi|300951826|ref|ZP_07165638.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 116-1]
 gi|300957174|ref|ZP_07169409.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 175-1]
 gi|300981815|ref|ZP_07175747.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 45-1]
 gi|300997967|ref|ZP_07181898.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 200-1]
 gi|301023837|ref|ZP_07187570.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 196-1]
 gi|301024677|ref|ZP_07188323.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 69-1]
 gi|301046363|ref|ZP_07193524.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 185-1]
 gi|301302826|ref|ZP_07208954.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 124-1]
 gi|301328997|ref|ZP_07222024.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 78-1]
 gi|301644466|ref|ZP_07244463.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 146-1]
 gi|306814446|ref|ZP_07448608.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli NC101]
 gi|307139110|ref|ZP_07498466.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli H736]
 gi|307312531|ref|ZP_07592164.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli W]
 gi|309794483|ref|ZP_07688906.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 145-7]
 gi|312967765|ref|ZP_07781980.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli 2362-75]
 gi|312973289|ref|ZP_07787461.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli 1827-70]
 gi|331658626|ref|ZP_08359570.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli TA206]
 gi|331664033|ref|ZP_08364943.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli TA143]
 gi|331669215|ref|ZP_08370063.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli TA271]
 gi|331684130|ref|ZP_08384726.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli H299]
 gi|67471593|sp|P0A7D7|PUR7_ECOLI RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|67471594|sp|P0A7D8|PUR7_ECOL6 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|67471595|sp|P0A7D9|PUR7_ECO57 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|67471596|sp|P0A7E0|PUR7_SHIFL RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|123048024|sp|Q0T241|PUR7_SHIF8 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|123048984|sp|Q0TF00|PUR7_ECOL5 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|167011917|sp|A7ZPS1|PUR7_ECO24 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|167011918|sp|A8A2W8|PUR7_ECOHS RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|189038232|sp|B1IWI3|PUR7_ECOLC RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|226723543|sp|B7MHW9|PUR7_ECO45 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|226723545|sp|B7M7H9|PUR7_ECO8A RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|226723546|sp|B7N658|PUR7_ECOLU RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|226723547|sp|B1LNC6|PUR7_ECOSM RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|226723548|sp|B7LKG5|PUR7_ESCF3 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229564391|sp|B5Z013|PUR7_ECO5E RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229564392|sp|B1XAE8|PUR7_ECODH RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229564393|sp|B6I546|PUR7_ECOSE RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229568617|sp|B2TXQ2|PUR7_SHIB3 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|254783960|sp|B7UGM6|PUR7_ECO27 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|254783961|sp|B7LCL4|PUR7_ECO55 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|254783962|sp|B7MYB5|PUR7_ECO81 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|259546855|sp|C4ZX51|PUR7_ECOBW RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|109157959|pdb|2GQS|A Chain A, Saicar Synthetase Complexed With Cair-Mg2+ And Adp
 gi|109157960|pdb|2GQS|B Chain B, Saicar Synthetase Complexed With Cair-Mg2+ And Adp
 gi|12516858|gb|AAG57586.1|AE005477_4 phosphoribosylaminoimidazole-succinocarboxamide synthetase = SAICAR
           synthetase [Escherichia coli O157:H7 str. EDL933]
 gi|147410|gb|AAA24448.1| 5'-phosphoribosyl-5-aminoimidazole-4- N-succinocarboxamide
           synthetase [Escherichia coli]
 gi|1788820|gb|AAC75529.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli str. K-12 substr. MG1655]
 gi|1799903|dbj|BAA16353.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli str. K12 substr. W3110]
 gi|13362808|dbj|BAB36761.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli O157:H7 str. Sakai]
 gi|30042110|gb|AAP17836.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase, SAICAR
           synthetase [Shigella flexneri 2a str. 2457T]
 gi|56383665|gb|AAN44022.2| phosphoribosylaminoimidazole-succinocarboxamide synthetase, SAICAR
           synthetase [Shigella flexneri 2a str. 301]
 gi|110344242|gb|ABG70479.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli 536]
 gi|110615957|gb|ABF04624.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Shigella flexneri 5 str. 8401]
 gi|157067617|gb|ABV06872.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli HS]
 gi|157078249|gb|ABV17957.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli E24377A]
 gi|169754167|gb|ACA76866.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli ATCC 8739]
 gi|169889921|gb|ACB03628.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli str. K-12 substr. DH10B]
 gi|170123715|gb|EDS92646.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia albertii TW07627]
 gi|170521117|gb|ACB19295.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli SMS-3-5]
 gi|187428705|gb|ACD07979.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           boydii CDC 3083-94]
 gi|187770570|gb|EDU34414.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC4196]
 gi|188017104|gb|EDU55226.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC4113]
 gi|188489662|gb|EDU64765.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli 53638]
 gi|189003264|gb|EDU72250.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC4076]
 gi|189356615|gb|EDU75034.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC4401]
 gi|189362285|gb|EDU80704.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC4486]
 gi|189368462|gb|EDU86878.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC4501]
 gi|189372333|gb|EDU90749.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC869]
 gi|189378667|gb|EDU97083.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC508]
 gi|190902316|gb|EDV62055.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli B7A]
 gi|190906819|gb|EDV66423.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli F11]
 gi|192927620|gb|EDV82236.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli E22]
 gi|192958262|gb|EDV88702.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli E110019]
 gi|194414666|gb|EDX30938.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli B171]
 gi|194423465|gb|EDX39456.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli 101-1]
 gi|208726214|gb|EDZ75815.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC4206]
 gi|208733996|gb|EDZ82683.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC4045]
 gi|208741615|gb|EDZ89297.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC4042]
 gi|209157421|gb|ACI34854.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC4115]
 gi|209763718|gb|ACI80171.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli]
 gi|209763720|gb|ACI80172.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli]
 gi|209763722|gb|ACI80173.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli]
 gi|209763724|gb|ACI80174.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli]
 gi|209763726|gb|ACI80175.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli]
 gi|209913210|dbj|BAG78284.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli SE11]
 gi|215265852|emb|CAS10261.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli O127:H6 str. E2348/69]
 gi|217319943|gb|EEC28368.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. TW14588]
 gi|218352837|emb|CAU98629.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli 55989]
 gi|218355631|emb|CAQ88242.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia fergusonii ATCC 35469]
 gi|218361770|emb|CAQ99367.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli IAI1]
 gi|218366181|emb|CAR03927.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli S88]
 gi|218428167|emb|CAR09081.2| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli ED1a]
 gi|218433072|emb|CAR13967.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli UMN026]
 gi|222034196|emb|CAP76937.1| Phosphoribosylaminoimidazole-succinocarboxamide [Escherichia coli
           LF82]
 gi|227835865|gb|EEJ46331.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli 83972]
 gi|238862059|gb|ACR64057.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli BW2952]
 gi|242378076|emb|CAQ32847.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli BL21(DE3)]
 gi|253323676|gb|ACT28278.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253974352|gb|ACT40023.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Escherichia coli B str. REL606]
 gi|253978519|gb|ACT44189.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Escherichia coli BL21(DE3)]
 gi|254593821|gb|ACT73182.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli O157:H7 str. TW14359]
 gi|257755220|dbj|BAI26722.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli O26:H11 str. 11368]
 gi|257760257|dbj|BAI31754.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli O103:H2 str. 12009]
 gi|257765522|dbj|BAI37017.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli O111:H- str. 11128]
 gi|260448445|gb|ACX38867.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli DH1]
 gi|281179539|dbj|BAI55869.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli SE15]
 gi|281601879|gb|ADA74863.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           flexneri 2002017]
 gi|284922423|emb|CBG35510.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli 042]
 gi|290763569|gb|ADD57530.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O55:H7 str. CB9615]
 gi|291323661|gb|EFE63089.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli B088]
 gi|291428120|gb|EFF01147.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli FVEC1412]
 gi|291471339|gb|EFF13823.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli B354]
 gi|294491666|gb|ADE90422.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli IHE3034]
 gi|298279102|gb|EFI20616.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli FVEC1302]
 gi|299880637|gb|EFI88848.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 196-1]
 gi|300301645|gb|EFJ58030.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 185-1]
 gi|300304068|gb|EFJ58588.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 200-1]
 gi|300316018|gb|EFJ65802.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 175-1]
 gi|300358621|gb|EFJ74491.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 198-1]
 gi|300396458|gb|EFJ79996.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 69-1]
 gi|300404516|gb|EFJ88054.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 84-1]
 gi|300408892|gb|EFJ92430.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 45-1]
 gi|300411640|gb|EFJ94950.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 115-1]
 gi|300421495|gb|EFK04806.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 182-1]
 gi|300448957|gb|EFK12577.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 116-1]
 gi|300454923|gb|EFK18416.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 21-1]
 gi|300462015|gb|EFK25508.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 187-1]
 gi|300526615|gb|EFK47684.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 119-7]
 gi|300841761|gb|EFK69521.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 124-1]
 gi|300844631|gb|EFK72391.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 78-1]
 gi|301077211|gb|EFK92017.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 146-1]
 gi|305851840|gb|EFM52292.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli NC101]
 gi|306907454|gb|EFN37958.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli W]
 gi|307554508|gb|ADN47283.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli ABU 83972]
 gi|308121939|gb|EFO59201.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 145-7]
 gi|309702756|emb|CBJ02085.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli ETEC H10407]
 gi|310331884|gb|EFP99119.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli 1827-70]
 gi|312287962|gb|EFR15867.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli 2362-75]
 gi|312947061|gb|ADR27888.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O83:H1 str. NRG 857C]
 gi|313650932|gb|EFS15332.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           flexneri 2a str. 2457T]
 gi|315061794|gb|ADT76121.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli W]
 gi|315137099|dbj|BAJ44258.1| phosphoribosylaminoimidazole succinocarboxamide synthetase
           [Escherichia coli DH1]
 gi|315256490|gb|EFU36458.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 85-1]
 gi|315288089|gb|EFU47489.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 110-3]
 gi|315292427|gb|EFU51779.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 153-1]
 gi|315300463|gb|EFU59693.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 16-3]
 gi|315615719|gb|EFU96351.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli 3431]
 gi|320180460|gb|EFW55391.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           boydii ATCC 9905]
 gi|320188808|gb|EFW63467.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC1212]
 gi|320196320|gb|EFW70944.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli WV_060327]
 gi|320200037|gb|EFW74626.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli EC4100B]
 gi|320640980|gb|EFX10464.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. G5101]
 gi|320646262|gb|EFX15189.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H- str. 493-89]
 gi|320651768|gb|EFX20148.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H- str. H 2687]
 gi|320657153|gb|EFX24962.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320662759|gb|EFX30091.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O55:H7 str. USDA 5905]
 gi|320667799|gb|EFX34710.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. LSU-61]
 gi|323156078|gb|EFZ42237.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli EPECa14]
 gi|323159327|gb|EFZ45312.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli E128010]
 gi|323170263|gb|EFZ55916.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli LT-68]
 gi|323177404|gb|EFZ62992.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli 1180]
 gi|323184469|gb|EFZ69844.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli 1357]
 gi|323188220|gb|EFZ73513.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli RN587/1]
 gi|323377625|gb|ADX49893.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli KO11]
 gi|323936368|gb|EGB32658.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli E1520]
 gi|323941268|gb|EGB37453.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli E482]
 gi|323944695|gb|EGB40762.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli H120]
 gi|323949491|gb|EGB45379.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli H252]
 gi|323955725|gb|EGB51483.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli H263]
 gi|323961269|gb|EGB56881.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli H489]
 gi|323967920|gb|EGB63332.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli M863]
 gi|323971003|gb|EGB66252.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli TA007]
 gi|323977346|gb|EGB72432.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli TW10509]
 gi|324011203|gb|EGB80422.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 60-1]
 gi|324020150|gb|EGB89369.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli MS 117-3]
 gi|324112967|gb|EGC06943.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia fergusonii B253]
 gi|324118180|gb|EGC12077.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli E1167]
 gi|325496493|gb|EGC94352.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia fergusonii ECD227]
 gi|326340271|gb|EGD64075.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. 1125]
 gi|326344956|gb|EGD68700.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. 1044]
 gi|327252126|gb|EGE63798.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli STEC_7v]
 gi|331054291|gb|EGI26318.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli TA206]
 gi|331059832|gb|EGI31809.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli TA143]
 gi|331064409|gb|EGI36320.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli TA271]
 gi|331079082|gb|EGI50284.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli H299]
 gi|332087917|gb|EGI93042.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           boydii 5216-82]
 gi|332344295|gb|AEE57629.1| phosphoribosylaminoimidazole-succinocarboxamide synthase PurC
           [Escherichia coli UMNK88]
 gi|332755117|gb|EGJ85482.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           flexneri 4343-70]
 gi|332756550|gb|EGJ86901.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           flexneri 2747-71]
 gi|332766282|gb|EGJ96492.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           flexneri 2930-71]
 gi|333001609|gb|EGK21177.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           flexneri VA-6]
 gi|333001785|gb|EGK21351.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           flexneri K-218]
 gi|333016502|gb|EGK35833.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           flexneri K-304]
          Length = 237

 Score =  241 bits (616), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LAEAGIPTQMERLLSDTECLVKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKANDVLKKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    E+ DK RF +S   L+E Y  VARRLG+
Sbjct: 181 GLY----KGEVVLGDEFSPDGSRLWDKETLEKMDKDRFRQSLGGLIEAYEAVARRLGV 234


>gi|110598416|ref|ZP_01386688.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chlorobium ferrooxidans DSM 13031]
 gi|110339950|gb|EAT58453.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chlorobium ferrooxidans DSM 13031]
          Length = 237

 Score =  241 bits (616), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 85/236 (36%), Positives = 127/236 (53%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K ++   +   +IQ FKDD    NN +  ++  KGV+NN IS  +FT 
Sbjct: 2   MNKTTQLYEGKAKKVFLTDDSDLVIQEFKDDATAFNNKKKGSIADKGVVNNAISCKLFTL 61

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  + + +++ RE L R +++I + + VRN AAGSL KR    EG  L + +VE 
Sbjct: 62  LEENGIRTHLVEKLSEREMLCRYLDIIKVEVVVRNIAAGSLVKRYGFAEGTLLEQPIVEL 121

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y   D  +  L+++ H  A   A   E+  +   +  IN  +   F    ++LVDF+++ 
Sbjct: 122 YLKNDDLDDPLMNDAHAVALGVATYEEIAVLKNRAEAINLVLRRFFADRKLKLVDFKLEF 181

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR    +   I+L DEI PD CRLWDL   E+ DK RF      + + YSEV RR+
Sbjct: 182 GR----NKGTILLGDEISPDTCRLWDLDTNEKLDKDRFRFDLGGVEDAYSEVQRRV 233


>gi|317049086|ref|YP_004116734.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Pantoea
           sp. At-9b]
 gi|316950703|gb|ADU70178.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Pantoea
           sp. At-9b]
          Length = 237

 Score =  241 bits (616), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 80/238 (33%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ R  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKRAELYRGKAKTVYSTDNPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP      ++  E LV+ +EM+P+   VRN AAGSL KRL + EG+ L   L + 
Sbjct: 61  LQEAGIPTQMEALLSDNEALVKKLEMVPVECVVRNRAAGSLVKRLGVEEGMLLNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND ++ +F    + LVDF+++ 
Sbjct: 121 FLKDDAKHDPMVNESYCETFGWVSKENLARMRELTYKANDVLSKMFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    ++ DK RF +S   L+E Y EVA RLG+
Sbjct: 181 GLF----KGEVVLGDEFSPDGARLWDKETMDKMDKDRFRQSLGGLIEAYEEVAHRLGV 234


>gi|74313002|ref|YP_311421.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           sonnei Ss046]
 gi|123616549|sp|Q3YZ76|PUR7_SHISS RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|73856479|gb|AAZ89186.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase = SAICAR
           synthetase [Shigella sonnei Ss046]
 gi|323169086|gb|EFZ54763.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           sonnei 53G]
 gi|330912258|gb|EGH40768.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli AA86]
          Length = 237

 Score =  241 bits (615), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 82/238 (34%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG+LNN+ + ++ ++
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMLNNKFNYFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LAEAGIPTQMERLLSDTECLVKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKANDVLKKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    E+ DK RF +S   L+E Y  VARRLG+
Sbjct: 181 GLY----KGEVVLGDEFSPDGSRLWDKETLEKMDKDRFRQSLGGLIEAYEAVARRLGV 234


>gi|332755516|gb|EGJ85880.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           flexneri K-671]
          Length = 237

 Score =  241 bits (615), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LAEAGIPTQMERLLSDTECLVKKLDMVPVECVVRNRAAGSLVKRLGIEEGIDLNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKANDVLKKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    E+ DK RF +S   L+E Y  VARRLG+
Sbjct: 181 GLY----KGEVVLGDEFSPDGSRLWDKETLEKMDKDRFRQSLGGLIEAYEAVARRLGV 234


>gi|200387121|ref|ZP_03213733.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|199604219|gb|EDZ02764.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
          Length = 237

 Score =  241 bits (615), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 79/238 (33%), Positives = 126/238 (52%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKQAELYRGKAKTLYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ +EM+P+   VRN AAGSL KRL + EG+ L   + + 
Sbjct: 61  LAEAGIPTQMERLLSDTECLVKKLEMVPVECVVRNRAAGSLVKRLGVEEGMELNPPIFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+  +   F W +Q  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDALHDPMVNSSYCETFGWVSQENLARMKELTYKANDVLKKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    ++ DK RF +S   L+E Y  VA RLG+
Sbjct: 181 GLY----KGEVVLGDEFSPDGSRLWDKETLDKMDKDRFRQSLGGLIEAYEAVAHRLGV 234


>gi|304446033|pdb|3NUA|A Chain A, Crystal Structure Of
           Phosphoribosylaminoimidazole-Succinocarboxamide Synthase
           From Clostridium Perfringens
 gi|304446034|pdb|3NUA|B Chain B, Crystal Structure Of
           Phosphoribosylaminoimidazole-Succinocarboxamide Synthase
           From Clostridium Perfringens
          Length = 238

 Score =  241 bits (615), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 86/235 (36%), Positives = 129/235 (54%), Gaps = 4/235 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
                +YE K K IY   +   +I  +KDD    N  + A +  KGVLNN I+  +F  L
Sbjct: 6   NQLEMLYEGKAKKIYATDKEDMVIVHYKDDATAFNGEKKAQIESKGVLNNEITSLIFEML 65

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            K GI  +F+ ++N R+QL + VE++PL + VRN AAGS+AKRL + EG  L  ++ E  
Sbjct: 66  NKEGIKTHFVEKLNDRDQLCKKVEIVPLEVIVRNVAAGSMAKRLGLEEGYELKTTVFELS 125

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  DS    L+++ H          E+ ++  ++ ++N+ +   F   NI L+DF+++ G
Sbjct: 126 YKDDSLGDPLINDYHAVGIGATTFEELNKIYEITAKVNEILKEAFKKQNINLIDFKLEFG 185

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           R        I+LADEI PD CR WD +  E+ DK RF +    ++ GY EV  RL
Sbjct: 186 RY----NGEILLADEISPDTCRFWDATTGEKMDKDRFRRDMGNVINGYREVLNRL 236


>gi|320176278|gb|EFW51339.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           dysenteriae CDC 74-1112]
          Length = 237

 Score =  241 bits (615), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LAEAGIPTQMERLLSDTECLVKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKANDELKKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    E+ DK RF +S   L+E Y  VARRLG+
Sbjct: 181 GLY----KGEVVLGDEFSPDGSRLWDKETLEKMDKDRFRQSLGGLIEAYEAVARRLGV 234


>gi|293415739|ref|ZP_06658382.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli B185]
 gi|291433387|gb|EFF06366.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli B185]
          Length = 237

 Score =  241 bits (615), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 129/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LAEAGIPTQMERLLSDTECLVKKLDMVPVECVVRNRAAGSLLKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKANDVLKKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        ++VL DE  PD  RLWD    E+ DK RF +S   L+E Y  VARRLG+
Sbjct: 181 GLY----KGKVVLGDEFSPDGSRLWDKETLEKMDKDRFRQSLGGLIEAYEAVARRLGV 234


>gi|152971341|ref|YP_001336450.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|206578918|ref|YP_002237186.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Klebsiella pneumoniae 342]
 gi|238895936|ref|YP_002920672.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Klebsiella pneumoniae NTUH-K2044]
 gi|262042095|ref|ZP_06015271.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Klebsiella
           pneumoniae subsp. rhinoscleromatis ATCC 13884]
 gi|288934125|ref|YP_003438184.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Klebsiella variicola At-22]
 gi|290508330|ref|ZP_06547701.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Klebsiella sp. 1_1_55]
 gi|330013579|ref|ZP_08307670.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Klebsiella
           sp. MS 92-3]
 gi|166229551|sp|A6TC99|PUR7_KLEP7 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229564412|sp|B5XVM9|PUR7_KLEP3 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|150956190|gb|ABR78220.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|206567976|gb|ACI09752.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Klebsiella pneumoniae 342]
 gi|238548254|dbj|BAH64605.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|259040576|gb|EEW41671.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Klebsiella
           pneumoniae subsp. rhinoscleromatis ATCC 13884]
 gi|288888854|gb|ADC57172.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Klebsiella variicola At-22]
 gi|289777724|gb|EFD85721.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Klebsiella sp. 1_1_55]
 gi|328533488|gb|EGF60218.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Klebsiella
           sp. MS 92-3]
          Length = 237

 Score =  241 bits (615), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 78/238 (32%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MKKQAELYRGKAKTVYSTDNPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP      ++  E LV+ ++M+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LAEAGIPTQMEALLSDTECLVKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V++ +   F W ++  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNDSYCETFGWVSKENLARMRELTYKANDVLKKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD +  ++ DK RF +S   L+E Y EVA RLG+
Sbjct: 181 GLF----KGEVVLGDEFSPDGSRLWDKNTLDKMDKDRFRQSLGGLIEAYEEVAHRLGV 234


>gi|86609242|ref|YP_478004.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|123501992|sp|Q2JKP0|PUR7_SYNJB RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|86557784|gb|ABD02741.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 247

 Score =  241 bits (615), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 84/237 (35%), Positives = 129/237 (54%), Gaps = 5/237 (2%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
            P+  +YE K K IY   +P   +  +KDD    N  +  ++ GKG +N  +S ++F  L
Sbjct: 4   SPQELLYEGKAKRIYRTADPRVYLCQYKDDATAFNAQKRGSIAGKGEVNCTVSSHVFAYL 63

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            + GIP++F+ +    E  VR + ++PL + VRN  AGSL KRL + +GL +   LVEFY
Sbjct: 64  AQQGIPNHFLAQTGPTEMQVRALHILPLEVVVRNRTAGSLCKRLGLEQGLPIQPPLVEFY 123

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D+    LV+ +HI     A   +VE + +L++ IN+ +   +    ++LVDF+++ G
Sbjct: 124 YKNDALGDPLVTPDHIRLLQLATPEQVERLGSLALAINNHLQAFWRSCRLELVDFKLEFG 183

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEE--CDKKRFSKSNDQLLEGYSEVARRL 236
                +   I+LADEI PD CRLWD    E    DK  F       + GY EV +R+
Sbjct: 184 LD---EKGEILLADEISPDTCRLWDRGGSEPRVLDKDLFRFDLGDPVAGYQEVLQRV 237


>gi|294791110|ref|ZP_06756268.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Scardovia
           inopinata F0304]
 gi|294459007|gb|EFG27360.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Scardovia
           inopinata F0304]
          Length = 255

 Score =  241 bits (615), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 86/249 (34%), Positives = 131/249 (52%), Gaps = 8/249 (3%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K +Y    P  L   + +     N  +   + GKG LNN+I+  +F +
Sbjct: 1   MQKLTQLYEGKAKKLYSTDNPDILWVEYMNQATAGNGAKKEQIEGKGRLNNQITTVIFNE 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +FI +++  EQLVR + M PL I +RN AAGS AKR  + EG  L R ++E 
Sbjct: 61  LAYRGIASHFISQLSPTEQLVRKMNMYPLEIIMRNRAAGSFAKRYGVEEGTVLSRPVLEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
               D+     ++++   A N AN+ E++ + A +  IN  +T +F  I++ LVDF+++ 
Sbjct: 121 CLKDDALGDPFINDDDAIALNLANRDELDIIAAKAREINHTLTAIFNEIDVTLVDFKVEM 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKK-----EECDKKRFSKSNDQLLEGYSEVARR 235
           G+  D     I+LADEI PD CRLWD +K      E  DK  F +    ++  Y E+  R
Sbjct: 181 GKTSD---GTILLADEITPDTCRLWDKAKTSQGHVEHLDKDLFRRDLGNIIPAYEEILDR 237

Query: 236 LGIFKKNEP 244
           L     + P
Sbjct: 238 LEKLHASHP 246


>gi|157144591|ref|YP_001451910.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Citrobacter koseri ATCC BAA-895]
 gi|166229540|sp|A8ADB1|PUR7_CITK8 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|157081796|gb|ABV11474.1| hypothetical protein CKO_00311 [Citrobacter koseri ATCC BAA-895]
          Length = 237

 Score =  241 bits (614), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 79/238 (33%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    + ++  E LV+ ++M+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LAEAGIPTQMEQLLSDTECLVKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V++ +   F W ++  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNDSYCETFGWVSKENLARMKELTYKANDVLKKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    ++ DK RF +S   L+E Y  VARRLG+
Sbjct: 181 GLY----KGEVVLGDEFSPDGSRLWDKETLDKMDKDRFRQSLGGLIEAYETVARRLGV 234


>gi|304398348|ref|ZP_07380222.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Pantoea
           sp. aB]
 gi|304354214|gb|EFM18587.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Pantoea
           sp. aB]
          Length = 237

 Score =  241 bits (614), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 78/238 (32%), Positives = 126/238 (52%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ R  +Y  K K +Y    P  LI  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKRAELYRGKAKTVYSTDNPDLLILEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP      ++  E LV+ +EM+P+   VRN AAGSL KRL + EG+ L   L + 
Sbjct: 61  LQEAGIPTQMEALLSDTEALVKKLEMVPVECVVRNRAAGSLVKRLGVEEGIVLNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D     +V+E +   F W ++  +  M  L+ + N+ ++ LF    + LVDF+++ 
Sbjct: 121 FLKDDEKHDPMVNESYCETFGWVSKQNLARMQELTFKANEVLSKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         + L DE  PD  RLWD    ++ DK RF +S   ++E Y  VA+RLG+
Sbjct: 181 GLF----NGEVTLGDEFSPDGARLWDKETLDKMDKDRFRQSLGGVVEAYEAVAQRLGV 234


>gi|194432149|ref|ZP_03064438.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           dysenteriae 1012]
 gi|194419678|gb|EDX35758.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           dysenteriae 1012]
 gi|332089819|gb|EGI94920.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           dysenteriae 155-74]
          Length = 237

 Score =  241 bits (614), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LAEAGIPTQMERLLSDTECLVKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKANDVLKKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    E+ DK RF +S   L+E Y  VARRLG+
Sbjct: 181 GLY----KGEVVLGDEFSPDGSRLWDKETLEKMDKDRFRQSLGGLIEAYEAVARRLGV 234


>gi|260598863|ref|YP_003211434.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cronobacter turicensis z3032]
 gi|260218040|emb|CBA32751.1| Phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Cronobacter turicensis z3032]
          Length = 237

 Score =  241 bits (614), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 79/238 (33%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    + ++  E LV+ ++M+P+   +RN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LAEAGIPTQMEQLLSDTEALVKKLDMVPVECVIRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W +Q  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCETFGWVSQENLARMKELTYKANDVLKKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         + L DE  PD  RLWD    ++ DK RF +S   L+E Y EVARRLG+
Sbjct: 181 GLF----NGEVTLGDEFSPDGARLWDKKTMDKMDKDRFRQSLGGLIEAYEEVARRLGV 234


>gi|308187725|ref|YP_003931856.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Pantoea
           vagans C9-1]
 gi|308058235|gb|ADO10407.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Pantoea
           vagans C9-1]
          Length = 237

 Score =  241 bits (614), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 79/238 (33%), Positives = 127/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ R  +Y  K K +Y    P  LI  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKRAELYRGKAKTVYSTDNPDLLILEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP      ++  E LV+ +EM+P+   VRN AAGSL KRL + EG+ L   L + 
Sbjct: 61  LQEAGIPTQMEALLSDTEALVKKLEMVPVECVVRNRAAGSLVKRLGVEEGIVLNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKDDAKHDPMVNESYCETFGWVSKQNLARMQELTFKANDVLSKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         + L DE  PD  RLWD    ++ DK RF +S   ++E Y  VA+RLG+
Sbjct: 181 GLF----NGEVTLGDEFSPDGARLWDKETLDKMDKDRFRQSLGGVVEAYEAVAQRLGV 234


>gi|157364767|ref|YP_001471534.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermotoga lettingae TMO]
 gi|157315371|gb|ABV34470.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermotoga lettingae TMO]
          Length = 232

 Score =  241 bits (614), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 85/234 (36%), Positives = 133/234 (56%), Gaps = 4/234 (1%)

Query: 3   PRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLG 62
            +  +YE K K +++   P   +  +KDD    +  +  T+N KGVLNN+IS   F  L 
Sbjct: 2   KKEILYEGKAKKVFKTDNPEFFVIEYKDDATAFDGKKRGTINNKGVLNNKISAIFFELLQ 61

Query: 63  KIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYY 122
           K GI  +F+R ++ RE LVR V +IP+ + VRN AAGSL+KRL + EG  L ++++E  Y
Sbjct: 62  KHGIETHFVRLLSEREMLVRAVGIIPIEVIVRNIAAGSLSKRLGLEEGTILKKTVLELCY 121

Query: 123 LPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGR 182
             D     +++  H  A   A + E+  +   ++++N+ M       NI LVDF+++ GR
Sbjct: 122 KNDELSDPMINRYHALAMELATEEELNRIEQTALKVNEIMKNFLGSKNIILVDFKLEFGR 181

Query: 183 LLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
                  +I+LADEI PD CR WD S +E+ DK RF +    + + Y E+ +R+
Sbjct: 182 ----ANGKILLADEISPDTCRFWDGSTREKLDKDRFRRDLGNVEQAYWEIYKRI 231


>gi|322807196|emb|CBZ04770.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium botulinum H04402 065]
          Length = 234

 Score =  241 bits (614), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 90/237 (37%), Positives = 136/237 (57%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  ++ +YE K K I+   +  T++ ++KDD    N  +  T+  KGV+NN I+  +F  
Sbjct: 1   MEKKDMLYEGKAKKIFRTDDKDTVVVYYKDDATAFNGEKKGTIEDKGVMNNSITAMLFEL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+  +FI +IN REQL + VE++PL + VRN AAGS+AKRL + EG  L  ++ E 
Sbjct: 61  LEKKGVKTHFIEKINEREQLCKKVEIVPLEVIVRNIAAGSMAKRLGLSEGRKLDTTVFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A       E++EM +++ ++ND +   F    I LVDF+I+ 
Sbjct: 121 SYKNDDLNDPLINDYHAVAIGLTTFEELKEMYSIAEKVNDTLKEFFDEQGINLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           GR        ++LADEI PD CRLWD S  E+ DK RF +    + E Y E+ +R+ 
Sbjct: 181 GRF----NGELLLADEISPDTCRLWDKSTGEKLDKDRFRRDMGNVKEAYMEILKRVN 233


>gi|327394750|dbj|BAK12172.1| phosphoribosylaminoimidazole-succinocarboxamide synthase PurC
           [Pantoea ananatis AJ13355]
          Length = 252

 Score =  241 bits (614), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 80/238 (33%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ R  +Y  K K +Y    P  LI  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 16  MQKRAELYRGKAKTVYSTDNPDLLILEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMTK 75

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP      ++  E LV+ ++M+P+   +RN AAGSL KRL + EG+ L   L + 
Sbjct: 76  LQEAGIPTQMEALLSDNEALVKKLDMVPVECVIRNRAAGSLVKRLGVEEGIVLNPPLFDL 135

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND ++ LF    + LVDF+++ 
Sbjct: 136 FLKDDAKHDPMVNESYCETFGWVSKENLARMRELTYKANDVLSNLFDKAGLILVDFKLEF 195

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    ++ DK RF +S   L+E Y  VARRLG+
Sbjct: 196 GLF----NGEVVLGDEFSPDGARLWDKETLDKMDKDRFRQSLGGLIEAYEAVARRLGV 249


>gi|309784789|ref|ZP_07679422.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           dysenteriae 1617]
 gi|308927159|gb|EFP72633.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           dysenteriae 1617]
          Length = 237

 Score =  241 bits (614), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDCKGMVNNKFNYFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LAEAGIPTQMERLLSDTECLVKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKANDVLKKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    E+ DK RF +S   L+E Y  VARRLG+
Sbjct: 181 GLY----KGEVVLGDEFSPDGSRLWDKETLEKMDKDRFRQSLGGLIEAYEAVARRLGV 234


>gi|222529441|ref|YP_002573323.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caldicellulosiruptor bescii DSM 6725]
 gi|222456288|gb|ACM60550.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caldicellulosiruptor bescii DSM 6725]
          Length = 239

 Score =  241 bits (614), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 90/237 (37%), Positives = 136/237 (57%), Gaps = 4/237 (1%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K K +YE   P  ++  +KDD    +  +   +N KGV+NN +S + F  L   
Sbjct: 7   KLLYEGKAKKVYETENPDVVVIEYKDDATAFDGTKRGIINNKGVVNNLVSNHFFKILEAN 66

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
            IP +FI +I+ R+  V+ V++IP+ + VRN AAGSL+KRL + EG  L R ++EF Y  
Sbjct: 67  NIPTHFIEQIDERKTAVKRVQIIPVEVIVRNIAAGSLSKRLGLEEGTILKRPILEFCYKN 126

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D      V++ HI A   A + E+ ++   S ++ND +      +NI L+DF+++ GR  
Sbjct: 127 DDLHDPQVNQYHILALELATEEEIRKIEEYSFKVNDVLRNYLKQVNIDLIDFKLEFGRYR 186

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKK 241
                 ++LADEI PD CR WD + KE+ DK RF +    + E Y E+ RRLG+ KK
Sbjct: 187 ----GDVILADEISPDTCRFWDTTTKEKLDKDRFRRDLGNVEEAYMEILRRLGLDKK 239


>gi|148380835|ref|YP_001255376.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium botulinum A str. ATCC 3502]
 gi|153933285|ref|YP_001385141.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium botulinum A str. ATCC 19397]
 gi|153934590|ref|YP_001388610.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium botulinum A str. Hall]
 gi|226950310|ref|YP_002805401.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium botulinum A2 str. Kyoto]
 gi|166229541|sp|A7FXD7|PUR7_CLOB1 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|166229542|sp|A5I5W3|PUR7_CLOBH RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|254783943|sp|C1FV80|PUR7_CLOBJ RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|148290319|emb|CAL84443.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium botulinum A str. ATCC 3502]
 gi|152929329|gb|ABS34829.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium botulinum A str. ATCC 19397]
 gi|152930504|gb|ABS36003.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium botulinum A str. Hall]
 gi|226841256|gb|ACO83922.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium botulinum A2 str. Kyoto]
          Length = 234

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 89/237 (37%), Positives = 136/237 (57%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  ++ +YE K K I+   +  T++ ++KDD    N  +  T+  KGV+NN I+  +F  
Sbjct: 1   MEKKDMLYEGKAKKIFRTDDKDTVVVYYKDDATAFNGEKKGTIEDKGVMNNSITAMLFEL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+  +FI +IN REQL + VE++PL + VRN AAGS+AKRL + EG  L  ++ E 
Sbjct: 61  LEKKGVKTHFIEKINEREQLCKKVEIVPLEVIVRNIAAGSMAKRLGLSEGRKLDTTVFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A       E++EM +++ ++N+ +   F    I LVDF+I+ 
Sbjct: 121 SYKNDDLNDPLINDYHAVAIGLTTFEELKEMYSIAEKVNNTLKEFFDEQGINLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           GR        ++LADEI PD CRLWD S  E+ DK RF +    + E Y E+ +R+ 
Sbjct: 181 GRF----NGELLLADEISPDTCRLWDKSTGEKLDKDRFRRDMGNVKEAYMEILKRVN 233


>gi|268589320|ref|ZP_06123541.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Providencia rettgeri DSM 1131]
 gi|291315344|gb|EFE55797.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Providencia rettgeri DSM 1131]
          Length = 237

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 77/238 (32%), Positives = 130/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y   +P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKKAELYRGKAKTVYTTEDPDLLVLEFRNDTSALDGERIEQFDRKGMVNNKFNHFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP      ++  E LV+ ++M+P+   +RN AAGSL KRL + EG+ L   L + 
Sbjct: 61  LEAAGIPTQMEALLSDTEALVKKLDMVPVECVIRNRAAGSLVKRLGVEEGMVLNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  + +M  LS + N+ ++ +F    + LVDF+++ 
Sbjct: 121 FLKDDAKHDPMVNESYCETFGWVSKENLAKMRELSYKANEVLSKIFADAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        +IVL DE  PD  RLWD     + DK RF +S   L+E Y EVARR+G+
Sbjct: 181 GLY----KGQIVLGDEFSPDGSRLWDKETLNKMDKDRFRQSLGGLIEAYEEVARRIGV 234


>gi|283786100|ref|YP_003365965.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Citrobacter rodentium ICC168]
 gi|282949554|emb|CBG89170.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Citrobacter rodentium ICC168]
          Length = 237

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 79/238 (33%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LAEAGIPTQMERLLSDTECLVKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V++ +   F W ++  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNDSYCETFGWVSKENLARMKELTYKANDVLKKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    ++ DK RF +S   L+E Y  VARRLG+
Sbjct: 181 GLY----KGEVVLGDEFSPDGSRLWDKETLDKMDKDRFRQSLGGLIEAYETVARRLGV 234


>gi|82777857|ref|YP_404206.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           dysenteriae Sd197]
 gi|123561949|sp|Q32D90|PUR7_SHIDS RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|81242005|gb|ABB62715.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Shigella dysenteriae Sd197]
          Length = 237

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 127/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++  +
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDCKGMVNNKFNYFIMNK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LAEAGIPTQMERLLSDTECLVKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKANDVLKKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    E+ DK RF +S   L+E Y  VARRLG+
Sbjct: 181 GLY----KGEVVLGDEFSPDGSRLWDKETLEKMDKDRFRQSLGGLIEAYEAVARRLGV 234


>gi|291618358|ref|YP_003521100.1| PurC [Pantoea ananatis LMG 20103]
 gi|291153388|gb|ADD77972.1| PurC [Pantoea ananatis LMG 20103]
          Length = 260

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 80/238 (33%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ R  +Y  K K +Y    P  LI  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 24  MQKRAELYRGKAKTVYSTDNPDLLILEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMTK 83

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP      ++  E LV+ ++M+P+   +RN AAGSL KRL + EG+ L   L + 
Sbjct: 84  LQEAGIPTQMEALLSDNEALVKKLDMVPVECVIRNRAAGSLVKRLGVEEGIVLNPPLFDL 143

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND ++ LF    + LVDF+++ 
Sbjct: 144 FLKDDAKHDPMVNESYCETFGWVSKENLARMRELTYKANDVLSNLFDKAGLILVDFKLEF 203

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    ++ DK RF +S   L+E Y  VARRLG+
Sbjct: 204 GLF----NGEVVLGDEFSPDGARLWDKETLDKMDKDRFRQSLGGLIEAYEAVARRLGV 257


>gi|26248846|ref|NP_754886.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli CFT073]
 gi|91211808|ref|YP_541794.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli UTI89]
 gi|117624672|ref|YP_853585.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli APEC O1]
 gi|237704993|ref|ZP_04535474.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia sp. 3_2_53FAA]
 gi|331643093|ref|ZP_08344228.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli H736]
 gi|331653901|ref|ZP_08354902.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli M718]
 gi|331673934|ref|ZP_08374697.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli TA280]
 gi|332278377|ref|ZP_08390790.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Shigella sp. D9]
 gi|26109252|gb|AAN81454.1|AE016764_136 Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli CFT073]
 gi|91073382|gb|ABE08263.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli UTI89]
 gi|115513796|gb|ABJ01871.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli APEC O1]
 gi|226901359|gb|EEH87618.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia sp. 3_2_53FAA]
 gi|331039891|gb|EGI12111.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli H736]
 gi|331048750|gb|EGI20826.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli M718]
 gi|331069207|gb|EGI40599.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli TA280]
 gi|332100729|gb|EGJ04075.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Shigella sp. D9]
          Length = 240

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 4   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSK 63

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 64  LAEAGIPTQMERLLSDTECLVKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL 123

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 124 FLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKANDVLKKLFDDAGLILVDFKLEF 183

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    E+ DK RF +S   L+E Y  VARRLG+
Sbjct: 184 GLY----KGEVVLGDEFSPDGSRLWDKETLEKMDKDRFRQSLGGLIEAYEAVARRLGV 237


>gi|206602419|gb|EDZ38900.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Leptospirillum sp. Group II '5-way CG']
          Length = 239

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 86/236 (36%), Positives = 138/236 (58%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M   + +YE K KI+Y+  +P TL+Q FKDD    N  +  ++  KG +N ++S ++F  
Sbjct: 1   ME-GHRLYEGKAKILYDRGDPDTLVQHFKDDATAFNAQKKGSILHKGAINCQLSAHLFEL 59

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP +F+ R+   E  VR + M+PL + +RN  AGSLAKRL  PEG +LP  ++E+
Sbjct: 60  LEQEGIPTHFVERLTPVEMKVRRLSMVPLEVVLRNRYAGSLAKRLGQPEGGALPFPVLEW 119

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +V+ +HI     A+++ + ++  L  ++ND ++G F   +I L D +++ 
Sbjct: 120 YYKRDDLGDPIVNRDHIRVLGVASEAILSDVERLGRKVNDILSGFFGRKDIVLADMKLEF 179

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G    +   +++L DEI PD CR WD    E+ DK RF +   Q+ E Y E+ RR+
Sbjct: 180 GV---ERSGKVLLGDEISPDTCRFWDAKTGEKMDKDRFRRDLGQIEEYYLELFRRV 232


>gi|212710875|ref|ZP_03319003.1| hypothetical protein PROVALCAL_01943 [Providencia alcalifaciens DSM
           30120]
 gi|212686572|gb|EEB46100.1| hypothetical protein PROVALCAL_01943 [Providencia alcalifaciens DSM
           30120]
          Length = 237

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 79/238 (33%), Positives = 130/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y   +P  LI  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKKAELYRGKAKTVYTTEDPDLLILEFRNDTSALDGERIEQFDRKGMVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP      ++  E LV+ ++M+P+   +RN AAGSL KRL + EG+ L   L + 
Sbjct: 61  LQEAGIPTQMEALLSDTEALVKKLDMVPVECVIRNRAAGSLVKRLGVEEGMILNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  + +M  LS + ND ++ +F    + LVDF+++ 
Sbjct: 121 FLKDDAKHDPMVNESYCETFGWVSKENLAKMRELSYKANDVLSQIFADAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK RF +S   L+E Y EVARR+G+
Sbjct: 181 GLF----NGEVVLGDEFSPDGSRLWDKETLNKMDKDRFRQSLGGLIEAYEEVARRIGV 234


>gi|313681519|ref|YP_004059257.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sulfuricurvum kujiense DSM 16994]
 gi|313154379|gb|ADR33057.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sulfuricurvum kujiense DSM 16994]
          Length = 236

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 84/237 (35%), Positives = 131/237 (55%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R+ +YE K K ++   +   +I  FKDD    N  +    +GKG LNN+IS  +F  
Sbjct: 1   MEKRDLIYEGKAKRLFSTDDANLVIAEFKDDLTAFNGAKKDNESGKGALNNKISTELFKM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+  +F+  ++    L + V++I + + VRN A GSL+K L IP+G  LP +LVEF
Sbjct: 61  LAKNGVESHFVEMLDDTHMLCKKVDIILIEVIVRNIATGSLSKNLGIPDGKVLPFTLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWA-NQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIK 179
            Y  D+     ++++H        N++E++++ A++  +N  +   F    + LVDF+++
Sbjct: 121 DYKNDALGDPKLNDQHCLILELVKNEAELDQLRAMAREVNSILRPYFHDKGLNLVDFKLE 180

Query: 180 CGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
            GR  D    +I+LADEI PD CR WDL   E+ DK RF +    L   Y EV  R+
Sbjct: 181 FGRDKD---GKIILADEISPDNCRFWDLETGEKMDKDRFRQGLGGLKVAYEEVLNRI 234


>gi|187778538|ref|ZP_02995011.1| hypothetical protein CLOSPO_02133 [Clostridium sporogenes ATCC
           15579]
 gi|187772163|gb|EDU35965.1| hypothetical protein CLOSPO_02133 [Clostridium sporogenes ATCC
           15579]
          Length = 234

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 91/237 (38%), Positives = 139/237 (58%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  ++ +YE K K I+E  +  T++ ++KDD    N  +  T+  KGV+NN I+  +F  
Sbjct: 1   MEKKDMLYEGKAKKIFETDDKDTVVVYYKDDATAFNGEKKGTIEDKGVMNNSITAMLFEL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+  +FI +IN REQL + VE++PL + VRN AAGS+AKRL + EG  L  ++ E 
Sbjct: 61  LEKKGVKTHFIEKINEREQLCKKVEIVPLEVIVRNIAAGSMAKRLGLSEGRKLDTTVFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A      +E++EM +++ ++N+ +   F    I LVDF+I+ 
Sbjct: 121 SYKNDDLNDPLINDYHAVAIGLTTFAELKEMYSIAEKVNNTLKEFFDKQGINLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           GR  D     ++LADEI PD CRLWD S  E+ DK RF +    + E Y E+ +R+ 
Sbjct: 181 GRFND----ELLLADEISPDTCRLWDKSTGEKLDKDRFRRDMGNVKEAYMEILKRVN 233


>gi|300778158|ref|ZP_07088016.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Chryseobacterium gleum ATCC 35910]
 gi|300503668|gb|EFK34808.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Chryseobacterium gleum ATCC 35910]
          Length = 240

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 90/241 (37%), Positives = 136/241 (56%), Gaps = 3/241 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
           + +  +YE K K ++    P  ++  FKDD    N  +   ++ KG +NN I+  +F  L
Sbjct: 3   QKKEMLYEGKAKQVFATDNPDEVVVRFKDDATAFNAQKRGQVDLKGEMNNAITTLIFEYL 62

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            + GI  +FI++++ REQLVR V +IPL + VRN +AGS+A+RL + EG+  P ++ +  
Sbjct: 63  NEKGIKTHFIKKLDEREQLVRKVSIIPLEMVVRNYSAGSMAQRLGVEEGIKSPVTIFDIC 122

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     L+++ H      A   E++EM  LS  IND +  LF  INI LVDF+I+ G
Sbjct: 123 YKKDELGDPLINDHHAVFLGAATYEELDEMYELSSDINDILIELFDKINIILVDFKIELG 182

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKK 241
           +  D     I+LADEI PD CRLWD    ++ DK RF +   ++ E Y E+  RL    +
Sbjct: 183 KTSD---GEIILADEISPDTCRLWDKDTMKKLDKDRFRRDLGEVTEAYVEIYNRLKNLLQ 239

Query: 242 N 242
            
Sbjct: 240 K 240


>gi|168181563|ref|ZP_02616227.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium botulinum Bf]
 gi|237796334|ref|YP_002863886.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium botulinum Ba4 str. 657]
 gi|259546819|sp|C3L2V3|PUR7_CLOB6 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|182675085|gb|EDT87046.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium botulinum Bf]
 gi|229262297|gb|ACQ53330.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium botulinum Ba4 str. 657]
          Length = 234

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 88/237 (37%), Positives = 135/237 (56%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  ++ +YE K K I+   +  T++ ++KDD    N  +  T+  KGV+NN I+  +F  
Sbjct: 1   MEKKDMLYEGKAKKIFGTDDKDTVVVYYKDDATAFNGEKKGTIEEKGVMNNSITSMLFEL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+  +FI +IN REQL + VE++PL + VRN AAGS+AKRL + EG  L  ++ E 
Sbjct: 61  LEKKGVKTHFIEKINEREQLCKKVEIVPLEVIVRNIAAGSMAKRLGLSEGRKLDTTVFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A       E++EM +++ ++N+ +   F    I LVDF+I+ 
Sbjct: 121 SYKNDDLNDPLINDYHAVAIGLTTFEELKEMYSIAEKVNNTLKEFFDEQGIILVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           GR        ++LADEI PD CRLWD    E+ DK RF +    + E Y E+ +R+ 
Sbjct: 181 GRF----GGELLLADEISPDTCRLWDKKTGEKLDKDRFRRDMGNVKEAYMEILKRVN 233


>gi|331648133|ref|ZP_08349223.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli M605]
 gi|331042993|gb|EGI15133.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli M605]
          Length = 240

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 82/238 (34%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG+LNN+ + ++ ++
Sbjct: 4   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMLNNKFNYFIMSK 63

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 64  LAEAGIPTQMERLLSDTECLVKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL 123

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 124 FLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKANDVLKKLFDDAGLILVDFKLEF 183

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    E+ DK RF +S   L+E Y  VARRLG+
Sbjct: 184 GLY----KGEVVLGDEFSPDGSRLWDKETLEKMDKDRFRQSLGGLIEAYEAVARRLGV 237


>gi|18309664|ref|NP_561598.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium perfringens str. 13]
 gi|110799762|ref|YP_695126.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium perfringens ATCC 13124]
 gi|168204667|ref|ZP_02630672.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium perfringens E str. JGS1987]
 gi|168209945|ref|ZP_02635570.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium perfringens B str. ATCC 3626]
 gi|22001852|sp|Q8XMK6|PUR7_CLOPE RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|123050000|sp|Q0TTB4|PUR7_CLOP1 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|18144341|dbj|BAB80388.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium perfringens str. 13]
 gi|110674409|gb|ABG83396.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium perfringens ATCC 13124]
 gi|170663766|gb|EDT16449.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium perfringens E str. JGS1987]
 gi|170711930|gb|EDT24112.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium perfringens B str. ATCC 3626]
          Length = 235

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 86/235 (36%), Positives = 129/235 (54%), Gaps = 4/235 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
                +YE K K IY   +   +I  +KDD    N  + A +  KGVLNN I+  +F  L
Sbjct: 3   NQLEMLYEGKAKKIYATDKEDMVIVHYKDDATAFNGEKKAQIESKGVLNNEITSLIFEML 62

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            K GI  +F+ ++N R+QL + VE++PL + VRN AAGS+AKRL + EG  L  ++ E  
Sbjct: 63  NKEGIKTHFVEKLNDRDQLCKKVEIVPLEVIVRNVAAGSMAKRLGLEEGYELKTTVFELS 122

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  DS    L+++ H          E+ ++  ++ ++N+ +   F   NI L+DF+++ G
Sbjct: 123 YKDDSLGDPLINDYHAVGIGATTFEELNKIYEITAKVNEILKEAFKKQNINLIDFKLEFG 182

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           R        I+LADEI PD CR WD +  E+ DK RF +    ++ GY EV  RL
Sbjct: 183 RY----NGEILLADEISPDTCRFWDATTGEKMDKDRFRRDMGNVINGYREVLNRL 233


>gi|225848982|ref|YP_002729146.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643310|gb|ACN98360.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 235

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 87/233 (37%), Positives = 132/233 (56%), Gaps = 3/233 (1%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K KI+Y+  +P  ++ +FKD+    N  +   + GKGV+NN+IS   F  L K 
Sbjct: 2   EKLYEGKAKIVYKAQDPDKVVIYFKDEATAFNAQKKDVIEGKGVINNKISSIFFQILEKH 61

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
           GIP +F+++++ RE L    ++IP+ + VRN A GS+ KRL IPE       L+EFY   
Sbjct: 62  GIPTHFVKQLSDREMLAYKTQIIPVEVVVRNLATGSIVKRLGIPEKTPFNPPLIEFYLKN 121

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D     ++  EHI A N AN  E++ +  L+ ++N  +  + +  +I LVDF+++ G+  
Sbjct: 122 DQLGDPIICYEHILALNLANDQEIKTIKELAFKVNQILKDILIKHDIILVDFKLEFGK-- 179

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
             +   IV+ADEI PD CR WD    E  DK RF  +   L + Y EV RR+ 
Sbjct: 180 -KEDGNIVVADEISPDTCRFWDAKTGERMDKDRFRLNLGDLAKFYEEVLRRIE 231


>gi|168217189|ref|ZP_02642814.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium perfringens NCTC 8239]
 gi|169344418|ref|ZP_02865387.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium perfringens C str. JGS1495]
 gi|169297338|gb|EDS79447.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium perfringens C str. JGS1495]
 gi|182380729|gb|EDT78208.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium perfringens NCTC 8239]
          Length = 235

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 86/235 (36%), Positives = 129/235 (54%), Gaps = 4/235 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
                +YE K K IY   +   +I  +KDD    N  + A +  KGVLNN I+  +F  L
Sbjct: 3   NQLEMLYEGKAKKIYATDKEDMVIVHYKDDATAFNGEKKAQIESKGVLNNEITSLIFEML 62

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            K GI  +F+ ++N R+QL + VE++PL + VRN AAGS+AKRL + EG  L  ++ E  
Sbjct: 63  NKEGIKTHFVEKLNDRDQLCKKVEIVPLEVIVRNVAAGSMAKRLGLEEGYELKTTVFELS 122

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  DS    L+++ H          E+ ++  ++ ++N+ +   F   NI L+DF+++ G
Sbjct: 123 YKDDSLGDPLINDYHAVGIGATTFEELNKIYEITAKVNEILKEAFKKQNINLIDFKLEFG 182

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           R        I+LADEI PD CR WD +  E+ DK RF +    ++ GY EV  RL
Sbjct: 183 RY----NGEILLADEISPDTCRFWDATTGEKMDKDRFRRDMGNVINGYREVLNRL 233


>gi|156932970|ref|YP_001436886.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cronobacter sakazakii ATCC BAA-894]
 gi|166229546|sp|A7ML04|PUR7_ENTS8 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|156531224|gb|ABU76050.1| hypothetical protein ESA_00773 [Cronobacter sakazakii ATCC BAA-894]
          Length = 237

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 80/238 (33%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   +RN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LAEAGIPTQMERLLSDTEALVKKLDMVPVECVIRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W +Q  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCETFGWVSQENLARMKELTYKANDVLKKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         + L DE  PD  RLWD    ++ DK RF +S   L+E Y EVARRLG+
Sbjct: 181 GLF----KGEVTLGDEFSPDGARLWDKQTMDKMDKDRFRQSLGGLIEAYEEVARRLGV 234


>gi|110802987|ref|YP_697998.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium perfringens SM101]
 gi|122956819|sp|Q0SV52|PUR7_CLOPS RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|110683488|gb|ABG86858.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium perfringens SM101]
          Length = 235

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 86/235 (36%), Positives = 128/235 (54%), Gaps = 4/235 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
                +YE K K IY   +   +I  +KDD    N  + A +  KGVLNN I+  +F  L
Sbjct: 3   NQLEMLYEGKAKKIYATDKEDMVIVHYKDDATAFNGEKKAQIESKGVLNNEITSLIFEML 62

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            K GI  +F+ ++N R+QL + VE++PL + VRN AAGS+AKRL + EG  L  ++ E  
Sbjct: 63  NKEGIKTHFVEKLNDRDQLCKKVEIVPLEVIVRNVAAGSMAKRLGLEEGYELKTTVFELS 122

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  DS    L+++ H          E+ ++  ++ ++N+ +   F   NI L+DF+++ G
Sbjct: 123 YKDDSLGDPLINDYHAVGIGATTFEELNKIYEITAKVNEILKEAFKKQNINLIDFKLEFG 182

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           R        I+LADEI PD CR WD    E+ DK RF +    ++ GY EV  RL
Sbjct: 183 RY----KGEILLADEISPDTCRFWDAKTGEKMDKDRFRRDMGNVINGYREVLNRL 233


>gi|126697790|ref|YP_001086687.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium difficile 630]
 gi|254973876|ref|ZP_05270348.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium difficile QCD-66c26]
 gi|255091261|ref|ZP_05320739.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium difficile CIP 107932]
 gi|255099379|ref|ZP_05328356.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium difficile QCD-63q42]
 gi|255305237|ref|ZP_05349409.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium difficile ATCC 43255]
 gi|255312920|ref|ZP_05354503.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium difficile QCD-76w55]
 gi|255515679|ref|ZP_05383355.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium difficile QCD-97b34]
 gi|255648773|ref|ZP_05395675.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium difficile QCD-37x79]
 gi|255654303|ref|ZP_05399712.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium difficile QCD-23m63]
 gi|260681993|ref|YP_003213278.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium difficile CD196]
 gi|260685591|ref|YP_003216724.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium difficile R20291]
 gi|296452593|ref|ZP_06894287.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Clostridium difficile NAP08]
 gi|296880995|ref|ZP_06904941.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Clostridium difficile NAP07]
 gi|306518890|ref|ZP_07405237.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium difficile QCD-32g58]
 gi|115249227|emb|CAJ67040.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium difficile]
 gi|260208156|emb|CBA60462.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium difficile CD196]
 gi|260211607|emb|CBE01832.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium difficile R20291]
 gi|296258554|gb|EFH05455.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Clostridium difficile NAP08]
 gi|296428016|gb|EFH13917.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Clostridium difficile NAP07]
          Length = 232

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 83/232 (35%), Positives = 138/232 (59%), Gaps = 3/232 (1%)

Query: 6   PVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIG 65
            +YE K K +Y        + ++KDD    N  + A ++ KG+LNN+IS  +F  L +  
Sbjct: 2   LLYEGKAKQVYSTDNENEYVVYYKDDATAFNGEKKAEISSKGILNNKISTIIFEMLKENN 61

Query: 66  IPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPD 125
           I  +FI+ ++ RE LV+ VE++PL + VRN AAGS+ KR+ + EG+     + E  Y  D
Sbjct: 62  INTHFIKSLSDREMLVKKVEILPLEVIVRNIAAGSICKRVGLEEGVVFDEPIFEISYKND 121

Query: 126 SSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLLD 185
           +    ++++++  A   A + E++ +   +++IN+ +   FL +N++LVDF+I+ G+   
Sbjct: 122 AYGDPMLNDDYAVAMKLATREELKFLREETLKINELLKAFFLKLNLKLVDFKIEFGKD-- 179

Query: 186 DDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
                I+LADE+ PD CRLWD++  E+ DK RF K    L+EGY+EV  R+ 
Sbjct: 180 -SEGNIILADEVSPDTCRLWDVNTNEKLDKDRFRKDLGDLVEGYTEVLSRMN 230


>gi|293394979|ref|ZP_06639267.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Serratia
           odorifera DSM 4582]
 gi|291422507|gb|EFE95748.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Serratia
           odorifera DSM 4582]
          Length = 237

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 80/238 (33%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKIAELYRGKAKTVYTTENPDLLVLEFRNDTSALDGQRIEQFDRKGMVNNKFNHFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   +RN AAGSL KRL I EGL L   L + 
Sbjct: 61  LEEAGIPTQMERLLSDNEVLVKKLDMVPVECVIRNRAAGSLVKRLGIEEGLELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W  +  +  M  LS + N  ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCETFGWVGKEHLARMRELSYQANAVLSKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD +  ++ DK RF +S   L+E Y EVARR+G+
Sbjct: 181 GLF----NGEVVLGDEFSPDGSRLWDKNTLDKMDKDRFRQSLGGLIEAYEEVARRIGV 234


>gi|331678460|ref|ZP_08379135.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli H591]
 gi|331074920|gb|EGI46240.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Escherichia coli H591]
          Length = 240

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 80/238 (33%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 4   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSK 63

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 64  LAEAGIPTQMERLLSDTECLVKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL 123

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 124 FLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKANDVLKKLFDDAGLILVDFKLEF 183

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         ++L DE  PD  RLWD    E+ DK RF +S   L+E Y  VARRLG+
Sbjct: 184 GLY----KGEVILGDEFSPDGSRLWDKETLEKMDKDRFRQSLGGLIEAYEAVARRLGV 237


>gi|218700934|ref|YP_002408563.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli IAI39]
 gi|226723544|sp|B7NQL4|PUR7_ECO7I RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|218370920|emb|CAR18739.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Escherichia coli IAI39]
          Length = 237

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 80/238 (33%), Positives = 127/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   VRN  AGSL KRL I EG+ L   L + 
Sbjct: 61  LAEAGIPTQMERLLSDTECLVKKLDMVPVECVVRNRTAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKANDVLKKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    E+ DK RF +S   L+E Y  VARRLG+
Sbjct: 181 GLY----KGEVVLGDEFSPDGSRLWDKETLEKMDKDRFRQSLGGLIEAYEAVARRLGV 234


>gi|210623372|ref|ZP_03293769.1| hypothetical protein CLOHIR_01719 [Clostridium hiranonis DSM 13275]
 gi|210153633|gb|EEA84639.1| hypothetical protein CLOHIR_01719 [Clostridium hiranonis DSM 13275]
          Length = 236

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 90/240 (37%), Positives = 138/240 (57%), Gaps = 6/240 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGL-EPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFT 59
           M     +YE K K +YE       L+  +KDD    N  +   ++GKGV+NNR++ ++F 
Sbjct: 1   MNKGKMLYEGKAKRVYEIEGNDDCLLISYKDDATAFNGLKKGQIDGKGVINNRMANFIFK 60

Query: 60  QLGK-IGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLV 118
           +L +  G+  + +  I+ RE +V+ VE++PL I VRN AAGS +KR  + EG  L    +
Sbjct: 61  KLEEEKGVETHLVEEISDRETIVKKVEIVPLEIIVRNIAAGSFSKRFGVEEGTVLKNPTL 120

Query: 119 EFYYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRI 178
           EF    D+    ++++  I A   A + E+  +  ++++INDF+   F   +I+LVDF+I
Sbjct: 121 EFCLKDDALGDPMINDSQIMAIGAATKEELYAIKDMTMKINDFLIEYFKQADIELVDFKI 180

Query: 179 KCGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           + GR       RI+LADEI PD CRLWD++  E+ DK RF +    + E Y EV  RLGI
Sbjct: 181 EMGRYH----GRIILADEISPDTCRLWDINTHEKLDKDRFRRDMGGVKEAYDEVMSRLGI 236


>gi|170756658|ref|YP_001782516.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium botulinum B1 str. Okra]
 gi|229485918|sp|B1IL61|PUR7_CLOBK RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|169121870|gb|ACA45706.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium botulinum B1 str. Okra]
          Length = 234

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 89/237 (37%), Positives = 137/237 (57%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  ++ +YE K K I+   +  T++ ++KDD    N  +  T+  KGV+NN I+  +F  
Sbjct: 1   MEKKDMLYEGKAKKIFGTDDKDTVVVYYKDDATAFNGEKKGTIEDKGVMNNSITAMLFEL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+  +FI +IN REQL + VE++PL + VRN AAGS+AKRL + EG  L  ++ E 
Sbjct: 61  LEKKGVKTHFIEKINEREQLCKKVEIVPLEVIVRNIAAGSMAKRLGLSEGRKLDTTVFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A      +E++EM +++ ++N+ +   F    I LVDF+I+ 
Sbjct: 121 SYKNDDLNDPLINDYHAVAIGLTTFAELKEMYSIAEKVNNTLKEFFDEQGINLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           GR        ++LADEI PD CRLWD S  E+ DK RF +    + E Y E+ +R+ 
Sbjct: 181 GRF----NGELLLADEISPDTCRLWDKSTGEKLDKDRFRRDMGNVKEAYMEILKRVN 233


>gi|186683205|ref|YP_001866401.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Nostoc
           punctiforme PCC 73102]
 gi|229564400|sp|B2IWK4|PUR7_NOSP7 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|186465657|gb|ACC81458.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Nostoc
           punctiforme PCC 73102]
          Length = 245

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 83/240 (34%), Positives = 133/240 (55%), Gaps = 7/240 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M   + +YE K KI+Y   +P  L+  FKDD    N  +  ++ GKG +N  IS  +F Q
Sbjct: 1   MSVNSKLYEGKAKILYTTDDPEVLLADFKDDATAFNAQKRGSIQGKGKINCSISSQLFKQ 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +FI      + LV+ V+++PL + +RN AAGSL ++  +P G  L + LVEF
Sbjct: 61  LEAYGIKTHFIDSPTPNQMLVKAVKILPLEVVIRNIAAGSLCQQTGLPVGTILKQPLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     L++ + +     A   +V+ +T L+++IN+F+   +    I LVDF+++ 
Sbjct: 121 YYKNDHLGDPLLTRDRLYLLELATAEQVDAITHLALQINEFLNKFWQQCGITLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEE----CDKKRFSKSNDQLLEGYSEVARRL 236
           G        +++LADEI PD CRLWD ++++      DK RF +    + + Y EV +R+
Sbjct: 181 GLD---SQQQLLLADEISPDTCRLWDTTEEDSNRRIMDKDRFRRDLGNVEDAYQEVLQRV 237


>gi|307625960|gb|ADN70264.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli UM146]
          Length = 237

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 80/238 (33%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LAEAGIPTQMERLLSDTECLVKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKANDVLKKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLW+    E+ DK RF +S   L+E Y  VARRLG+
Sbjct: 181 GLY----KGEVVLGDEFSPDGSRLWNKETLEKMDKDRFRQSLGGLIEAYEAVARRLGV 234


>gi|168213871|ref|ZP_02639496.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium perfringens CPE str. F4969]
 gi|182624090|ref|ZP_02951877.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium perfringens D str. JGS1721]
 gi|170714637|gb|EDT26819.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium perfringens CPE str. F4969]
 gi|177910706|gb|EDT73066.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium perfringens D str. JGS1721]
          Length = 235

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 86/235 (36%), Positives = 129/235 (54%), Gaps = 4/235 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
                +YE K K IY   +   +I  +KDD    N  + A +  KGVLNN I+  +F  L
Sbjct: 3   NQLEMLYEGKAKKIYATDKDDMVIVHYKDDATAFNGEKKAQIESKGVLNNEITSLIFEML 62

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            K GI  +F+ ++N R+QL + VE++PL + VRN AAGS+AKRL + EG  L  ++ E  
Sbjct: 63  NKEGIKTHFVEKLNDRDQLCKKVEIVPLEVIVRNVAAGSMAKRLGLEEGYELKTTVFELS 122

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  DS    L+++ H          E+ ++  ++ ++N+ +   F   NI L+DF+++ G
Sbjct: 123 YKDDSLGDPLINDYHAVGIGATTFEELNKIYEITAKVNEILKEAFKKQNINLIDFKLEFG 182

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           R        I+LADEI PD CR WD +  E+ DK RF +    ++ GY EV  RL
Sbjct: 183 RY----NGEILLADEISPDTCRFWDATTGEKMDKDRFRRDMGNVINGYREVLNRL 233


>gi|333002261|gb|EGK21825.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           flexneri K-272]
 gi|333016083|gb|EGK35415.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Shigella
           flexneri K-227]
          Length = 237

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 80/238 (33%), Positives = 127/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +       + KG++NN+ + ++ ++
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGACIEQFDRKGMVNNKFNYFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LAEAGIPTQMERLLSDTECLVKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKANDVLKKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    E+ DK RF +S   L+E Y  VARRLG+
Sbjct: 181 GLY----KGEVVLGDEFSPDGSRLWDKETLEKMDKDRFRQSLGGLIEAYEAVARRLGV 234


>gi|329297534|ref|ZP_08254870.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Plautia
           stali symbiont]
          Length = 237

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 79/238 (33%), Positives = 129/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ R  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKRAELYRGKAKTVYSTDNPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP      ++  E LV+ +EM+P+   VRN AAGSL KRL + EG+ L   L + 
Sbjct: 61  LQEAGIPTQMEALLSDNEALVKKLEMVPVECVVRNRAAGSLVKRLGVEEGMLLNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W +++ +  M  L+ + N+ ++ LF   ++ LVDF+++ 
Sbjct: 121 FLKDDAKHDPMVNESYCETFGWVSKANLARMQELTFKANEMLSKLFDDADLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         + L DE  PD  RLWD    ++ DK RF +S   L+E Y EVA RLG+
Sbjct: 181 GLF----KGEVTLGDEFSPDGARLWDKETMDKMDKDRFRQSLGGLIEAYEEVAHRLGV 234


>gi|158333780|ref|YP_001514952.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acaryochloris marina MBIC11017]
 gi|189038242|sp|B0CD47|PUR7_ACAM1 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|158304021|gb|ABW25638.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acaryochloris marina MBIC11017]
          Length = 245

 Score =  240 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 80/240 (33%), Positives = 128/240 (53%), Gaps = 7/240 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K KIIY   +P  L+  +KDD    N  +  T+  KG +N  I+ ++F  
Sbjct: 1   MSTGEFLYEGKAKIIYRTDDPDILLAQYKDDATAFNAQKRGTITNKGRINCAIATHLFKV 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +FI + N  +  +R V+++PL + VRN AAGSL ++  +  G+ L + LV+F
Sbjct: 61  LEAAGIATHFIDQPNPDQMRMRAVQIVPLEVVVRNIAAGSLCQQTGLALGVPLSQPLVDF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D+    L++ + I         ++E++  L++RIN  +   F    I LVDF+++ 
Sbjct: 121 YYKDDALGDPLLTRDRIFLLELTTPEQLEQLRQLALRINQILINFFHQCGITLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLS----KKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G   D    +++LADEI PD CRLWD +     +   DK RF +   ++   Y+ V  R+
Sbjct: 181 GMTSDQ---QLLLADEISPDTCRLWDDAESDPTRRVMDKDRFRRDLGEVDTAYARVMERV 237


>gi|159030627|emb|CAO88295.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 244

 Score =  240 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 83/240 (34%), Positives = 131/240 (54%), Gaps = 7/240 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K KI+Y+  +P  L+ ++KDD    N  +   + GKG +N  +S  +F  
Sbjct: 1   MITMEKLYEGKAKILYQTDDPDILLTYYKDDATAFNAQKRGQIVGKGEINCTVSTALFQW 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  +GIP ++I R + RE  V+ +++IPL + VRN AAGSL K+  + EG  LP  LVEF
Sbjct: 61  LESLGIPTHYIDRPSSREMRVKAIKIIPLEVVVRNIAAGSLCKQTGLKEGKILPFPLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y   D+    L++ + I   + A++ +V ++  L+++IN ++   F    I LVDF+++ 
Sbjct: 121 YLKDDALGDPLLTPDRIKVIDIASEEQVNQLRDLALQINQYLQEFFDKCQIILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDL----SKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G        +I L DEI PD CRLWD     ++    DK RF +    +   Y +V  R+
Sbjct: 181 GVD---KTGKIYLGDEISPDTCRLWDKTQEDAQARILDKDRFRRDLGDVETAYQQVQARV 237


>gi|269138454|ref|YP_003295154.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Edwardsiella tarda EIB202]
 gi|267984114|gb|ACY83943.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Edwardsiella tarda EIB202]
 gi|304558480|gb|ADM41144.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Edwardsiella tarda FL6-60]
          Length = 237

 Score =  240 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 130/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y   +P  LI  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKLAELYRGKAKTVYATEDPDLLILSFRNDTSALDGQRIEQFDRKGMVNNKFNHFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP    R ++  + LV+ +EM+P+   +RN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LEAAGIPTQMERLLSDTDALVKKLEMVPVECVIRNRAAGSLVKRLGIEEGMPLNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W +   + +M ALS R N+ ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCRTFGWVSDEHLAQMKALSYRANEVLSQLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        ++VL DE  PD  RLWD +   + DK RF ++   L+E Y EVA RLG+
Sbjct: 181 GLY----KGQVVLGDEFSPDGSRLWDKATLAKMDKDRFRQNLGGLIEAYEEVAHRLGV 234


>gi|168186656|ref|ZP_02621291.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium botulinum C str. Eklund]
 gi|169295411|gb|EDS77544.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium botulinum C str. Eklund]
          Length = 235

 Score =  240 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 86/236 (36%), Positives = 137/236 (58%), Gaps = 5/236 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +YE  +   +I ++KDD    N  + + ++ KG+LNN I+  +F  
Sbjct: 1   MEK-KMLYEGKAKKVYEAEDRDHVIIYYKDDATAFNGAKKSQIDHKGILNNNITSAIFEM 59

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+  +F ++++ REQL + VE++PL + VRN AAGS+AKRL I EG  L  ++ E 
Sbjct: 60  LHKKGVETHFEKKLSDREQLCKKVEIVPLEVIVRNVAAGSMAKRLGILEGKELDTTVFEI 119

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A   A+  E+E++  ++  +N+ +   FL  NI+L+DF+++ 
Sbjct: 120 CYKNDELGDPLINDYHAVALGLASFDELEKIYNITSDVNNILKEFFLKQNIKLIDFKLEF 179

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR       +I+LADEI PD CR WD +  E+ DK RF +    + E Y E+  R+
Sbjct: 180 GRF----NGKIILADEISPDTCRFWDATTNEKLDKDRFRRDMGNVEEAYIEILNRI 231


>gi|261345957|ref|ZP_05973601.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Providencia rustigianii DSM 4541]
 gi|282566045|gb|EFB71580.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Providencia rustigianii DSM 4541]
          Length = 237

 Score =  240 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 78/238 (32%), Positives = 130/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y   +P  LI  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKKAELYRGKAKTVYTTEDPNLLILEFRNDTSALDGERIEQFDRKGMVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP      ++  E LV+ ++M+P+   +RN AAGSL KRL + EG+ L   L + 
Sbjct: 61  LEEAGIPTQMEALLSDTEALVKKLDMVPVECVIRNRAAGSLVKRLGVEEGMVLNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  + +M  LS + N+ ++ +F    + LVDF+++ 
Sbjct: 121 FLKDDAKHDPMVNESYCETFGWVSKENLAKMRELSYKANEVLSKIFADAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK RF +S   L+E Y EVARR+G+
Sbjct: 181 GLF----NGEVVLGDEFSPDGSRLWDKETLNKMDKDRFRQSLGGLIEAYEEVARRIGV 234


>gi|237732462|ref|ZP_04562943.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Citrobacter sp. 30_2]
 gi|226908001|gb|EEH93919.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Citrobacter sp. 30_2]
          Length = 237

 Score =  240 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 77/238 (32%), Positives = 127/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ +EM+P+   VRN AAGSL KRL + EG+ L   L + 
Sbjct: 61  LQEAGIPTQMERLLSDTECLVKKLEMVPVECVVRNRAAGSLVKRLGVEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    ++++ +   F W ++  +  M  L+ + ND +  +F    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMINDSYCETFGWVSKENLARMKELTYKANDVLKKMFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    ++ DK RF +S   L+E Y  VA RLG+
Sbjct: 181 GLY----KGEVVLGDEFSPDGSRLWDKETLDKMDKDRFRQSLGGLIEAYEAVAHRLGV 234


>gi|172056489|ref|YP_001812949.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Exiguobacterium sibiricum 255-15]
 gi|229564395|sp|B1YJ02|PUR7_EXIS2 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|171989010|gb|ACB59932.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Exiguobacterium sibiricum 255-15]
          Length = 235

 Score =  240 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 93/233 (39%), Positives = 126/233 (54%), Gaps = 3/233 (1%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
            P+YE K K +Y   +   L   +KD+    N  + A   GKG LNNR++ + F  L   
Sbjct: 2   QPLYEGKAKRLYTTQDQDVLRIVYKDEATAFNGEKKAEFAGKGELNNRLTSHFFEVLAAA 61

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
           GIP +FI + + REQLVR V +IPL + VRN  AGSL+KRL I EG  L   +VEFYY  
Sbjct: 62  GIPTHFIEQTSEREQLVRRVTIIPLEVVVRNVVAGSLSKRLGIEEGTVLETPIVEFYYKD 121

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           DS    LV+  HI     A   E+  +   + R+ND +   F    I L+DF+++ G+  
Sbjct: 122 DSLGDPLVTPAHINLLKIATTEELSLLEQEANRVNDVLRPYFDEKGITLIDFKLEYGKTP 181

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
                 I+LADEI PD CRLWD    E  DK  F ++   L++ Y  +  RLG
Sbjct: 182 ---AGEILLADEISPDTCRLWDKETGEHLDKDVFRRNIGSLIDTYQTLFNRLG 231


>gi|325290468|ref|YP_004266649.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Syntrophobotulus glycolicus DSM 8271]
 gi|324965869|gb|ADY56648.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Syntrophobotulus glycolicus DSM 8271]
          Length = 239

 Score =  240 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 92/242 (38%), Positives = 135/242 (55%), Gaps = 4/242 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K IY+  +       +KDD    N  +  T+  KG++NN++S  MF  
Sbjct: 1   MQKSAMLYEGKAKKIYDTDDQNCFWVEYKDDATAFNGVKKGTIVDKGIINNKMSAMMFKY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +F+  +N REQ+VR ++M+PL + VRN  AGSL+KR+   EG  L  +++E 
Sbjct: 61  LEGKGIETHFVELLNDREQIVRRLDMMPLEVVVRNIVAGSLSKRVGKDEGYVLASTVLEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  DS    +V+E H  A  WA+  EVE M  +++R+N+ M  L     I LVD++++ 
Sbjct: 121 YYKDDSLGDPMVNETHAQAMGWASIEEVETMKKIALRVNEEMAKLTAKAGITLVDYKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           G+       +I L DEI PD CR WD   KE+ DK RF +   ++ E Y EV  RL    
Sbjct: 181 GK----ANGKIFLGDEISPDTCRFWDTETKEKLDKDRFRRDLGKVEEAYVEVYSRLKEAV 236

Query: 241 KN 242
           +N
Sbjct: 237 EN 238


>gi|290475633|ref|YP_003468522.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Xenorhabdus bovienii SS-2004]
 gi|289174955|emb|CBJ81756.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase (SAICAR
           synthetase) [Xenorhabdus bovienii SS-2004]
          Length = 237

 Score =  240 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 79/241 (32%), Positives = 130/241 (53%), Gaps = 4/241 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++  +
Sbjct: 1   MQKKAELYRGKAKTVYSTDNPDLLVLEFRNDTSALDGERIEQFDRKGMVNNKFNHFIMNK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   +RN AAGSL KRL + EG+ L   L + 
Sbjct: 61  LEEAGIPTQMERLLSDNECLVKKLDMVPVECVIRNRAAGSLVKRLGVEEGMVLNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  + EM  LS + N+ ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAKHDPMVNESYCETFGWVSKVHLAEMKQLSYKANEVLSKLFNDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           G         +VL DE  PD  RLWD    ++ DK RF +S   L+E Y EVARR+G+  
Sbjct: 181 GLF----NGNVVLGDEFSPDGSRLWDQQTLDKMDKDRFRQSLGGLIEAYEEVARRIGVIL 236

Query: 241 K 241
            
Sbjct: 237 D 237


>gi|291085052|ref|ZP_06351881.2| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Citrobacter youngae ATCC 29220]
 gi|291071770|gb|EFE09879.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Citrobacter youngae ATCC 29220]
          Length = 261

 Score =  240 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 77/238 (32%), Positives = 127/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 25  MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMTK 84

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ +EM+P+   VRN AAGSL KRL + EG+ L   L + 
Sbjct: 85  LQEAGIPTQMERLLSDTECLVKKLEMVPVECVVRNRAAGSLVKRLGVEEGIELNPPLFDL 144

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    ++++ +   F W ++  +  M  L+ + ND +  +F    + LVDF+++ 
Sbjct: 145 FLKNDAMHDPMINDSYCETFGWVSKENLARMKELTYKANDVLKKMFDDAGLILVDFKLEF 204

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    ++ DK RF +S   L+E Y  VA RLG+
Sbjct: 205 GLY----KGEVVLGDEFSPDGSRLWDKETLDKMDKDRFRQSLGGLIEAYEAVAHRLGV 258


>gi|288819068|ref|YP_003433416.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Hydrogenobacter thermophilus TK-6]
 gi|288788468|dbj|BAI70215.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Hydrogenobacter thermophilus TK-6]
 gi|308752651|gb|ADO46134.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Hydrogenobacter thermophilus TK-6]
          Length = 232

 Score =  240 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 89/232 (38%), Positives = 128/232 (55%), Gaps = 3/232 (1%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             VYE K KI+Y+  +P   I +FKD     +  + A + GKG LNN IS  +F  L + 
Sbjct: 2   EKVYEGKAKIVYKTEDPDKYILYFKDTATAFDATKRAEVEGKGELNNNISSLIFQLLEER 61

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
           GI  +FIR+++ RE LV   +   L + VRN +AGSL KRL I EG  L + LVEF+Y  
Sbjct: 62  GIRTHFIRKLSSREMLVWRAKRFELEVVVRNISAGSLCKRLGIEEGKPLEKPLVEFFYKN 121

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D     LV  +HI       + ++ E+  ++ R+N+ +   F    + LVDF+++ G+L 
Sbjct: 122 DELHDPLVCYDHIILLGLLKEEQIHEIKHITFRVNEILREFFSQHGLILVDFKLEFGQLP 181

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           D     + + DE+ PD CRLWD    E+ DK RF      LLEGY +V  +L
Sbjct: 182 D---GSLAVVDEVSPDTCRLWDAKTGEKLDKDRFRFDLGDLLEGYRKVLEKL 230


>gi|332706202|ref|ZP_08426271.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Lyngbya
           majuscula 3L]
 gi|332355039|gb|EGJ34510.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Lyngbya
           majuscula 3L]
          Length = 242

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 83/240 (34%), Positives = 133/240 (55%), Gaps = 7/240 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M P   +YE K KI+Y   +P  L+  FKDD    N  +   ++GKG +N  I+ ++F  
Sbjct: 1   MSPDQKLYEGKAKILYTTDDPEILLTHFKDDATAFNAQKRGQISGKGEINCAIASHLFKV 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +FI R    + LV+ V+++PL + VRN AAGSL ++  IPEG  LP++LVEF
Sbjct: 61  LEENGIATHFIDRPTPNQMLVKQVKIVPLEVVVRNIAAGSLCQQTGIPEGRVLPKALVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y   D     L++ + +     A   +++++   ++RIN  +T  F    I LVDF+++ 
Sbjct: 121 YLKNDDLGDPLLTRDRLLLLELATPEQLKQLIEQALRINQILTDFFYQCGITLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEE----CDKKRFSKSNDQLLEGYSEVARRL 236
           G         ++LADEI PD CRLW+ ++ +      DK RF K    + + Y +V +++
Sbjct: 181 GLTP---SEELLLADEISPDTCRLWNQAETDPERRVMDKDRFRKDLGNVEQAYQQVLQKV 237


>gi|172037294|ref|YP_001803795.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cyanothece sp. ATCC 51142]
 gi|171698748|gb|ACB51729.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cyanothece sp. ATCC 51142]
          Length = 244

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 80/236 (33%), Positives = 126/236 (53%), Gaps = 7/236 (2%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K KI+Y       L+  FKDD    N  +  T+  KG +N +I+  +F  L   
Sbjct: 3   KKLYEGKAKILYSTDNAEVLLTHFKDDATAFNAQKRGTIAQKGKMNCQITVALFQWLESK 62

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
           GIP + I +    E LV+ V++IP+ + VRN AAGSL ++  + EG  LP  LVE+Y   
Sbjct: 63  GIPTHLIEQSADDEILVKRVKIIPIEVVVRNIAAGSLCRQTGLEEGHELPFPLVEYYLKN 122

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D     L++ + +     A + +++++  L++ IN  +  LF    I LVDF+++ G   
Sbjct: 123 DELGDPLLTCDRLLILELATEEQLKQLQTLALSINQHLQELFASCQITLVDFKLEFGID- 181

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEE----CDKKRFSKSNDQLLEGYSEVARRL 236
                +I+LADEI PD CRLWD ++ +      DK RF +   Q+   Y +V +R+
Sbjct: 182 --TQGQILLADEISPDTCRLWDQTQSDPERRVMDKDRFRRDLGQVETAYQQVQKRI 235


>gi|157371744|ref|YP_001479733.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Serratia
           proteamaculans 568]
 gi|167011922|sp|A8GHL5|PUR7_SERP5 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|157323508|gb|ABV42605.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Serratia
           proteamaculans 568]
          Length = 237

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 82/238 (34%), Positives = 129/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKLAELYRGKAKTVYTTENPDLLVLEFRNDTSALDGQRIEQFDRKGMVNNKFNHFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   +RN AAGSL KRL I EGL L   L + 
Sbjct: 61  LEEAGIPTQMERLLSDNEVLVKKLDMVPVECVIRNRAAGSLVKRLGIEEGLVLNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D     +V+E +   F W N+  +  M  LS + ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDEMHDPMVNESYCETFGWVNKQHLARMRELSYQANDVLSKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD +  ++ DK RF +S   L+E Y EVARR+G+
Sbjct: 181 GLF----NGEVVLGDEFSPDGSRLWDKNTLDKMDKDRFRQSLGGLIEAYEEVARRIGV 234


>gi|16330103|ref|NP_440831.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Synechocystis sp. PCC 6803]
 gi|6225903|sp|P73471|PUR7_SYNY3 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|1652590|dbj|BAA17511.1| phosphoribosyl aminoidazole succinocarboxamide synthetase
           [Synechocystis sp. PCC 6803]
          Length = 264

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 84/236 (35%), Positives = 127/236 (53%), Gaps = 7/236 (2%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K KI+Y   +P  L+  FKDD    N  +   + GKG +N  IS  +F  L  +
Sbjct: 18  EKLYEGKAKILYPTEDPDVLLTIFKDDATAFNAQKKGQIQGKGAINCAISAALFRWLETL 77

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
           GIP ++I      + LV+ V +IPL + VRN AAGSL K+  + EGL LP  LVEFY+  
Sbjct: 78  GIPTHYIDCPQNDQMLVKAVNIIPLEVVVRNIAAGSLCKQTGLKEGLVLPNPLVEFYFKD 137

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D+    L++ E        +++ ++ +  L++ IN  +   F   +I LVDF+++ G   
Sbjct: 138 DALGDPLLTWERALLLGVTDEARLQTLKDLALNINQHLQRFFAQCDITLVDFKLEFG--- 194

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEE----CDKKRFSKSNDQLLEGYSEVARRL 236
            D   +I+LADEI PD CRLWD ++ +      DK RF +    +   Y  V +R+
Sbjct: 195 GDRQGKIILADEISPDTCRLWDNAQADPQARVLDKDRFRRDLGSIEAAYQTVEKRV 250


>gi|68171803|ref|ZP_00545143.1| SAICAR synthetase [Ehrlichia chaffeensis str. Sapulpa]
 gi|88658076|ref|YP_507111.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ehrlichia
           chaffeensis str. Arkansas]
 gi|123493704|sp|Q2GHH2|PUR7_EHRCR RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|67998776|gb|EAM85488.1| SAICAR synthetase [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599533|gb|ABD45002.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ehrlichia
           chaffeensis str. Arkansas]
          Length = 242

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 97/240 (40%), Positives = 148/240 (61%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K KII+  L P  +IQ FKD+    NN + A ++ KG+LNN IS ++  +
Sbjct: 1   MENKEKIYEGKAKIIFATLNPLEVIQHFKDEITAFNNKKAAIIHEKGILNNYISSFLMKK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +FI  +N REQLV+ + +IP+ + +RN AAG+ +KR  I +G      ++EF
Sbjct: 61  LIDKGIKTHFISLLNQREQLVKKITIIPIEVVIRNLAAGNFSKRFQIADGTPFKSPIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSE HI +F W    E+E++  LS++IN+ ++ LF  + I+LVDF+++ 
Sbjct: 121 YYKNDELSDPMVSEGHILSFQWLTNQELEKIKILSLKINNILSELFFNVGIKLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           G+L +D+   + LADEI PD CRLWD+S  +  DK R+  +   ++EGY EVA +L    
Sbjct: 181 GKLHNDEQSDLFLADEISPDTCRLWDISTNKRLDKDRYRLNLGNVIEGYREVAHKLNAIP 240


>gi|170758707|ref|YP_001788202.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium botulinum A3 str. Loch Maree]
 gi|229485556|sp|B1KZ59|PUR7_CLOBM RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|169405696|gb|ACA54107.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium botulinum A3 str. Loch Maree]
          Length = 234

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 88/237 (37%), Positives = 135/237 (56%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  ++ +YE K K I+   +  T++ ++KDD    N  +  T+  KGV+NN I+  +F  
Sbjct: 1   MEKKDMLYEGKAKKIFGTDDKDTVVVYYKDDATAFNGEKKGTIEDKGVMNNSITSMLFEL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+  +FI +IN REQL + VE++PL + VRN AAGS+AKRL + EG  L  ++ E 
Sbjct: 61  LEKKGVKTHFIEKINEREQLCKKVEIVPLEVIVRNIAAGSMAKRLGLSEGRKLDTTVFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A       E++EM +++ ++N+ +   F    I LVDF+I+ 
Sbjct: 121 SYKNDDLNDPLINDYHAVAIGLTTFEELKEMYSIAEKVNNTLKEFFDKQGIILVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           GR        ++LADEI PD CRLWD    E+ DK RF +    + E Y E+ +R+ 
Sbjct: 181 GR----SRGGLLLADEISPDTCRLWDKKTGEKLDKDRFRRDMGNVKEAYMEILKRVN 233


>gi|146312613|ref|YP_001177687.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterobacter sp. 638]
 gi|167011919|sp|A4WD56|PUR7_ENT38 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|145319489|gb|ABP61636.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterobacter sp. 638]
          Length = 237

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 78/238 (32%), Positives = 124/238 (52%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP      ++  E LV+ ++M+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LADAGIPTQMEALLSDTECLVKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D     +V+E +   F W ++  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDEMHDPMVNESYCETFGWVSKENLARMQELTFKANDVLKKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    ++ DK RF +S   L+E Y  VA RLG+
Sbjct: 181 GLY----KGEVVLGDEFSPDGSRLWDKETLDKMDKDRFRQSLGGLIEAYEAVAHRLGV 234


>gi|331269941|ref|YP_004396433.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium botulinum BKT015925]
 gi|329126491|gb|AEB76436.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium botulinum BKT015925]
          Length = 235

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 86/234 (36%), Positives = 135/234 (57%), Gaps = 4/234 (1%)

Query: 3   PRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLG 62
            R  +YE K K +Y+  +   +I ++KDD    N  + + +  KG+LNN I+  +F  L 
Sbjct: 2   KREMLYEGKAKKVYKAEDENHVIIYYKDDATAFNGAKKSQIEHKGILNNNITSTIFKMLH 61

Query: 63  KIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYY 122
             GI  +F +++N REQL + V+++PL + VRN AAGS+AKRL IPEG  L  ++ E  Y
Sbjct: 62  NNGIETHFEKKLNEREQLCKKVDIVPLEVIVRNVAAGSMAKRLGIPEGTELKTTIFEICY 121

Query: 123 LPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGR 182
             D     L+++ H  A       E++E+ +++ +IND +   FL  N++L+DF+++ GR
Sbjct: 122 KNDELGDPLINDYHAVALGLTTFQELKEIYSITSKINDILKKFFLNENVKLIDFKLEFGR 181

Query: 183 LLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
                  +I+LADEI PD CR WD    E+ DK RF +    + E Y E+  R+
Sbjct: 182 F----GGKIILADEISPDTCRFWDAITNEKLDKDRFRRDMGHVEEAYVEILNRI 231


>gi|300723556|ref|YP_003712861.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Xenorhabdus nematophila ATCC 19061]
 gi|297630078|emb|CBJ90715.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase (SAICAR
           synthetase) [Xenorhabdus nematophila ATCC 19061]
          Length = 237

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 78/241 (32%), Positives = 133/241 (55%), Gaps = 4/241 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKKAELYRGKAKTVYTTDNPDLLVLEFRNDTSALDGERIEQFDRKGMVNNKFNHFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    + ++  E LV+ ++M+P+   +RN AAGSL KRL + EG+ L   L + 
Sbjct: 61  LEEAGIPTQMEQLLSDNESLVKKLDMVPVECVIRNRAAGSLVKRLGVEEGMVLNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W +++ + EM  LS + ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKDDAKHDPMVNESYCETFGWVSKAHLSEMKRLSYKANDVLSKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           G        +++L DE  PD  RLWD    ++ DK RF +S   L+E Y EVARR+G+  
Sbjct: 181 GLF----KGQVILGDEFSPDGSRLWDKQTMDKMDKDRFRQSLGGLIEAYEEVARRIGVIL 236

Query: 241 K 241
            
Sbjct: 237 D 237


>gi|168179312|ref|ZP_02613976.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium botulinum NCTC 2916]
 gi|182669845|gb|EDT81821.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium botulinum NCTC 2916]
          Length = 234

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 88/237 (37%), Positives = 135/237 (56%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  ++ +YE K K I+   +  T++ ++KDD    N  +  T+  KGV+NN I+  +F  
Sbjct: 1   MEKKDMLYEGKAKKIFRTDDKDTVVVYYKDDATAFNGEKKGTIEDKGVMNNSITAMLFEL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+  +FI +IN REQL + VE++PL + VRN AAGS+AKRL + EG  L  ++ E 
Sbjct: 61  LEKKGVKTHFIEKINEREQLCKKVEIVPLEVIVRNIAAGSMAKRLGLSEGRKLDTTVFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A       E++EM +++ ++N+ +   F    I LVDF+I+ 
Sbjct: 121 SYKNDDLNDPLINDYHAVAIGLTTFEELKEMYSIAEKVNNTLKEFFDEQGINLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           GR        ++LADEI PD CRLWD    E+ DK RF +    + E Y E+ +R+ 
Sbjct: 181 GRF----NGELLLADEISPDTCRLWDKITGEKLDKDRFRRDMGNVKEAYMEILKRVN 233


>gi|194334183|ref|YP_002016043.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Prosthecochloris aestuarii DSM 271]
 gi|229564409|sp|B4S8K9|PUR7_PROA2 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|194312001|gb|ACF46396.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Prosthecochloris aestuarii DSM 271]
          Length = 235

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 82/236 (34%), Positives = 128/236 (54%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M   + ++E K K ++       +IQ FKDD    N  +  ++  KGV+NN IS  +FT 
Sbjct: 1   MNKVSLLHEGKAKKVFLTDNSDLVIQEFKDDATAFNAKKKGSIQNKGVVNNAISCTLFTF 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           LG+ GIP +++ +++ R+ L + +++I + + VRN AAGSL +R    EG  L   ++E 
Sbjct: 61  LGENGIPTHYVEQLSDRDMLCKHLDIIKVEVVVRNVAAGSLVRRYGFKEGFVLETPIIEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y   D  +  L++E H  A   A+  E++ +  L+  IN  +   F    + LVDF+++ 
Sbjct: 121 YLKDDDLDDPLMNESHAVALGLASYEELDRLKELAAAINTLLRSFFADRKLNLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR        I+L DEI PD CR WDL   E+ DK RF      + + YSEV RR+
Sbjct: 181 GR----HNGTILLGDEISPDTCRFWDLDSGEKMDKDRFRFDMGGVEDAYSEVQRRV 232


>gi|126667508|ref|ZP_01738479.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Marinobacter sp. ELB17]
 gi|126628100|gb|EAZ98726.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Marinobacter sp. ELB17]
          Length = 237

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 79/238 (33%), Positives = 130/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K ++   +P   +  F+DD    +  R   LN KG++NN+ + ++  +
Sbjct: 1   MEKREELYAGKAKSVHTTDDPERFVLVFRDDTSAFDGERIEQLNRKGMVNNKFNAFIMEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP +F   ++  E LV+ ++MIP+   +RN +AGSL +R+ + EGL L     E 
Sbjct: 61  LEAAGIPTHFEGLLSNTECLVKKLDMIPVECVIRNISAGSLCRRIGVEEGLELNPPTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E    +  WA   E+ +M  L+ ++ND +  LF   ++ LVD++++ 
Sbjct: 121 FLKNDALHDPMVNESLAISLGWAKADELAQMKTLTYKVNDVLKTLFADASMLLVDYKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           GR       +IVL DE  PD CR+WD   + + DK RF +    ++E Y EV RRLG+
Sbjct: 181 GRSH----GQIVLGDEFSPDGCRIWDAETRNKMDKDRFRQGLGNVIETYEEVGRRLGM 234


>gi|153937896|ref|YP_001392160.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium botulinum F str. Langeland]
 gi|166229543|sp|A7GHA0|PUR7_CLOBL RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|152933792|gb|ABS39290.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium botulinum F str. Langeland]
 gi|295320165|gb|ADG00543.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium botulinum F str. 230613]
          Length = 234

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 88/237 (37%), Positives = 135/237 (56%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  ++ +YE K K I+   +  T++ ++KDD    N  +  T+  KGV+NN I+  +F  
Sbjct: 1   MEKKDMLYEGKAKKIFRTDDKDTVVVYYKDDATAFNGEKKGTIEDKGVMNNSITAMLFEL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+  +FI +IN REQL + VE++PL + VRN AAGS+AK L + EG  L  ++ E 
Sbjct: 61  LEKKGVKTHFIEKINEREQLCKKVEIVPLEVIVRNIAAGSMAKILGLSEGRKLDTTVFEI 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     L+++ H  A    N  E++EM +++ ++N+ +   F    I LVDF+I+ 
Sbjct: 121 SYKNDDLNDPLINDYHAVAIGLTNFEELKEMYSIAEKVNNTLKEFFDEQGINLVDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           GR        ++LADEI PD CRLWD    E+ DK RF +    + E Y E+ +R+ 
Sbjct: 181 GRF----NGELLLADEISPDTCRLWDKKTGEKLDKDRFRRDMGNVKEAYMEILKRVN 233


>gi|238788111|ref|ZP_04631906.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           frederiksenii ATCC 33641]
 gi|238723698|gb|EEQ15343.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           frederiksenii ATCC 33641]
          Length = 237

 Score =  238 bits (608), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 82/238 (34%), Positives = 127/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++  +
Sbjct: 1   MQKLAELYRGKAKTVYTTENPDLLVLEFRNDTSALDGQRIEQFDRKGMVNNKFNHFIMAK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ +EMIP+   +RN AAGSL KRL I EGL L   L + 
Sbjct: 61  LEEAGIPTQMERLLSDTEVLVKKLEMIPVECVIRNRAAGSLVKRLGIEEGLPLNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F WA ++++  M  LS   ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCETFGWATETQLARMKELSYLANDVLSKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK R+ +S   L+E Y EVA R+G+
Sbjct: 181 GLF----NGEVVLGDEFSPDGSRLWDKKTLNKMDKDRYRQSLGGLIEAYEEVAHRIGV 234


>gi|270264613|ref|ZP_06192878.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Serratia
           odorifera 4Rx13]
 gi|270041296|gb|EFA14395.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Serratia
           odorifera 4Rx13]
          Length = 237

 Score =  238 bits (608), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 82/238 (34%), Positives = 130/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKIAELYRGKAKTVYTTENPDLLVLEFRNDTSALDGQRIEQFDRKGMVNNKFNHFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   +RN AAGSL KRL I EGL L   L + 
Sbjct: 61  LEEAGIPTQMERLLSDNEVLVKKLDMVPVECVIRNRAAGSLVKRLGIEEGLVLNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W N+  +  M  LS + ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCETFGWVNKEHLARMRELSYKANDVLSKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD +  ++ DK RF +S   L+E Y EVARR+G+
Sbjct: 181 GLF----NGEVVLGDEFSPDGSRLWDKNTLDKMDKDRFRQSLGGLIEAYEEVARRIGV 234


>gi|309388432|gb|ADO76312.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Halanaerobium praevalens DSM 2228]
          Length = 239

 Score =  238 bits (608), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 86/236 (36%), Positives = 127/236 (53%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K ++       LI  FKDD    N  +   +  KG +NN+I+ + F  
Sbjct: 1   MEKKEMLYEGKAKQLFATEVTDQLIVHFKDDATAFNGQKKGQIKEKGKINNKITNFFFKL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  + IR +N  + LV+ V++IPL + +RN AAGSLAKR+   EG  L + ++EF
Sbjct: 61  LEAEGIKTHLIRELNQTDSLVKKVKIIPLEVVMRNLAAGSLAKRIGFTEGKLLRQPVIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     L++  HI     A   E+E++ ALS +IN  ++       I LVDF+++ 
Sbjct: 121 YYKDDQLGDPLINISHIELLKLAEHQELEKLIALSHKINYILSKFLKARKIDLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+        I+LADEI PD CR WD   KE+ DK RF +    +   Y E+ +R+
Sbjct: 181 GKT---ASGEIILADEITPDTCRFWDSQTKEKLDKDRFRRDLGNVEAAYQEMYQRI 233


>gi|195940773|ref|ZP_03086155.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Escherichia coli O157:H7 str. EC4024]
          Length = 237

 Score =  238 bits (608), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 77/238 (32%), Positives = 126/238 (52%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP      ++  E LV+ ++M+P+   +RN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LAEAGIPTQMEALLSDTECLVKKLDMVPVECVIRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCETFGWVSKENLARMQELTYKANDVLKKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    ++ DK RF +S   ++E Y  VA RLG+
Sbjct: 181 GLY----KGEVVLGDEFSPDGSRLWDKETLDKMDKDRFRQSLGGVVEAYEAVAHRLGV 234


>gi|22125319|ref|NP_668742.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis KIM 10]
 gi|45442455|ref|NP_993994.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis biovar Microtus str. 91001]
 gi|51597097|ref|YP_071288.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pseudotuberculosis IP 32953]
 gi|108808244|ref|YP_652160.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis Antiqua]
 gi|108811489|ref|YP_647256.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis Nepal516]
 gi|145599438|ref|YP_001163514.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis Pestoides F]
 gi|149365080|ref|ZP_01887115.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis CA88-4125]
 gi|153947768|ref|YP_001400229.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pseudotuberculosis IP 31758]
 gi|162421722|ref|YP_001607497.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis Angola]
 gi|165926818|ref|ZP_02222650.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis biovar Orientalis str. F1991016]
 gi|165935984|ref|ZP_02224554.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis biovar Orientalis str. IP275]
 gi|166011240|ref|ZP_02232138.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis biovar Antiqua str. E1979001]
 gi|166212533|ref|ZP_02238568.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis biovar Antiqua str. B42003004]
 gi|167399517|ref|ZP_02305041.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis biovar Antiqua str. UG05-0454]
 gi|167422679|ref|ZP_02314432.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis biovar Orientalis str. MG05-1020]
 gi|167424544|ref|ZP_02316297.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis biovar Mediaevalis str. K1973002]
 gi|167470499|ref|ZP_02335203.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis FV-1]
 gi|170023606|ref|YP_001720111.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pseudotuberculosis YPIII]
 gi|186896189|ref|YP_001873301.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pseudotuberculosis PB1/+]
 gi|218930104|ref|YP_002347979.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis CO92]
 gi|229838658|ref|ZP_04458817.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229895722|ref|ZP_04510893.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Yersinia pestis Pestoides A]
 gi|229899224|ref|ZP_04514367.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229901750|ref|ZP_04516872.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Yersinia pestis Nepal516]
 gi|270489941|ref|ZP_06207015.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Yersinia
           pestis KIM D27]
 gi|294504805|ref|YP_003568867.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis Z176003]
 gi|22001857|sp|Q8ZCD2|PUR7_YERPE RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|81825756|sp|Q668F9|PUR7_YERPS RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|123245696|sp|Q1C5Q7|PUR7_YERPA RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|123373325|sp|Q1CK24|PUR7_YERPN RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|166230849|sp|A4TMM9|PUR7_YERPP RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|167011923|sp|A7FG51|PUR7_YERP3 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229568636|sp|B2K993|PUR7_YERPB RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229568637|sp|B1JSG7|PUR7_YERPY RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229568638|sp|A9R2H1|PUR7_YERPG RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|21958197|gb|AAM84993.1|AE013745_5 phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Yersinia pestis KIM 10]
 gi|45437320|gb|AAS62871.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis biovar Microtus str. 91001]
 gi|51590379|emb|CAH22019.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pseudotuberculosis IP 32953]
 gi|108775137|gb|ABG17656.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis Nepal516]
 gi|108780157|gb|ABG14215.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis Antiqua]
 gi|115348715|emb|CAL21661.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis CO92]
 gi|145211134|gb|ABP40541.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis Pestoides F]
 gi|149291493|gb|EDM41567.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis CA88-4125]
 gi|152959263|gb|ABS46724.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pseudotuberculosis IP 31758]
 gi|162354537|gb|ABX88485.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis Angola]
 gi|165916129|gb|EDR34736.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis biovar Orientalis str. IP275]
 gi|165921169|gb|EDR38393.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis biovar Orientalis str. F1991016]
 gi|165989918|gb|EDR42219.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis biovar Antiqua str. E1979001]
 gi|166206464|gb|EDR50944.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis biovar Antiqua str. B42003004]
 gi|166958386|gb|EDR55407.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis biovar Orientalis str. MG05-1020]
 gi|167052021|gb|EDR63429.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis biovar Antiqua str. UG05-0454]
 gi|167056426|gb|EDR66195.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis biovar Mediaevalis str. K1973002]
 gi|169750140|gb|ACA67658.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pseudotuberculosis YPIII]
 gi|186699215|gb|ACC89844.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pseudotuberculosis PB1/+]
 gi|229681679|gb|EEO77773.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Yersinia pestis Nepal516]
 gi|229687626|gb|EEO79699.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229695024|gb|EEO85071.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229701528|gb|EEO89556.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Yersinia pestis Pestoides A]
 gi|262362868|gb|ACY59589.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis D106004]
 gi|262366791|gb|ACY63348.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis D182038]
 gi|270338445|gb|EFA49222.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Yersinia
           pestis KIM D27]
 gi|294355264|gb|ADE65605.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           pestis Z176003]
 gi|320014379|gb|ADV97950.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Yersinia pestis biovar Medievalis str. Harbin 35]
          Length = 237

 Score =  238 bits (608), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 84/238 (35%), Positives = 129/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKLAELYRGKAKTVYTTENPDLLVLEFRNDTSALDGQRIEQFDRKGMVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ +EMIP+   +RN AAGSL KRL I EGLSL   L + 
Sbjct: 61  LEEAGIPTQMERLLSDTEVLVKKLEMIPVECVIRNRAAGSLVKRLGIEEGLSLNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F WA ++++  M  LS   ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCKTFGWATEAQLARMKELSYLANDVLSKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK R+ +S   L+E Y EVA R+G+
Sbjct: 181 GLF----NGEVVLGDEFSPDGSRLWDKKTLNKMDKDRYRQSLGGLIEAYEEVAHRIGV 234


>gi|288575083|ref|ZP_06393440.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288570824|gb|EFC92381.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 240

 Score =  238 bits (608), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 96/241 (39%), Positives = 136/241 (56%), Gaps = 3/241 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K +Y   +P  L   +K+     N  + A + GKG LNN IS ++F  
Sbjct: 1   MEIREMLYEGKAKRLYSTDDPDALYLKYKNSLTAFNAKKKAEMEGKGELNNMISSWIFKY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +FI RI+   QLV+ V ++PL + VRN  AGS+ +RL + EG+ LPR LVEF
Sbjct: 61  LRSKGIDSHFIERIDELSQLVKPVTIVPLEVVVRNVTAGSICRRLGVEEGMKLPRPLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D  +  LV  +H   F WA   E++ MT +++ ++  +T LF  I+I LVDF+++ 
Sbjct: 121 YYKEDELDDPLVIRDHAVLFGWATDEELDRMTEMALTVDSVLTELFSSIDIDLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           G+        I+LADEI PD CR W    ++  DK RF K    +L  Y E+ RRL   K
Sbjct: 181 GKD---KEGNILLADEISPDTCRFWQKGTRQSLDKDRFRKDLGDVLGAYREIWRRLSEKK 237

Query: 241 K 241
           +
Sbjct: 238 E 238


>gi|224437929|ref|ZP_03658871.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Helicobacter cinaedi CCUG 18818]
 gi|313144372|ref|ZP_07806565.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Helicobacter cinaedi CCUG 18818]
 gi|313129403|gb|EFR47020.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Helicobacter cinaedi CCUG 18818]
          Length = 237

 Score =  238 bits (608), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 85/237 (35%), Positives = 132/237 (55%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +YE K K ++   +   +I  FKDD    N  +    +GKG LN +IS  +F  
Sbjct: 1   MQKEAMLYEGKGKKLFATSDENVVIAEFKDDLTAFNAEKKGVESGKGALNCQISSLLFEL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K G+  ++I+R+N  + L + V +IP+ + VRN A GSL KRL I EG  LP +LVEF
Sbjct: 61  LSKNGVESHYIKRLNDIDMLCKKVSIIPIEVVVRNIATGSLTKRLGISEGSVLPFALVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQS-EVEEMTALSIRINDFMTGLFLGINIQLVDFRIK 179
           YY  D+    ++++EH        +  E+E + A + +IN+ +   F    ++LVDF+++
Sbjct: 121 YYKDDALGDPIINDEHCKILGLVKEQGELEVLKAEARKINEILRDFFDKRGLKLVDFKLE 180

Query: 180 CGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
            G   D    +I+LADEI PD CR WD    ++ DK RF ++   +   Y EV +R+
Sbjct: 181 FGWDKDS---KIILADEISPDSCRFWDKQTNQKLDKDRFRQNLGSVKVAYEEVLKRI 234


>gi|261338062|ref|ZP_05965946.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bifidobacterium gallicum DSM 20093]
 gi|270276676|gb|EFA22530.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bifidobacterium gallicum DSM 20093]
          Length = 249

 Score =  238 bits (608), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 82/247 (33%), Positives = 131/247 (53%), Gaps = 7/247 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K ++   +P  L   + +     N  + A + GKG LNNRI+  +F  
Sbjct: 1   MEKLEKLYEGKAKKLFATDDPEVLWVEYMNQATAGNGAKKAQIEGKGSLNNRITAVIFDL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+  +F+  ++  EQLVR ++M PL I +RNTAAGS AKR  + EG  L + ++EF
Sbjct: 61  LKARGVDSHFVSSLSDTEQLVRKMDMFPLEIIMRNTAAGSFAKRYGVEEGTPLKQPILEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
               D+     ++ + + A     + E++E++  +  +N+ +  +F  I+++LVDF+I+ 
Sbjct: 121 CVKDDALGDPFINNDGLIALGIVTEEELDEISRQARAVNEALLDIFSKIDVRLVDFKIEE 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKK----EECDKKRFSKSNDQLLEGYSEVARRL 236
           GR  D    RI+LADEI PD CRLWD+       E  DK  F +    ++  Y ++  RL
Sbjct: 181 GRTAD---GRILLADEITPDTCRLWDVKDGGETIEHLDKDLFRRDLGNIIPAYEQILERL 237

Query: 237 GIFKKNE 243
                 E
Sbjct: 238 EQLADAE 244


>gi|302874490|ref|YP_003843123.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium cellulovorans 743B]
 gi|307690903|ref|ZP_07633349.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium cellulovorans 743B]
 gi|302577347|gb|ADL51359.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium cellulovorans 743B]
          Length = 237

 Score =  238 bits (608), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 83/236 (35%), Positives = 128/236 (54%), Gaps = 3/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K IY   +   +I  +KD     N  +   +  KGVLNN I+  +F  
Sbjct: 1   MEKLEMMYEGKAKQIYRCADEDKVIVHYKDSATAFNGEKKGEIEDKGVLNNAITSAIFKL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+  +FI+++N R+QL + VE+IPL + VRN AAGS+AKRL + EG  L  ++ E 
Sbjct: 61  LEENGVKTHFIKKLNDRDQLCKKVEIIPLEVIVRNVAAGSMAKRLGLEEGYKLKTTVFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  DS    L+++ H          E++E+  ++ ++N+ +   F   NI L+DF+I+ 
Sbjct: 121 SYKDDSLGDPLINDHHAVGIGATTFEELDEIYKMTAKVNEVLKDFFAKQNISLIDFKIEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G+  D     ++LADEI PD CR WD    E+ DK RF +    +   Y E+  R+
Sbjct: 181 GKTAD---GEVLLADEISPDTCRFWDSITGEKLDKDRFRRDLGDVKAAYVEILNRI 233


>gi|169634878|ref|YP_001708614.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter baumannii SDF]
 gi|169794259|ref|YP_001712052.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter baumannii AYE]
 gi|184159938|ref|YP_001848277.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter baumannii ACICU]
 gi|213158744|ref|YP_002321165.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter baumannii AB0057]
 gi|215481817|ref|YP_002323999.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter baumannii AB307-0294]
 gi|239502785|ref|ZP_04662095.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter baumannii AB900]
 gi|260553890|ref|ZP_05826158.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Acinetobacter sp. RUH2624]
 gi|260557816|ref|ZP_05830029.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter baumannii ATCC 19606]
 gi|301345876|ref|ZP_07226617.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter baumannii AB056]
 gi|301509944|ref|ZP_07235181.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter baumannii AB058]
 gi|301594522|ref|ZP_07239530.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter baumannii AB059]
 gi|332850337|ref|ZP_08432671.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Acinetobacter baumannii 6013150]
 gi|332871555|ref|ZP_08440049.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Acinetobacter baumannii 6013113]
 gi|332873373|ref|ZP_08441327.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Acinetobacter baumannii 6014059]
 gi|226723531|sp|B7GV30|PUR7_ACIB3 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|226723532|sp|B7I289|PUR7_ACIB5 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229485594|sp|B0VA00|PUR7_ACIBY RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229485595|sp|B2I2E3|PUR7_ACIBC RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229485596|sp|B0VPX5|PUR7_ACIBS RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|229485597|sp|A3MA70|PUR7_ACIBT RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|169147186|emb|CAM85045.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter baumannii AYE]
 gi|169153670|emb|CAP02866.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter baumannii]
 gi|183211532|gb|ACC58930.1| Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [Acinetobacter baumannii ACICU]
 gi|193078742|gb|ABO13814.2| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter baumannii ATCC 17978]
 gi|213057904|gb|ACJ42806.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter baumannii AB0057]
 gi|213987176|gb|ACJ57475.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter baumannii AB307-0294]
 gi|260405010|gb|EEW98512.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Acinetobacter sp. RUH2624]
 gi|260408607|gb|EEX01912.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter baumannii ATCC 19606]
 gi|322509854|gb|ADX05308.1| purC [Acinetobacter baumannii 1656-2]
 gi|323519863|gb|ADX94244.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter baumannii TCDC-AB0715]
 gi|332730795|gb|EGJ62105.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Acinetobacter baumannii 6013150]
 gi|332731409|gb|EGJ62701.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Acinetobacter baumannii 6013113]
 gi|332738436|gb|EGJ69309.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Acinetobacter baumannii 6014059]
          Length = 239

 Score =  238 bits (608), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 88/238 (36%), Positives = 131/238 (55%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +Y  K K +YE      LI  F+DD    N  +   L+ KG +NNR + ++  +
Sbjct: 1   MLKQTLLYTGKAKSVYETDNADHLILVFRDDASAFNGEKIEQLDRKGKVNNRFNAFIMEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +F + ++  E LV+ ++MIP+   +RN AAGSL +RL + EG  L     E 
Sbjct: 61  LAEAGIETHFEKLLSPTEVLVKKLQMIPVECVIRNYAAGSLCRRLGVEEGKELTPPTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +Y  D     +V+E    A  WA   ++E+M  L+ ++ND +  LF   N+ LVDF+++ 
Sbjct: 121 FYKDDGLGDPMVNESQAIALGWATAEQLEQMKVLTYKVNDVLKALFAEGNMILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G   D    RIVL DE  PD CRLWD   K++ DK RF +    ++E Y EVA RLG+
Sbjct: 181 GVFHD----RIVLGDEFSPDGCRLWDKDTKKKLDKDRFRQGLGGVVEAYEEVAARLGV 234


>gi|299768303|ref|YP_003730329.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter sp. DR1]
 gi|298698391|gb|ADI88956.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter sp. DR1]
          Length = 239

 Score =  238 bits (607), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 87/238 (36%), Positives = 129/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +Y  K K +YE      LI  F+DD    N  +   L+ KG +NN  + ++  +
Sbjct: 1   MLKQTLLYTGKAKSVYETDNADHLILVFRDDASAFNGEKIEQLDRKGKVNNLFNAFIMEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +F + ++  E LV+ ++MIP+   +RN AAGSL +RL + EG  L     E 
Sbjct: 61  LAAAGIETHFEKLLSPTEVLVKKLQMIPVECVIRNYAAGSLCRRLGVEEGKELTPPTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +Y  D     +V+E    A  WA   ++E+M  L+ ++ND +  LF   N+ LVDF+++ 
Sbjct: 121 FYKDDGLGDPMVNESQAIALGWATAEQLEQMKVLTYQVNDVLKALFAEGNMILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G   D    RIVL DE  PD CRLWD   K++ DK RF +    ++E Y EVA RLG+
Sbjct: 181 GVFHD----RIVLGDEFSPDGCRLWDKDSKKKLDKDRFRQGLGGVVEAYEEVAARLGV 234


>gi|166365879|ref|YP_001658152.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Microcystis aeruginosa NIES-843]
 gi|166088252|dbj|BAG02960.1| phosphoribosyl aminoidazole succinocarboxamide synthetase
           [Microcystis aeruginosa NIES-843]
          Length = 241

 Score =  238 bits (607), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 82/236 (34%), Positives = 130/236 (55%), Gaps = 7/236 (2%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K KI+Y+  +P  L+ ++KDD    N  +   + GKG +N  +S  +F  L  +
Sbjct: 2   EKLYEGKAKILYQTDDPDILLTYYKDDATAFNAQKRGQIVGKGEINCTVSTALFQWLESL 61

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
           GIP ++I R + RE  V+ +++IPL + VRN AAGSL K+  + EG  LP  LVEFY   
Sbjct: 62  GIPTHYIDRPSSREMRVKAIKIIPLEVVVRNIAAGSLCKQTGLKEGKVLPFPLVEFYLKD 121

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D+    L++ + I   + A++ +V ++  L+++IN ++   F    I LVDF+++ G   
Sbjct: 122 DALGDPLLTPDRIKVIDIASEEQVNQLRDLALQINQYLQEFFDKCQIILVDFKLEFGVD- 180

Query: 185 DDDILRIVLADEIFPDCCRLWDL----SKKEECDKKRFSKSNDQLLEGYSEVARRL 236
                +I L DEI PD CRLWD     ++    DK RF +    +   Y +V  R+
Sbjct: 181 --KTGKIYLGDEISPDTCRLWDKTQEDAQARILDKDRFRRDLGDVETAYQQVQARV 234


>gi|34557023|ref|NP_906838.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Wolinella
           succinogenes DSM 1740]
 gi|39931692|sp|Q7M9X5|PUR7_WOLSU RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|34482738|emb|CAE09738.1| AMINOIMIDAZOLE-SUCCINOCARBOXAMIDE [Wolinella succinogenes]
          Length = 236

 Score =  238 bits (607), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 86/237 (36%), Positives = 128/237 (54%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M   + +YE K K +Y    P  ++  FKDD    N  +     GKG LN +IS  +F  
Sbjct: 1   MEKASMIYEGKGKKLYNTSHPDQVVAEFKDDLTAFNAEKKGNEAGKGALNCQISTEIFKL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +FI++++ +  L + V +IP+ +  RN A GSL+KRL I EG  LP SLVEF
Sbjct: 61  LEAEGIKTHFIKQLDEKNMLCKRVSIIPIEVVTRNIATGSLSKRLGIKEGSVLPFSLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWA-NQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIK 179
           YY  D+    ++++EH        +Q E+E +   +  IN+ +   F    + LVDF+++
Sbjct: 121 YYKDDALGDPIMNDEHAILLKCVNSQEELEFLKETAREINEILRSFFDSKGLNLVDFKLE 180

Query: 180 CGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
            G+ ++     I+LADEI PD CR WD    E+ DK RF +    +   Y EV RR+
Sbjct: 181 FGKDIE---GNILLADEISPDSCRFWDKKTNEKLDKDRFRQDLGNVKMAYEEVLRRI 234


>gi|123441481|ref|YP_001005467.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|332162575|ref|YP_004299152.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|166230848|sp|A1JL09|PUR7_YERE8 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|122088442|emb|CAL11234.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|318606674|emb|CBY28172.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325666805|gb|ADZ43449.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330863277|emb|CBX73402.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Yersinia
           enterocolitica W22703]
          Length = 237

 Score =  238 bits (607), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 126/238 (52%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++  +
Sbjct: 1   MQKLAELYRGKAKTVYTTENPDLLVLEFRNDTSALDGQRIEQFDRKGMVNNKFNHFIMAK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP      ++  E LV+ +EMIP+   +RN AAGSL KRL I EGL L   L + 
Sbjct: 61  LEEAGIPTQMESLLSDTEVLVKKLEMIPVECVIRNRAAGSLVKRLGIEEGLELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F WA ++++  M  LS   ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCKTFGWATEAQLARMKELSYLANDVLSKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK R+ +S   L+E Y EVA R+G+
Sbjct: 181 GLF----NGEVVLGDEFSPDGSRLWDKKTLNKMDKDRYRQSLGGLIEAYEEVAHRIGV 234


>gi|183599394|ref|ZP_02960887.1| hypothetical protein PROSTU_02865 [Providencia stuartii ATCC 25827]
 gi|188021634|gb|EDU59674.1| hypothetical protein PROSTU_02865 [Providencia stuartii ATCC 25827]
          Length = 237

 Score =  238 bits (607), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 79/238 (33%), Positives = 130/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y   +P  LI  F++D    +  R      KG++NN+ + ++ ++
Sbjct: 1   MQKKAELYRGKAKTVYTTEDPDLLILEFRNDTSALDGERIEQFERKGMVNNKFNHFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP      ++  E LV+ ++M+P+   +RN AAGSL KRL + EG+ L   L + 
Sbjct: 61  LEEAGIPTQMEALLSDTEALVKKLDMVPVECVIRNRAAGSLVKRLGVEEGMELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W N+  + EM  LS + N+ ++ +F    + LVDF+++ 
Sbjct: 121 FLKDDAKHDPMVNESYCETFGWVNKENLAEMKRLSYKANEVLSKIFADAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        ++VL DE  PD  RLWD     + DK RF +S   L+E Y EVARR+G+
Sbjct: 181 GLF----KGKVVLGDEFSPDGSRLWDKETLNKMDKDRFRQSLGGLIEAYEEVARRIGV 234


>gi|317492762|ref|ZP_07951187.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316919285|gb|EFV40619.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 237

 Score =  238 bits (607), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 79/238 (33%), Positives = 127/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y    P  LI  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKLAELYRGKAKTVYTTENPDLLILEFRNDTSALDGQRIEQFDRKGMVNNKFNHFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   +RN AAGSL KRL I EG  L   L + 
Sbjct: 61  LEEAGIPTQMERLLSDTEVLVKKLDMVPVECVIRNRAAGSLVKRLGIEEGTPLNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D     +V+E +   F W +   +  M ALS ++ND ++ +F    + LVDF+++ 
Sbjct: 121 FLKNDVMHDPMVNESYCRTFGWVSDENLATMKALSYKVNDVLSKIFGDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        ++VL DE  PD  RLWD     + DK R+ +S   L+E Y EVA R+G+
Sbjct: 181 GLF----KGQVVLGDEFSPDGSRLWDKETLNKMDKDRYRQSLGGLIEAYEEVAHRIGV 234


>gi|293610476|ref|ZP_06692776.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826820|gb|EFF85185.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325123956|gb|ADY83479.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter calcoaceticus PHEA-2]
          Length = 239

 Score =  238 bits (607), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 88/238 (36%), Positives = 130/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +Y  K K +YE      LI  F+DD    N  +   L+ KG +NNR + ++  +
Sbjct: 1   MLKQTLLYTGKAKSVYETDNADHLILVFRDDASAFNGEKIEQLDRKGKVNNRFNAFIMEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +F + ++  E LV+ ++MIP+   +RN AAGSL +RL + EG  L     E 
Sbjct: 61  LAAAGIETHFEKLLSPTEVLVKKLQMIPVECVIRNYAAGSLCRRLGVEEGKELTPPTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +Y  D     +V+E    A  WA   ++E+M  L+ ++ND +  LF   N+ LVDF+++ 
Sbjct: 121 FYKDDGLGDPMVNESQAIALGWATAEQLEQMKVLTYKVNDVLKALFAEGNMILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G   D    RIVL DE  PD CRLWD   K++ DK RF +    ++E Y EVA RLG+
Sbjct: 181 GVFHD----RIVLGDEFSPDGCRLWDKDSKKKLDKDRFRQGLGGVVEAYEEVAARLGV 234


>gi|257884790|ref|ZP_05664443.1| saicar synthetase [Enterococcus faecium 1,231,501]
 gi|293552840|ref|ZP_06673498.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterococcus faecium E1039]
 gi|257820628|gb|EEV47776.1| saicar synthetase [Enterococcus faecium 1,231,501]
 gi|291602974|gb|EFF33168.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterococcus faecium E1039]
          Length = 242

 Score =  238 bits (607), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 88/243 (36%), Positives = 133/243 (54%), Gaps = 4/243 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K +Y   +   +   + D     N  R   ++GKG LNN+I+  +F  
Sbjct: 1   MEKKELLYEGKAKKLYLTSDENLIWVEYLDQATALNGARKDQISGKGELNNQITSTIFRY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI ++FI +++  EQLV+ V++IPL + +RN AAGS +KRL +PEG  L   +VEF
Sbjct: 61  LTQRGIKNHFIEQLSKTEQLVKKVQIIPLEVVIRNIAAGSFSKRLGVPEGKKLIEPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D  +   V+EEHI     A   E+ E+   ++ IN  +  LF  + + LVDF+++ 
Sbjct: 121 YYKDDQLDDPFVNEEHIYYLQLAKPEEISELKTQALAINKILIELFAKVGLVLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR       +I+LADE+ PD CRLWD    E  DK  + +    L+  Y EV  RL    
Sbjct: 181 GR----SNEKILLADEVTPDTCRLWDERTNEHMDKDVYRRDLGDLIPVYQEVYNRLSELT 236

Query: 241 KNE 243
           + +
Sbjct: 237 EEK 239


>gi|238752060|ref|ZP_04613544.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           rohdei ATCC 43380]
 gi|238709760|gb|EEQ01994.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           rohdei ATCC 43380]
          Length = 237

 Score =  238 bits (607), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 127/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++  +
Sbjct: 1   MQKLAELYRGKAKTVYTTENPDLLVLEFRNDTSALDGQRIEQFDRKGMVNNKFNHFIMAK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++MIP+   +RN AAGSL KRL I EGL L   L + 
Sbjct: 61  LEEAGIPTQMERLLSDTEVLVKKLDMIPVECVIRNRAAGSLVKRLGIEEGLQLNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F WA ++++  M  LS   ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCKTFGWATEAQLARMKELSYLANDVLSKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK R+ +S   L+E Y EVA R+G+
Sbjct: 181 GLF----NGEVVLGDEFSPDGSRLWDKQTLNKMDKDRYRQSLGGLIEAYEEVAHRIGV 234


>gi|257898756|ref|ZP_05678409.1| saicar synthetase [Enterococcus faecium Com15]
 gi|257836668|gb|EEV61742.1| saicar synthetase [Enterococcus faecium Com15]
          Length = 242

 Score =  238 bits (607), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 85/243 (34%), Positives = 131/243 (53%), Gaps = 4/243 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K +Y   +   +   + D     N  R   ++GKG LNN+I+  +F  
Sbjct: 1   MEKKELLYEGKAKKLYLTSDENLIWVEYLDQATALNGARKDQISGKGELNNQITSTIFRY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI ++FI +++  EQL + V++IPL + +RN AAGS +KRL +PEG  L   +VEF
Sbjct: 61  LTHRGIKNHFIEQLSKTEQLAKKVQIIPLEVVIRNIAAGSFSKRLGVPEGKKLIEPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D  +   V+E+HI     A   E+ E+   ++ IN  +  LF  + + LVDF+++ 
Sbjct: 121 YYKDDQLDDPFVNEDHIYYLQLAKPEEISELKTQALAINKILIELFAKVGLVLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR       +++LADE+ PD CRLWD    E  DK  + +    L+  Y EV  RL    
Sbjct: 181 GR----SNGKMLLADEVTPDTCRLWDERTNEHMDKDVYRRGLGDLIPVYQEVYNRLSELT 236

Query: 241 KNE 243
           + +
Sbjct: 237 EEK 239


>gi|124514787|gb|EAY56299.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Leptospirillum rubarum]
          Length = 239

 Score =  238 bits (607), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 84/236 (35%), Positives = 136/236 (57%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M   + +YE K KI+++  +P TL+Q FKDD    N  +   +  KG +N ++S ++F  
Sbjct: 1   ME-GHRIYEGKAKILFDRGDPDTLVQHFKDDATAFNAQKKGRILHKGAINCQLSAHLFEF 59

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+P +++ R+   E  VR + M+PL + +RN  AGSLAKRL  PEG +LP  ++E+
Sbjct: 60  LEREGVPTHYVERLTPVEMKVRRLSMVPLEVVLRNRYAGSLAKRLGQPEGGALPFPVLEW 119

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +V+ +HI     A+++ + ++  L  R+ND ++G F   +I L D +++ 
Sbjct: 120 YYKRDDLGDPIVNRDHIRVLGVASETILADVERLGRRVNDILSGFFGRKDIVLADMKLEF 179

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G    +   +I+L DEI PD CR WD    E+ DK RF +    + E Y E+ RR+
Sbjct: 180 GV---ERSGKILLGDEISPDTCRFWDAKTGEKMDKDRFRRDLGHIEEYYLELFRRV 232


>gi|288549923|ref|ZP_05968641.2| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Enterobacter cancerogenus ATCC 35316]
 gi|288317207|gb|EFC56145.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Enterobacter cancerogenus ATCC 35316]
          Length = 239

 Score =  238 bits (607), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 79/238 (33%), Positives = 126/238 (52%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 3   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMTK 62

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP      ++  E LV+ ++M+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 63  LAEAGIPTQMEALLSDTECLVKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL 122

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 123 FLKNDAMHDPMVNESYCETFGWVSKENLARMQELTYKANDVLKKLFDDAGLILVDFKLEF 182

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    ++ DK RF +S   L+E Y  VA RLG+
Sbjct: 183 GLF----KGEVVLGDEFSPDGSRLWDKETLDKMDKDRFRQSLGGLIEAYEAVAHRLGV 236


>gi|238792087|ref|ZP_04635723.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           intermedia ATCC 29909]
 gi|238728718|gb|EEQ20236.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           intermedia ATCC 29909]
          Length = 237

 Score =  238 bits (607), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 83/238 (34%), Positives = 127/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKLAELYRGKAKTVYTTENPDLLVLEFRNDTSALDGQRIEQFDRKGMVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP    R ++  E LV+ +EMIP+   +RN AAGSL KRL I EGL L   L + 
Sbjct: 61  LEDAGIPTQMERLLSDTEVLVKKLEMIPVECVIRNRAAGSLVKRLGIEEGLQLNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F WA ++++  M  LS   ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNETYCKTFGWATEAQLARMKELSYLANDVLSKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK R+ +S   L+E Y EVA R+G+
Sbjct: 181 GLF----NGEVVLGDEFSPDGSRLWDKKTLNKMDKDRYRQSLGGLIEAYEEVAHRIGV 234


>gi|15613189|ref|NP_241492.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           halodurans C-125]
 gi|20139778|sp|Q9KF60|PUR7_BACHD RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|10173240|dbj|BAB04345.1| phosphoribosylaminoimidazole succinocarboxamide synthetase
           [Bacillus halodurans C-125]
          Length = 237

 Score =  238 bits (606), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 94/237 (39%), Positives = 136/237 (57%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M   + +YE K K IY   E G L   +K+     N  + A++ GK  LNN IS  +F+ 
Sbjct: 1   MEKHDLLYEGKAKKIYRTDEEGLLWVEYKNSATAFNGEKKASIEGKARLNNEISSLIFSY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+  +F++R++  EQL+  V +IPL + VRN  AGSLAKR+ I EG  L + LVEF
Sbjct: 61  LKEQGVDSHFVKRLSETEQLIHQVTIIPLEVVVRNVIAGSLAKRIGIEEGTPLEKPLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     LV+E+HI     A + +V+ +   +I +ND +T  F GI ++LVDF+++ 
Sbjct: 121 YYKDDDLGDPLVTEDHIAILQAATKEQVDILKVKAIEVNDALTTFFAGIGVKLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G   D     I+LADEI PD CRLWD    E  DK  F ++   L +GY ++  R+ 
Sbjct: 181 GVTAD---GAILLADEISPDTCRLWDAKTGERFDKDLFRRNLGNLQDGYEQILTRIE 234


>gi|67924365|ref|ZP_00517796.1| SAICAR synthetase [Crocosphaera watsonii WH 8501]
 gi|67853791|gb|EAM49119.1| SAICAR synthetase [Crocosphaera watsonii WH 8501]
          Length = 246

 Score =  238 bits (606), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 80/236 (33%), Positives = 130/236 (55%), Gaps = 7/236 (2%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K KI+Y   +P  L+  FKDD    N  +  T+  KG +N +I+  +F  L   
Sbjct: 3   EKLYEGKAKILYTTDDPDILLTHFKDDATAFNAQKRGTIVEKGKMNCQITVALFQWLESK 62

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
           GIP + I++    + LV+ V++IP+ + VRN AAGSL ++  + EG  LP  LVEFY+  
Sbjct: 63  GIPTHLIKQSADDKILVKRVKIIPIEVVVRNIAAGSLCRQTGLEEGSKLPFPLVEFYFKN 122

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D     L++ + +     A + +++++  L++ IN  +   F    I LVDF+++ G   
Sbjct: 123 DELGDPLLTRDRLLILELATEEQLKQLQNLALSINQHLQEFFASCQITLVDFKLEFGLD- 181

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEE----CDKKRFSKSNDQLLEGYSEVARRL 236
                +I+LADEI PD CRLWD ++K+      DK RF +   ++   Y +V +R+
Sbjct: 182 --KQGKILLADEISPDTCRLWDQTEKDPQKRVMDKDRFRRDLGKVETAYQQVQKRV 235


>gi|238919131|ref|YP_002932645.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Edwardsiella ictaluri 93-146]
 gi|259546860|sp|C5B7A4|PUR7_EDWI9 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|238868699|gb|ACR68410.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase, putative
           [Edwardsiella ictaluri 93-146]
          Length = 237

 Score =  238 bits (606), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 130/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y   +P  LI  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKLAELYRGKAKTVYTTEDPDLLILSFRNDTSALDGQRIEQFDRKGMVNNKFNHFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP    R ++  + LV+ +EM+P+   +RN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LEAAGIPTQMERLLSDTDALVKKLEMVPVECVIRNRAAGSLVKRLGIEEGMPLNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W +   + +M ALS R N+ ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCRTFGWVSDEHLAQMKALSYRANEVLSQLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        ++VL DE  PD  RLWD +   + DK RF ++   L+E Y EVA RLG+
Sbjct: 181 GLY----KGQVVLGDEFSPDGSRLWDKTTLAKMDKDRFRQNLGGLIEAYEEVALRLGV 234


>gi|75906318|ref|YP_320614.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Anabaena
           variabilis ATCC 29413]
 gi|123610942|sp|Q3MH17|PUR7_ANAVT RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|75700043|gb|ABA19719.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Anabaena
           variabilis ATCC 29413]
          Length = 245

 Score =  238 bits (606), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 86/240 (35%), Positives = 132/240 (55%), Gaps = 7/240 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M   + +YE K KI+Y   EP  L+  FKDD    N  +  ++ GKG +N  IS  +F Q
Sbjct: 1   MSVHSKLYEGKAKILYTTDEPEVLLADFKDDATAFNAQKRGSILGKGRINCSISSQLFQQ 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +FI   +  +  V+ V++IP+ + +RN AAGSL+++  I  G  L + LVEF
Sbjct: 61  LEASGIKTHFIDSPSPNQMRVKAVKIIPIEVVIRNIAAGSLSQQTGIELGTVLKQPLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     L++ + +     A   +VEE+T L+++INDF+   +    I LVDF+++ 
Sbjct: 121 YYKNDQLGDPLLTRDRLLLMELATAEQVEEITHLALQINDFLKNFWQNCGITLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLS----KKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G        +I+LADEI PD CRLW+ +     +   DK RF +    + + Y EV +R+
Sbjct: 181 GLD---SQQQILLADEISPDTCRLWNTTEADPNRRVMDKDRFRRDLGNVEDAYQEVLQRV 237


>gi|257867993|ref|ZP_05647646.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterococcus casseliflavus EC30]
 gi|257874323|ref|ZP_05653976.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterococcus casseliflavus EC10]
 gi|257802076|gb|EEV30979.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterococcus casseliflavus EC30]
 gi|257808487|gb|EEV37309.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterococcus casseliflavus EC10]
          Length = 241

 Score =  238 bits (606), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 85/237 (35%), Positives = 137/237 (57%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +++  E   L   + D     N  +   + GKG LNN+I+ ++F +
Sbjct: 1   MESEVLLYEGKAKKLFKTNEEDVLRVVYLDQATALNGQKKDAVVGKGALNNQITAHLFQR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L    +P +F+  ++  EQL+R V MIPL + VRNTAAGS +KRL I EG  LP+ +VEF
Sbjct: 61  LADKNVPSHFLHLVSKHEQLIRAVTMIPLEVVVRNTAAGSFSKRLGIEEGTKLPKPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D  +   ++++H+     A++ E++++  L++++N  +  +F  INI+L+DF+I+ 
Sbjct: 121 YYKEDRLDDPFINDDHVFYLGLASEEELDQIKTLALQVNAALLEIFANINIRLIDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G+        ++LADEI PD CRLWD+   E  DK  + +    ++  Y EV  RL 
Sbjct: 181 GKT---KKGELLLADEISPDTCRLWDMGTNEHLDKDVYRRDLGDIVPVYEEVLNRLE 234


>gi|238759412|ref|ZP_04620576.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           aldovae ATCC 35236]
 gi|238702309|gb|EEP94862.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           aldovae ATCC 35236]
          Length = 237

 Score =  238 bits (606), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 126/238 (52%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++  +
Sbjct: 1   MQKLAELYRGKAKTVYTTENPDLLVLEFRNDTSALDGQRIEQFDRKGMVNNKFNHFIMAK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP    R ++  E LV+ +EMIP+   +RN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LEAAGIPTQMERLLSDTEVLVKKLEMIPVECVIRNRAAGSLVKRLGIEEGIVLNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F WA ++++  M  LS   ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCKTFGWATEAQLARMKELSYLANDVLSKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK R+ +S   L+E Y EVA R+G+
Sbjct: 181 GLF----NGEVVLGDEFSPDGSRLWDKKTLNKMDKDRYRQSLGGLIEAYEEVAHRIGV 234


>gi|88602538|ref|YP_502716.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methanospirillum hungatei JF-1]
 gi|88188000|gb|ABD40997.1| FO synthase subunit 1 [Methanospirillum hungatei JF-1]
          Length = 565

 Score =  238 bits (606), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 73/232 (31%), Positives = 112/232 (48%), Gaps = 4/232 (1%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
            P+YE K K +Y    P  LI  F++D    N  +      KG LN   SE+    L   
Sbjct: 332 KPLYEGKAKSVYASENPDELIVVFRNDMTAFNGVKHDQFTDKGRLNATASEFFMKMLEAE 391

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
           GIP + IR       +VR +EMIPL + VRN AAGS+ K+  + EG+ L R +V   Y  
Sbjct: 392 GIPTHHIRMSAPDTMIVRRLEMIPLEVIVRNVAAGSMTKKYPVKEGMVLDRPVVTIDYKD 451

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D     +++++ I   +     E+ ++  +++ +N  +T  F    I+LVDF+++ G+  
Sbjct: 452 DERGDPMINDDLIEVLHILTADELRKVKEMALHVNKVLTRFFDECGIRLVDFKLEFGK-- 509

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
                 I L DEI  D  RLWD    E  DK  +      ++  Y  V +R+
Sbjct: 510 --ADGTIYLGDEISMDSMRLWDKKTGESFDKDVYRFDKGDVIAAYRNVLKRI 559


>gi|238765499|ref|ZP_04626416.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           kristensenii ATCC 33638]
 gi|238696268|gb|EEP89068.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           kristensenii ATCC 33638]
          Length = 237

 Score =  238 bits (606), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 82/238 (34%), Positives = 126/238 (52%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++  +
Sbjct: 1   MQKLAELYRGKAKTVYTTENPDLLVLEFRNDTSALDGQRIEQFDRKGMVNNKFNHFIMAK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP    R ++  E LV+ +EMIP+   +RN AAGSL KRL I EGL L   L + 
Sbjct: 61  LEAAGIPTQMERLLSDTEVLVKKLEMIPVECVIRNRAAGSLVKRLGIEEGLELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F WA ++++  M  LS   ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCKTFGWATEAQLARMKELSYLANDVLSKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK R+ +S   L+E Y EVA R+G+
Sbjct: 181 GLF----NGEVVLGDEFSPDGSRLWDKKTLNKMDKDRYRQSLGGLIEAYEEVAHRIGV 234


>gi|295097978|emb|CBK87068.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 239

 Score =  238 bits (606), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 77/238 (32%), Positives = 126/238 (52%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 3   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMTK 62

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP      ++  E LV+ ++M+P+   +RN AAGSL KRL I EG+ L   L + 
Sbjct: 63  LAEAGIPTQMEALLSDTECLVKKLDMVPVECVIRNRAAGSLVKRLGIEEGIELNPPLFDL 122

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 123 FLKNDAMHDPMVNESYCETFGWVSKENLARMQELTYKANDVLKKLFDDAGLILVDFKLEF 182

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    ++ DK RF +S   ++E Y  VA RLG+
Sbjct: 183 GLY----KGEVVLGDEFSPDGSRLWDKETLDKMDKDRFRQSLGGVVEAYEAVAHRLGV 236


>gi|254414943|ref|ZP_05028706.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Microcoleus chthonoplastes PCC 7420]
 gi|196178090|gb|EDX73091.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Microcoleus chthonoplastes PCC 7420]
          Length = 244

 Score =  237 bits (605), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 76/240 (31%), Positives = 127/240 (52%), Gaps = 7/240 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K KI+Y   +P  L+  +KDD    N  +   + GKG +N  I+ ++F  
Sbjct: 1   MSQPQKLYEGKAKILYPTEDPEILLSVYKDDATAFNAQKRGQIVGKGEMNCAIAAHLFKF 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +FI      +  V+ V ++P+ + VRN AAGSL ++  +  G  LP+ LVEF
Sbjct: 61  LESQGIRTHFIDCPTSNQMRVKRVTILPVEVVVRNIAAGSLCQQTGLELGKVLPKPLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     L++ + +     A   ++ ++  L++++N  +T  F    I LVDF+++ 
Sbjct: 121 YYKKDELGDPLLTRDRLLLLELATPDQLNQLEQLALQVNQSLTAFFQSCGITLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEE----CDKKRFSKSNDQLLEGYSEVARRL 236
           G   +    +++LADEI PD CRLW+ ++ +      DK RF +   Q+ + Y +V  R+
Sbjct: 181 GIDANQ---QLLLADEISPDTCRLWNQAETDPQQRVMDKDRFRRDLGQVEQAYQQVLERV 237


>gi|119511197|ref|ZP_01630314.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Nodularia
           spumigena CCY9414]
 gi|119464185|gb|EAW45105.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Nodularia
           spumigena CCY9414]
          Length = 245

 Score =  237 bits (605), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 80/240 (33%), Positives = 129/240 (53%), Gaps = 7/240 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M   + +YE K KI+Y    P  L+  FKDD    N  +  ++  KG +N  IS  +F Q
Sbjct: 1   MSVYSQLYEGKAKILYATDNPEVLLADFKDDATAFNAQKRGSIIDKGKINCTISSQLFQQ 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  ++I   N  +  V+ V+++P+ + +RN AAGSL+ +  +P G  L + LVEF
Sbjct: 61  LEIYGIKTHYIDSPNPHQMRVKAVKIVPIEVVIRNIAAGSLSVQTGLPVGTVLKQPLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     L++ + +     A   +V+ +  L++++N+F+ G +    I LVDF+++ 
Sbjct: 121 YYKNDQLGDPLLTRDRLFLLELATPEQVDTIHNLALQVNEFLRGFWQQCGITLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEE----CDKKRFSKSNDQLLEGYSEVARRL 236
           G        +I+LADEI PD CRLWD ++ +      DK RF +    +   Y EV +R+
Sbjct: 181 GLD---SQQQILLADEISPDTCRLWDTAEADPNLRVMDKDRFRRDLGNVENAYQEVLQRV 237


>gi|260577092|ref|ZP_05845070.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Rhodobacter sp. SW2]
 gi|259020670|gb|EEW23988.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Rhodobacter sp. SW2]
          Length = 253

 Score =  237 bits (605), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 122/253 (48%), Positives = 176/253 (69%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  VYE K KI+YEG EPGTLIQ++KDD      P  A + GKGVLNNR+SE+  + 
Sbjct: 1   MARRKKVYEGKAKILYEGPEPGTLIQYYKDDGRAGATPPQAAVEGKGVLNNRLSEFFMSG 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L  IG+P +FIRR+NMREQLVR  E++PL + VRN AAG L+ RL IPEG +LPR +VE+
Sbjct: 61  LNSIGVPTHFIRRLNMREQLVRMAEIVPLEVVVRNFAAGELSTRLGIPEGTALPRPIVEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y+  +     +V+EEHI AF WA+Q +++++ AL++R+NDF++G+ +GI I+L DFR++ 
Sbjct: 121 YFKDEKLGDPMVAEEHIIAFGWASQQDLDDIVALALRVNDFLSGVMMGIGIRLADFRLEV 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR+ + D +R+++ADEI PD CRLWD    E  D++  ++    L + Y+E+ARRLG+  
Sbjct: 181 GRIWEGDFMRLIVADEISPDSCRLWDTRGTEAPDREGVTREPGPLADVYTELARRLGVLP 240

Query: 241 KNEPALKENLILN 253
            N     +  ++N
Sbjct: 241 SNVTHTTKPTLIN 253


>gi|238798731|ref|ZP_04642203.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           mollaretii ATCC 43969]
 gi|238717427|gb|EEQ09271.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           mollaretii ATCC 43969]
          Length = 237

 Score =  237 bits (605), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 126/238 (52%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++  +
Sbjct: 1   MQKLAELYRGKAKTVYTTENPDLLVLEFRNDTSALDGQRIEQFDRKGMVNNKFNHFIMAK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP    R ++  E LV+ ++MIP+   +RN AAGSL KRL I EGL L   L + 
Sbjct: 61  LEAAGIPTQMERLLSDTEVLVKKLDMIPVECVIRNRAAGSLVKRLGIEEGLELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F WA ++++  M  LS   ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCKTFGWATEAQLARMKELSYLANDVLSKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK R+ +S   L+E Y EVA R+G+
Sbjct: 181 GLF----NGEVVLGDEFSPDGSRLWDKKTLNKMDKDRYRQSLGGLIEAYEEVAHRIGV 234


>gi|32267118|ref|NP_861150.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Helicobacter hepaticus ATCC 51449]
 gi|39931800|sp|Q7VFQ6|PUR7_HELHP RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|32263171|gb|AAP78216.1| SAICAR synthetase PurC [Helicobacter hepaticus ATCC 51449]
          Length = 236

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 84/237 (35%), Positives = 132/237 (55%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K ++   +   +I  FKDD    N  +    +GKG LN +IS  +F  
Sbjct: 1   MEKREMLYEGKGKKLFATDDEHIVIAEFKDDLTAFNAEKKGKESGKGELNCQISSVLFEL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L +  I  ++I+R+NM + L + V +IP+ + VRN A GSL KRL I +G  L ++LVEF
Sbjct: 61  LARHNIATHYIKRLNMSDMLCKKVTIIPIEVVVRNIATGSLTKRLGISDGSILSQTLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQS-EVEEMTALSIRINDFMTGLFLGINIQLVDFRIK 179
           YY  D+    L+++EH        +  ++E + + + +IN+ +   F    ++LVDF+++
Sbjct: 121 YYKDDALGDPLINDEHCKILGIIKEQSQLEILKSQARQINEILKAFFDEKGLRLVDFKLE 180

Query: 180 CGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
            G+        I+LADEI PD CRLWD    ++ DK RF ++   +   Y EV RR+
Sbjct: 181 FGQD---SAGNIILADEISPDSCRLWDKQTNQKLDKDRFRENLGSVKVAYEEVLRRI 234


>gi|238783855|ref|ZP_04627873.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           bercovieri ATCC 43970]
 gi|238715242|gb|EEQ07236.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           bercovieri ATCC 43970]
          Length = 237

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 80/238 (33%), Positives = 126/238 (52%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++  +
Sbjct: 1   MQKLAELYRGKAKTVYTTENPDLLVLEFRNDTSALDGQRIEQFDRKGMVNNKFNHFIMAK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP    R ++  E LV+ +EMIP+   +RN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LEAAGIPTQMERLLSDTEVLVKKLEMIPVECVIRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F WA ++++  M  LS   N+ ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCKTFGWATEAQLARMKELSYLANEVLSKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK R+ +S   L+E Y EVA R+G+
Sbjct: 181 GLF----NGEVVLGDEFSPDGSRLWDKKTLNKMDKDRYRQSLGGLIEAYEEVAHRIGV 234


>gi|293571977|ref|ZP_06682991.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterococcus faecium E980]
 gi|291607995|gb|EFF37303.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterococcus faecium E980]
          Length = 242

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 86/243 (35%), Positives = 133/243 (54%), Gaps = 4/243 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K +Y   +   +   + D     N  R   ++GKG LNN+I+  +F  
Sbjct: 1   MEKKELLYEGKAKKLYLTSDENLIWVEYLDQATALNGARKDQISGKGELNNQITSTIFRY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI ++FI +++  EQLV+ V++IPL + +RN AAGS +KRL +PEG  L   +VEF
Sbjct: 61  LTQRGIKNHFIEQLSKTEQLVKKVQIIPLEVVIRNIAAGSFSKRLGVPEGKKLIEPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D  +   V+E+HI     A   E+ E+   ++ IN  +  LF  + + LVDF+++ 
Sbjct: 121 YYKDDQLDDPFVNEDHIYYLQLAKPEEISELKTQALAINKILIELFAKVGLVLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR       +++LADE+ PD CRLWD    E  DK  + +    L+  Y EV  RL    
Sbjct: 181 GR----SNGKMLLADEVTPDTCRLWDERTNEHMDKDVYRRGLGDLIPVYQEVYNRLSELT 236

Query: 241 KNE 243
           + +
Sbjct: 237 EEK 239


>gi|212716878|ref|ZP_03325006.1| hypothetical protein BIFCAT_01821 [Bifidobacterium catenulatum DSM
           16992]
 gi|212660163|gb|EEB20738.1| hypothetical protein BIFCAT_01821 [Bifidobacterium catenulatum DSM
           16992]
          Length = 250

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 84/247 (34%), Positives = 125/247 (50%), Gaps = 7/247 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +Y   +P  L   +K+     +  +     GKG LNN I+  +F  
Sbjct: 1   MEKLEKLYEGKAKQLYATDDPEVLWVEYKNSATAGDGEKKEDFAGKGRLNNLITTLIFDL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI  + + R+    QLV+ V M PL I +RNTAAG    RL + EG+ L   ++E+
Sbjct: 61  LKKRGINSHLVARVGETSQLVKKVTMFPLEIVLRNTAAGHFCSRLGVEEGIELKEPVLEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D      V+++ + A     + ++ E+  L+ RIN+ +  +F  I I+LVDF+I+ 
Sbjct: 121 FLKNDDLHDPFVNDDDLVALGVCTREDLAEIAPLARRINEALIEIFAKIGIKLVDFKIEM 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKK----EECDKKRFSKSNDQLLEGYSEVARRL 236
           GR  D     ++LADEI PD CRLWD        E  DK  F +    ++  Y EV  RL
Sbjct: 181 GRTSD---GTLLLADEITPDSCRLWDQRDGSGKVEHLDKDLFRRDLGDIIPAYEEVESRL 237

Query: 237 GIFKKNE 243
               K+E
Sbjct: 238 AELAKSE 244


>gi|257876888|ref|ZP_05656541.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterococcus casseliflavus EC20]
 gi|257811054|gb|EEV39874.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterococcus casseliflavus EC20]
          Length = 241

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 85/237 (35%), Positives = 138/237 (58%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +++  E   L   + D     N  +   + GKG LNN+I+ ++F +
Sbjct: 1   MESEVLLYEGKAKKLFKTNEEDVLRVVYLDQATALNGQKKDAVVGKGALNNQITAHLFQR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L    +P +F++ ++  EQL+R V MIPL + VRNTAAGS +KRL I EG  LP+ +VEF
Sbjct: 61  LADKNVPSHFLQLVSKHEQLIRAVAMIPLEVVVRNTAAGSFSKRLGIEEGTKLPKPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D  +   ++++H+     A++ E++++  L++++N  +  +F  INI+L+DF+I+ 
Sbjct: 121 YYKEDRLDDPFINDDHVFYLGLASEEELDQIKTLALQVNAALLEIFANINIRLIDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G+        ++LADEI PD CRLWD+   E  DK  + +    ++  Y EV  RL 
Sbjct: 181 GKT---KKGELLLADEISPDTCRLWDMGTNEHLDKDVYRRDLGDIVPVYEEVLNRLE 234


>gi|78189397|ref|YP_379735.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chlorobium chlorochromatii CaD3]
 gi|123579546|sp|Q3AQN3|PUR7_CHLCH RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|78171596|gb|ABB28692.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chlorobium chlorochromatii CaD3]
          Length = 235

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 86/236 (36%), Positives = 123/236 (52%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K ++    P  +IQ FKDD    NN +  T+  KGV+NN IS  +FT 
Sbjct: 1   MNKKEQLYEGKAKKVFATDNPDLVIQEFKDDATAFNNKKKGTIADKGVVNNAISCKLFTL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  + + +++ RE L R +++I   + VRN AAGSL +R    EG  L   +VE 
Sbjct: 61  LEQHGIRTHLVEKLSEREMLCRHLDIIKAEVVVRNIAAGSLVRRYGFAEGTVLECPIVEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y   D  +  L+ E H  A       E+  +   +  IN  +   F    ++LVDF+++ 
Sbjct: 121 YLKDDDLDDPLMIEAHAVALGVGTFEELAHLKQQAEVINTVLRSFFAERKLKLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR        I+L DEI PD CR WDL+  E+ DK RF      + E YSEV RR+
Sbjct: 181 GR----HNGEILLGDEISPDTCRFWDLATNEKLDKDRFRFDLGSVEEAYSEVERRV 232


>gi|227551257|ref|ZP_03981306.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Enterococcus faecium TX1330]
 gi|257896121|ref|ZP_05675774.1| saicar synthetase [Enterococcus faecium Com12]
 gi|293376998|ref|ZP_06623209.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Enterococcus faecium PC4.1]
 gi|227179597|gb|EEI60569.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Enterococcus faecium TX1330]
 gi|257832686|gb|EEV59107.1| saicar synthetase [Enterococcus faecium Com12]
 gi|292644367|gb|EFF62466.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Enterococcus faecium PC4.1]
          Length = 242

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 88/243 (36%), Positives = 134/243 (55%), Gaps = 4/243 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K +Y   +   +   + D     N  R   ++GKG LNN+I+  +F  
Sbjct: 1   MEKKELLYEGKAKKLYLTSDENLIWVEYLDQATALNGARKDQISGKGELNNQITSTIFRY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI ++FI +++  EQLV+ V++IPL + +RN AAGS +KRL +PEG  L + +VEF
Sbjct: 61  LTQRGIKNHFIEQLSKTEQLVKKVQIIPLEVVIRNIAAGSFSKRLGVPEGKKLIKPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D  +   V+EEHI     A   E+ E+   ++ IN  +  LF  + + LVDF+++ 
Sbjct: 121 YYKDDQLDDPFVNEEHIYYLQLAKPEEISELKTQALAINKILIELFAKVGLVLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR       +I+LADE+ PD CRLWD    E  DK  + +    L+  Y EV  RL    
Sbjct: 181 GR----SNEKILLADEVTPDTCRLWDEHTNEHMDKDVYRRGLGNLIPVYQEVYNRLSELT 236

Query: 241 KNE 243
           + +
Sbjct: 237 EEK 239


>gi|322833956|ref|YP_004213983.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rahnella
           sp. Y9602]
 gi|321169157|gb|ADW74856.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rahnella
           sp. Y9602]
          Length = 237

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 79/238 (33%), Positives = 126/238 (52%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++  +
Sbjct: 1   MQKLAELYRGKAKTVYTTENPDLLVLEFRNDTSALDGQRIEQFDRKGMVNNKFNHFIMAK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   +RN AAGSL KRL I EGL L   L + 
Sbjct: 61  LEEAGIPTQMERLLSDTEVLVKKLDMVPVECVIRNRAAGSLVKRLGIEEGLELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +++E +   F W N+  +  M  LS + ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMINESYCKTFGWVNEENLARMKELSYKANDVLSKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK R+ +S   L+E Y EVA R+G+
Sbjct: 181 GLF----NGEVVLGDEFSPDGSRLWDKETLNKMDKDRYRQSLGGLIEAYEEVAHRIGV 234


>gi|188533214|ref|YP_001907011.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Erwinia
           tasmaniensis Et1/99]
 gi|229564394|sp|B2VE61|PUR7_ERWT9 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|188028256|emb|CAO96114.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Erwinia
           tasmaniensis Et1/99]
          Length = 237

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 78/238 (32%), Positives = 129/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKKAELYRGKAKTVYSTENPDLLVLEFRNDTSALDGERIEQFDRKGMINNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP      ++  E LV++++M+P+   +RN AAGSL KRL + EG+ L   L + 
Sbjct: 61  LQEAGIPTQMEALLSDNEALVKNLDMVPVECVIRNRAAGSLVKRLGVEEGMILNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W +Q+ +  M  L+ R N+ ++ LF    + LVDF+++ 
Sbjct: 121 FLKDDAKHDPMVNESYCETFGWVSQTHLARMRELTYRANEVLSKLFADAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK R+ +S   L+E Y EVA RLG+
Sbjct: 181 GLF----KGEVVLGDEFSPDGARLWDKDTLNKMDKDRYRQSLGGLIEAYEEVANRLGV 234


>gi|226953313|ref|ZP_03823777.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter sp. ATCC 27244]
 gi|294648643|ref|ZP_06726105.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Acinetobacter haemolyticus ATCC 19194]
 gi|226835939|gb|EEH68322.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter sp. ATCC 27244]
 gi|292825433|gb|EFF84174.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Acinetobacter haemolyticus ATCC 19194]
          Length = 239

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 88/238 (36%), Positives = 132/238 (55%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +Y  K K +YE      LI  F+DD    N  +   L+ KG +NNR + ++  +
Sbjct: 1   MLKQTLLYTGKAKSVYETDNADHLILVFRDDASAFNGEKIEQLDRKGKVNNRFNAFIMEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +F + ++  E LV+ ++MIP+   +RN AAGSL +RL + EG  L     E 
Sbjct: 61  LAEAGIETHFEKLLSPTEVLVKKLQMIPVECVIRNYAAGSLCRRLGVEEGKELTPPTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           ++  D+    +V+E    A  WA   ++E+M  L+ ++ND +  LF   N+ LVDF+++ 
Sbjct: 121 FFKDDALGDPMVNESQAIALGWATADQLEKMKELTYQVNDVLKALFDAGNMILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G   D    RIVL DE  PD CRLWD   K++ DK RF +    ++E Y EVA RLGI
Sbjct: 181 GVFHD----RIVLGDEFSPDGCRLWDKDTKKKLDKDRFRQGLGGVVEAYEEVAARLGI 234


>gi|302871751|ref|YP_003840387.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caldicellulosiruptor obsidiansis OB47]
 gi|302574610|gb|ADL42401.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caldicellulosiruptor obsidiansis OB47]
          Length = 240

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 88/234 (37%), Positives = 135/234 (57%), Gaps = 4/234 (1%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K K IYE      ++  +KDD    +  +   +N KG++NN +S + F  L   
Sbjct: 7   KLLYEGKAKKIYETNHQDVVVIEYKDDATAFDGTKRGIINNKGIVNNLVSNHFFKILESN 66

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
            IP +FI +I+ R+  V+ V++IP+ + VRN AAGSL KRL + EG  L R ++EF Y  
Sbjct: 67  KIPTHFIEQIDERKTAVKKVQIIPVEVIVRNIAAGSLCKRLGLEEGAILKRPILEFCYKN 126

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D+     V++ HI A   A + E++++   S +IND +      +NI L+DF+++ GR  
Sbjct: 127 DALRDPQVNQYHILALELATEDEIKKIEEYSFKINDVLRNYLKQVNINLIDFKLEFGRY- 185

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
                 I+LADEI PD CR WD++ KE+ DK RF +    + E Y E+ +RLG+
Sbjct: 186 ---KGEIILADEISPDTCRFWDVATKEKLDKDRFRRDLGNVEEAYMEILKRLGL 236


>gi|268680024|ref|YP_003304455.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Sulfurospirillum deleyianum DSM 6946]
 gi|268618055|gb|ACZ12420.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Sulfurospirillum deleyianum DSM 6946]
          Length = 237

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 85/237 (35%), Positives = 132/237 (55%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K ++   +   L+  FKDD    N  +     GKG LN +IS  +F  
Sbjct: 1   MNKGALLYEGKGKKLFLTDDENLLVSEFKDDLTAFNAEKRGNEAGKGALNCKISTQLFHL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI  + ++ ++   QL++ V++IP+ + VRN A GSL+KRL I +G +LP +LVEF
Sbjct: 61  LEKHGIQTHLVKTLDDTHQLIKRVQIIPIEVVVRNIATGSLSKRLGIADGTALPFTLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWA-NQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIK 179
           YY  D+    ++++EH    N   ++S++EE+  L   IN  M   F    ++LVDF+++
Sbjct: 121 YYKDDALGDPIINDEHCLLLNLVKSESDLEELKRLGREINVIMKNFFAERRLKLVDFKVE 180

Query: 180 CGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
            G   +     I+L+DEI PD CR WD+   E+ DK RF +    +   Y EV +R+
Sbjct: 181 FGVDPE---GTILLSDEISPDSCRFWDMDTNEKLDKDRFRQGLGNVKVAYEEVLKRI 234


>gi|262280581|ref|ZP_06058365.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter calcoaceticus RUH2202]
 gi|262258359|gb|EEY77093.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter calcoaceticus RUH2202]
          Length = 239

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 87/238 (36%), Positives = 129/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +Y  K K +YE      LI  F+DD    N  +   L+ KG +NN  + ++  +
Sbjct: 1   MLKQTLLYTGKAKSVYETDNADHLILVFRDDASAFNGEKIEQLDRKGKVNNLFNAFIMEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +F + ++  E LV+ ++MIP+   +RN AAGSL +RL + EG  L     E 
Sbjct: 61  LAAAGIETHFEKLLSPTEVLVKKLQMIPVECVIRNYAAGSLCRRLGVEEGKELTPPTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +Y  D     +V+E    A  WA   ++E+M  L+ ++ND +  LF   N+ LVDF+++ 
Sbjct: 121 FYKDDGLGDPMVNESQAIALGWATAEQLEQMKVLTYQVNDVLKALFAEGNMILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G   D    RIVL DE  PD CRLWD   K++ DK RF +    ++E Y EVA RLG+
Sbjct: 181 GVFHD----RIVLGDEFSPDGCRLWDKDSKKKLDKDRFRQGLGGVVEAYEEVAARLGV 234


>gi|189500054|ref|YP_001959524.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chlorobium phaeobacteroides BS1]
 gi|229485914|sp|B3EQL0|PUR7_CHLPB RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|189495495|gb|ACE04043.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chlorobium phaeobacteroides BS1]
          Length = 236

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 83/240 (34%), Positives = 126/240 (52%), Gaps = 4/240 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     ++E K K ++       +IQ FKDD    NN +  T+  KGV+NN IS  +FT 
Sbjct: 1   MNKTELLHEGKAKKVFLTDNKDLVIQEFKDDATAFNNKKKGTIGNKGVVNNAISCKLFTY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + G+  +F+ +++ R+ L + +++I + + VRNTAAGSL +R    EG  L   ++E 
Sbjct: 61  LAEHGVSTHFVEKLSDRDMLCKRLDIILVEVVVRNTAAGSLVRRYGFEEGFRLEDPIIEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y   D  +  L++E H  A   AN  E+E +   +  IN  +   F G  + LVDF+++ 
Sbjct: 121 YLKDDDLDDPLMNESHAVALGLANYEELELLKEQAATINTLLKTFFAGRKLNLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR        I+L DEI PD CR WDL   E+ DK RF      + + Y+EV  R+    
Sbjct: 181 GR----HNGEILLGDEISPDTCRFWDLDTGEKMDKDRFRFDLGGVEDAYTEVQHRVLDLP 236


>gi|88800197|ref|ZP_01115765.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Reinekea
           sp. MED297]
 gi|88777043|gb|EAR08250.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Reinekea
           sp. MED297]
          Length = 236

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 78/238 (32%), Positives = 133/238 (55%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +Y  K K ++   +   ++  F+DD    +  +   L  KG +NN  + ++  +
Sbjct: 1   MEKTGILYAGKAKTVHTTADRDLMVLEFRDDTTAFDGEKTEALADKGRVNNLFNAFVMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  ++++ ++  E LVR+++M+P+   VRN AAGSL +RL + EG  L   + EF
Sbjct: 61  LQDAGIETHYVKTLSDHESLVRNLKMMPVECVVRNRAAGSLVRRLGVEEGQELTPPVFEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D     ++++ HI +F WA ++++ EM +L+ R+ND +  LF   ++ LVD++++ 
Sbjct: 121 FLKNDQLHDPMINDFHILSFGWATEAQIAEMKSLTFRVNDVLKSLFADGDLILVDYKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        R+VL DE  PD CRLWD    E+ DK RF +    ++E Y EV RR+G+
Sbjct: 181 GVF----DGRVVLGDEFSPDGCRLWDAKTMEKMDKDRFRQGLGSVVESYMEVGRRIGV 234


>gi|238756092|ref|ZP_04617414.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           ruckeri ATCC 29473]
 gi|238705698|gb|EEP98093.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Yersinia
           ruckeri ATCC 29473]
          Length = 237

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 78/238 (32%), Positives = 127/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKLAELYRGKAKTVYTTENPDLLVLEFRNDTSALDGQRIEQFDRKGMVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++MIP+   +RN AAGSL KRL I EGL L   L + 
Sbjct: 61  LEEAGIPTQMERLLSDTEVLVKKLDMIPVECVIRNRAAGSLVKRLGIEEGLVLNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +++E +   F WA+++ +  M  LS + ND ++ +F    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMINESYCKTFGWASETHLARMKELSYKANDVLSKIFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK R+ +    L+E Y  VA R+G+
Sbjct: 181 GLF----NGEVVLGDEFSPDGSRLWDKETLNKMDKDRYRQGLGGLIEAYEAVAHRIGV 234


>gi|296104111|ref|YP_003614257.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|295058570|gb|ADF63308.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 237

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 78/238 (32%), Positives = 126/238 (52%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP      ++  E LV+ ++M+P+   +RN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LAEAGIPTQMEALLSDTECLVKKLDMVPVECVIRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V++ +   F W N+  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNDSYCETFGWVNKENLARMKELTYKANDVLKKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    ++ DK RF +S   L+E Y  VA RLG+
Sbjct: 181 GLF----KGEVVLGDEFSPDGSRLWDKETLDKMDKDRFRQSLGGLIEAYEAVAHRLGV 234


>gi|289549000|ref|YP_003473988.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Thermocrinis albus DSM 14484]
 gi|289182617|gb|ADC89861.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Thermocrinis albus DSM 14484]
          Length = 233

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 84/232 (36%), Positives = 133/232 (57%), Gaps = 3/232 (1%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K KI+Y   +P   + +FKD+    +  + + + GKG++NN IS  +F  L + 
Sbjct: 2   EKLYEGKAKIVYRTEDPDKYLIYFKDEATAFDATKRSHVEGKGIINNTISSILFQLLWEK 61

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
           GI +++I++++ RE LV   E   + + VRN AAGS+ KRL IPEG   P  +VEF+Y  
Sbjct: 62  GIKNHYIQKVSDREMLVWRAERFDVEVVVRNVAAGSITKRLGIPEGTVFPSPVVEFFYKN 121

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D     L+ E+HI   N   + ++ ++  +++ +N  ++  F    I+LVDF+++ GRL 
Sbjct: 122 DQLRDPLICEDHILLLNLLPKEDIGKVKEMALEVNRVLSLFFEEHGIRLVDFKLEFGRLP 181

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           D     + + DEI PD CRLWD+   E+ DK RF      L+EGY  V  +L
Sbjct: 182 D---GSVGVIDEISPDTCRLWDMRTGEKLDKDRFRFDLGDLIEGYRRVLEKL 230


>gi|310768325|gb|ADP13275.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Erwinia
           sp. Ejp617]
          Length = 237

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 78/238 (32%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKKAELYRGKAKTVYSTENPDLLVLEFRNDTSALDGERIEQFDRKGMINNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP      ++  E LV++++M+P+   VRN AAGSL KRL + EG+ L   L + 
Sbjct: 61  LQEAGIPTQMEALLSDNEALVKNLDMVPVECVVRNRAAGSLVKRLGVEEGMILNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKDDAKHDPMVNESYCETFGWVSKPHLARMQELTYQANDVLSKLFADAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK R+ +S   L+E Y EVA RLG+
Sbjct: 181 GLF----KGEVVLGDEFSPDGARLWDKDTLNKMDKDRYRQSLGGLIEAYEEVANRLGV 234


>gi|183602580|ref|ZP_02963945.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bifidobacterium animalis subsp. lactis HN019]
 gi|219683622|ref|YP_002470005.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bifidobacterium animalis subsp. lactis AD011]
 gi|241190653|ref|YP_002968047.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bifidobacterium animalis subsp. lactis Bl-04]
 gi|241196059|ref|YP_002969614.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bifidobacterium animalis subsp. lactis DSM 10140]
 gi|254783937|sp|B8DTV0|PUR7_BIFA0 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|183218221|gb|EDT88867.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bifidobacterium animalis subsp. lactis HN019]
 gi|219621272|gb|ACL29429.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bifidobacterium animalis subsp. lactis AD011]
 gi|240249045|gb|ACS45985.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Bifidobacterium animalis subsp. lactis Bl-04]
 gi|240250613|gb|ACS47552.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Bifidobacterium animalis subsp. lactis DSM 10140]
 gi|289178391|gb|ADC85637.1| Phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Bifidobacterium animalis subsp. lactis BB-12]
 gi|295793642|gb|ADG33177.1| phosphoribosylaminoimidazole- succinocarboxamidesynthase
           [Bifidobacterium animalis subsp. lactis V9]
          Length = 250

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 90/247 (36%), Positives = 139/247 (56%), Gaps = 7/247 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+  + +YE K K +Y   +P  L   + +     N  + A + GKG LNN+I+  +F  
Sbjct: 1   MQKLDKLYEGKAKKLYATDDPDVLWVEYMNQATAGNGAKKAQIEGKGELNNQITSVIFDL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +F++RI+  EQLVR ++M PL I +RNTAAGS AKR  + EG +L + ++EF
Sbjct: 61  LKARGIDSHFVKRISDTEQLVRKMDMYPLEIIMRNTAAGSFAKRYGVEEGTALDKPILEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
               D      ++++ I A   A++ E++E++  +  +ND +  +F  I++QLVDF+I+ 
Sbjct: 121 CVKSDELGDPFINDDGIVALGIASEEELDEISRQARAVNDALKDIFSKIDVQLVDFKIEE 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKK----EECDKKRFSKSNDQLLEGYSEVARRL 236
           G+  D    RI+LADEI PD CRLWDL       E  DK  F +    ++  Y E+  RL
Sbjct: 181 GKTGD---GRILLADEITPDTCRLWDLKDGSGQIEHLDKDLFRRDLGNIIPAYEEIYDRL 237

Query: 237 GIFKKNE 243
               + E
Sbjct: 238 VKLAEAE 244


>gi|262373847|ref|ZP_06067125.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter junii SH205]
 gi|262311600|gb|EEY92686.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter junii SH205]
          Length = 239

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 88/238 (36%), Positives = 132/238 (55%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +Y  K K +YE      LI  F+DD    N  +   L+ KG +NNR + ++  +
Sbjct: 1   MLKQTLLYTGKAKSVYETDNADHLILVFRDDASAFNGEKIEQLDRKGKVNNRFNAFIMEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +F + ++  E LV+ ++MIP+   +RN AAGSL +RL + EG  L     E 
Sbjct: 61  LAEAGIETHFEKLLSPTEVLVKKLQMIPVECVIRNYAAGSLCRRLGVEEGKELTPPTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           ++  D+    +V+E    A  WA   ++E+M  L+ ++ND +  LF   N+ LVDF+++ 
Sbjct: 121 FFKDDALGDPMVNESQAIALGWATADQLEKMKELTYQVNDVLKALFDAGNMILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G   D    RIVL DE  PD CRLWD   K++ DK RF +    ++E Y EVA RLGI
Sbjct: 181 GVFHD----RIVLGDEFSPDGCRLWDKDTKKKLDKDRFRQGLGGVVEAYEEVAARLGI 234


>gi|190571274|ref|YP_001975632.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|213018670|ref|ZP_03334478.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
 gi|229568631|sp|B3CM64|PUR7_WOLPP RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|190357546|emb|CAQ54983.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|212995621|gb|EEB56261.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
          Length = 240

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 98/238 (41%), Positives = 147/238 (61%), Gaps = 1/238 (0%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K+I E  +  T+IQ+FKDD    N  +   + GKG++NN +S ++  +
Sbjct: 1   MSLNKTIYEGKAKVIIETEDSSTVIQYFKDDVTAFNKEKYEIIEGKGIINNHVSAFIMEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +FI  +N REQLV+ +++IPL + VRN AAGS  KR NI EG +L   ++EF
Sbjct: 61  LEEAGISTHFINTLNEREQLVKKLKIIPLEVVVRNIAAGSFCKRFNIKEGEALTSPIIEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +Y  D     +V+E HI  F W +  E+EE+   +++IN  +  LF   NI LVD +++ 
Sbjct: 121 FYKNDDLADPMVNENHILYFGWLSHKEMEEVKTTTLKINKILVDLFSNANIYLVDLKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G+L+++   +I+LADEI PD CRLWD +  ++ DK  F  +   L E YSEVA+RL +
Sbjct: 181 GKLINNST-KIILADEISPDNCRLWDKNTHKKLDKDVFRLNLGNLKEAYSEVAKRLSV 237


>gi|315638009|ref|ZP_07893194.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Campylobacter upsaliensis JV21]
 gi|315481857|gb|EFU72476.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Campylobacter upsaliensis JV21]
          Length = 236

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 88/237 (37%), Positives = 133/237 (56%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K +Y+  +   LI  FKDD    N  +     GKG LN +IS  +F  
Sbjct: 1   MEKKELLYEGKGKKMYKTDDEFLLITEFKDDLTAFNAEKKGNEAGKGALNCKISTELFHL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI  + ++ ++  EQLV+  +++P+ + VRN A GSL KRL I EG  LP +LVEF
Sbjct: 61  LEKGGITTHLVQTLSENEQLVKKCKIVPIEVIVRNVATGSLTKRLGIKEGTKLPFALVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWA-NQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIK 179
               D+     +++EH    N   NQ+++EE+  ++ +IN  +   F   N++L+DF+I+
Sbjct: 121 CLKDDALGDPFINDEHCLLLNLVKNQAQIEEIKTIARKINAILLDFFDKKNLRLIDFKIE 180

Query: 180 CGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
            G   DD   +++LADEI PD CR WD    E+ DK RF +    +   Y EV +R+
Sbjct: 181 LGLDKDD---KLILADEISPDSCRFWDKETNEKLDKDRFRQDLGNVKMAYEEVLKRI 234


>gi|241889741|ref|ZP_04777039.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Gemella
           haemolysans ATCC 10379]
 gi|241863363|gb|EER67747.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Gemella
           haemolysans ATCC 10379]
          Length = 233

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 83/232 (35%), Positives = 127/232 (54%), Gaps = 3/232 (1%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K K ++E      +   +K+     N  +     GKGV NN I+  +F  L K 
Sbjct: 2   KLLYEGKAKQLFECENNDEIYVHYKNSATAFNGVKKEEFEGKGVFNNTITSLIFEYLEKQ 61

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
           G+  +FIR++N  +Q+ + V +IPL + VRN  AGS+AK+  + EG  L + + E  Y  
Sbjct: 62  GVKTHFIRKVNETDQICKHVTIIPLEVIVRNIVAGSMAKKYGLEEGKKLKKPVFELSYKN 121

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D     L++  H  A     + E+E + + +++IN+ +  L+L  N+ LVDF+I+ G+  
Sbjct: 122 DELNDPLINNNHAVALEIVTEEELENIRSQALKINELLQKLYLDANLVLVDFKIEFGKTK 181

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           D     I+LADEI PD CRLWD    E+ DK RF +    ++E Y EV RRL
Sbjct: 182 D---GEIILADEISPDTCRLWDKDTNEKLDKDRFRRDLGSVMEAYEEVLRRL 230


>gi|17229760|ref|NP_486308.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Nostoc
           sp. PCC 7120]
 gi|22001856|sp|Q8YUR7|PUR7_ANASP RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|17131359|dbj|BAB73967.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Nostoc sp.
           PCC 7120]
          Length = 245

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 87/240 (36%), Positives = 131/240 (54%), Gaps = 7/240 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M   + +YE K KI+Y   EP  L+  FKDD    N  +  ++ GKG +N  IS  +F Q
Sbjct: 1   MSVHSKLYEGKAKILYTTDEPEVLLADFKDDATAFNAQKRGSIIGKGRINCSISSQLFQQ 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +FI      +  V+ V++IPL + +RN AAGSL+++  I  G  L + LVEF
Sbjct: 61  LEASGIKTHFIDSPAPNQMRVKAVKIIPLEVVIRNIAAGSLSQQTGIELGTVLKQPLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     L++ + +     A   +VEE+T L+++INDF+   +    I LVDF+++ 
Sbjct: 121 YYKNDQLGDPLLTRDRLLLMELATAEQVEEITHLALQINDFLKNFWQNCGITLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLS----KKEECDKKRFSKSNDQLLEGYSEVARRL 236
           G        +I+LADEI PD CRLW+ +     +   DK RF +    + + Y EV +R+
Sbjct: 181 GLD---SQQQILLADEISPDTCRLWNTTEADPNRRVMDKDRFRRDLGNVEDAYQEVLQRV 237


>gi|311029265|ref|ZP_07707355.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Bacillus
           sp. m3-13]
          Length = 241

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 87/236 (36%), Positives = 141/236 (59%), Gaps = 3/236 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
           + +  +YE K K++Y   +   +   +K+     N  + A + GKG LNN I+  +F+ L
Sbjct: 4   QKQALLYEGKAKLVYSTTDENVVWIQYKNSATAFNGEKKADITGKGRLNNEITSLLFSML 63

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            + GI ++FI R +  EQLV+ V++IPL + VRN  AGS+AKRL I EG+ L + +VEFY
Sbjct: 64  TQAGIENHFIERKSETEQLVKKVDIIPLEVVVRNITAGSMAKRLGIEEGIKLEQPIVEFY 123

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  DS    L++E+H+     A  +EV+ +  ++ ++N  ++  F   N++LVDF+++ G
Sbjct: 124 YKDDSLGDPLITEDHVQLLKLATPAEVDILKHVARKVNVVLSEFFEKKNLRLVDFKLEFG 183

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           +  D    RI+LADE+ PD CRLWD    E+ DK  F ++   L + Y ++  R+G
Sbjct: 184 KTED---GRIILADEVSPDTCRLWDKDTNEKLDKDVFRRNLGSLTDAYEKILARIG 236


>gi|57167560|ref|ZP_00366700.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Campylobacter coli RM2228]
 gi|305433066|ref|ZP_07402222.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Campylobacter coli JV20]
 gi|57020682|gb|EAL57346.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Campylobacter coli RM2228]
 gi|304443767|gb|EFM36424.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Campylobacter coli JV20]
          Length = 236

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 86/237 (36%), Positives = 133/237 (56%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +YE K K +Y   +   LI  FKDD    N  +  + +GKG LN +IS  +F  
Sbjct: 1   MKKKELLYEGKGKKLYTTEDENFLISEFKDDLTAFNAEKKGSESGKGALNCKISTELFHL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI  + +  I+  EQ+V+  +++P+ + VRN A GSL KRL I +G  LP +LVEF
Sbjct: 61  LEKNGIKTHLVETISDNEQVVKKCKIVPIEVIVRNVATGSLTKRLGIKDGTVLPFALVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWA-NQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIK 179
               D      +++EH    N   N+++++E+  ++ +IN  +T  F   N++L+DF+I+
Sbjct: 121 CLKNDELGDPFINDEHCLILNLVQNEAQIKEIKEMAKKINAILTPFFDAKNLRLIDFKIE 180

Query: 180 CGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
            G   D+    +VLADEI PD CR WD    E+ DK RF +    +   Y EV +R+
Sbjct: 181 LGLTKDN---ELVLADEISPDSCRFWDKFSNEKLDKDRFRQDLGNVKMAYEEVLKRI 234


>gi|259907769|ref|YP_002648125.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Erwinia
           pyrifoliae Ep1/96]
 gi|224963391|emb|CAX54878.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Erwinia
           pyrifoliae Ep1/96]
 gi|283477630|emb|CAY73546.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Erwinia
           pyrifoliae DSM 12163]
          Length = 237

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 78/238 (32%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKKAELYRGKAKTVYSTENPDLLVLEFRNDTSALDGERIEQFDRKGMINNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP      ++  E LV++++M+P+   VRN AAGSL KRL + EG+ L   L + 
Sbjct: 61  LQEAGIPTQMEALLSDNEALVKNLDMVPVECVVRNRAAGSLVKRLGVEEGMILNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKDDAKHDPMVNESYCETFGWVSKPHLARMQELTYQANDVLSKLFADAGLLLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK R+ +S   L+E Y EVA RLG+
Sbjct: 181 GLF----KGEVVLGDEFSPDGARLWDKDTLNKMDKDRYRQSLGGLIEAYEEVANRLGV 234


>gi|307154076|ref|YP_003889460.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cyanothece sp. PCC 7822]
 gi|306984304|gb|ADN16185.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cyanothece sp. PCC 7822]
          Length = 243

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 87/240 (36%), Positives = 128/240 (53%), Gaps = 10/240 (4%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K KI+Y   EP   +  FKDD    N  +   + GKG +N  IS  +F  
Sbjct: 1   MNK---LYEGKAKILYSTDEPEIFLAHFKDDATAFNALKRGQIQGKGEINCTISSALFRW 57

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +FI +    E  V+ V+++PL + VRN AAGSL +   + EG  LP  LVEF
Sbjct: 58  LESKGILTHFIEQSTSNEMRVKAVKILPLEVVVRNIAAGSLCRETGLAEGKILPFPLVEF 117

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y   D  +  L++++ I         ++EEM  L+++IN+ +T  F    I LVDF+++ 
Sbjct: 118 YLKNDELQDPLLTKDRILILEIVTPEQLEEMKNLALKINEHLTQFFADCGITLVDFKLEF 177

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEE----CDKKRFSKSNDQLLEGYSEVARRL 236
           G        +I+LADEI PD CRLWD S+ +      DK RF +   ++ E Y +V +R+
Sbjct: 178 GVD---SQNKILLADEISPDTCRLWDSSETDPLARVMDKDRFRRDLGKIEEAYQQVQQRV 234


>gi|189346700|ref|YP_001943229.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chlorobium limicola DSM 245]
 gi|229485912|sp|B3ECH5|PUR7_CHLL2 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|189340847|gb|ACD90250.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chlorobium limicola DSM 245]
          Length = 236

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 83/236 (35%), Positives = 126/236 (53%), Gaps = 4/236 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    ++E K K ++   +   +IQ FKDD    NN +  T+  KGV+NN IS  +FT 
Sbjct: 1   MQKTTLLHEGKAKKVFLTGDSDLVIQEFKDDATAFNNKKKGTIADKGVVNNAISCKLFTM 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+  + + +++ R+ L R +++I + + VRN AAGSL KR    EG  L + +VEF
Sbjct: 61  LESHGVKTHLVEKLSERDMLCRRLDIIKVEVVVRNIAAGSLVKRYGFAEGTVLDKPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           Y   D  +  L++E H  A   A   E+  +   +  IN  +   F    ++LVDF+++ 
Sbjct: 121 YLKDDDLDDPLMNESHAVALGVATLEELSVLRDRAEAINVVLKEFFAQRKLKLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           GR  +     I+L DEI PD CR WDL   E+ DK RF      + + Y EV RR+
Sbjct: 181 GRYHN----EILLGDEISPDTCRFWDLDTNEKMDKDRFRFDLGGVEDAYGEVQRRV 232


>gi|225350777|ref|ZP_03741800.1| hypothetical protein BIFPSEUDO_02347 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225158233|gb|EEG71475.1| hypothetical protein BIFPSEUDO_02347 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 250

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 84/247 (34%), Positives = 125/247 (50%), Gaps = 7/247 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +Y   +P  L   +K+     +  +     GKG LNN I+  +F  
Sbjct: 1   MEKLEKLYEGKAKQLYATDDPEVLWVEYKNSATAGDGEKKEDFAGKGRLNNLITTLIFDL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI  + + R+    QLV+ V M PL I +RNTAAG    RL + EG+ L   ++E+
Sbjct: 61  LKKRGIDSHLVARVGETSQLVKKVTMFPLEIVLRNTAAGHFCSRLGVEEGIELKEPVLEY 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D      V+++ + A     + ++ E+  L+ RIN+ +  +F  I I+LVDF+I+ 
Sbjct: 121 FLKNDDLHDPFVNDDDLVALGVCTREDLAEIAPLARRINEALIEIFAKIGIKLVDFKIEM 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKK----EECDKKRFSKSNDQLLEGYSEVARRL 236
           GR  D     ++LADEI PD CRLWD        E  DK  F +    ++  Y EV  RL
Sbjct: 181 GRTSD---GTLLLADEITPDSCRLWDQRDGSGKVEHLDKDLFRRDLGDIIPAYEEVESRL 237

Query: 237 GIFKKNE 243
               K+E
Sbjct: 238 AELAKSE 244


>gi|329766901|ref|ZP_08258429.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Gemella
           haemolysans M341]
 gi|328837626|gb|EGF87251.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Gemella
           haemolysans M341]
          Length = 233

 Score =  236 bits (601), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 83/233 (35%), Positives = 127/233 (54%), Gaps = 3/233 (1%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K K ++E      +   +K+     N  +     GKGV NN I+  +F  L K 
Sbjct: 2   KLLYEGKAKQLFECENNDEIYVHYKNSATAFNGVKKEEFEGKGVFNNTITSLIFEYLDKQ 61

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
           G+  +FIR++N  +Q+ + V +IPL + VRN  AGS+AK+  + EG  L + + E  Y  
Sbjct: 62  GVKTHFIRKVNETDQICKHVTIIPLEVIVRNIVAGSMAKKYGLEEGKKLKKPVFELSYKN 121

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D     L++ +H  A     + E+E +   +++IN+ +  L+L  N+ LVDF+I+ G+  
Sbjct: 122 DELNDPLINNDHAVALEIVTEEELENIRTQALKINELLQKLYLDANLVLVDFKIEFGKTK 181

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           D     I+LADEI PD CRLWD    E+ DK RF +    ++E Y EV RRL 
Sbjct: 182 D---GEIILADEISPDTCRLWDKDTNEKLDKDRFRRDLGSVMEAYEEVLRRLE 231


>gi|197285421|ref|YP_002151293.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Proteus
           mirabilis HI4320]
 gi|227355905|ref|ZP_03840297.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Proteus
           mirabilis ATCC 29906]
 gi|229564402|sp|B4EY76|PUR7_PROMH RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|194682908|emb|CAR43276.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase (SAICAR
           synthetase) [Proteus mirabilis HI4320]
 gi|227163893|gb|EEI48795.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Proteus
           mirabilis ATCC 29906]
          Length = 237

 Score =  236 bits (601), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 80/238 (33%), Positives = 130/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y       LI  F++D    +  R    + KG++NN+ + ++  +
Sbjct: 1   MQKKAELYRGKAKTVYTTESSDYLILEFRNDTSALDGQRIEQFDRKGMVNNKFNYFIMNK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   +RN AAGSL KRL I EG  L   + + 
Sbjct: 61  LEEAGIPTQMERLLSDNEVLVKKLDMVPVECVIRNRAAGSLVKRLGIEEGTVLNPPIFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  + EM  LS + ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKDDARHDPMVNESYCETFGWVSKENLAEMKRLSYKANDVLSELFDKAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G        ++VL DE  PD  RLWD +  ++ DK RF +S   L+E Y EVARR+G+
Sbjct: 181 GLF----NGKVVLGDEFSPDGSRLWDKNTLDKMDKDRFRQSLGGLIEAYEEVARRIGV 234


>gi|329769626|ref|ZP_08261030.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Gemella
           sanguinis M325]
 gi|328838381|gb|EGF87990.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Gemella
           sanguinis M325]
          Length = 235

 Score =  236 bits (601), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 80/233 (34%), Positives = 127/233 (54%), Gaps = 3/233 (1%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K K ++E      +   +K+     N  +     GKGV NN I+  +F  L K 
Sbjct: 2   KLLYEGKAKQLFECENNDEIYVHYKNSATAFNGVKKEEFEGKGVFNNTITSLIFEYLEKS 61

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
           G+  +FI+++N  +Q+ + V +IPL + VRN  AGS+AK+  + EG  L + + E  Y  
Sbjct: 62  GVETHFIKKVNETDQICKHVTIIPLEVIVRNIVAGSMAKKYGLEEGKKLKKPVFELSYKN 121

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D     L++++H  A     + E+  +   +++IN  +  L+L  N+ LVDF+I+ G+  
Sbjct: 122 DELNDPLINDDHAVALEIVTEDELANIKEQALKINSLLQKLYLEANLVLVDFKIEFGKDK 181

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           +    +I+LADEI PD CRLWD    E+ DK RF +    ++E Y EV RRL 
Sbjct: 182 N---GKIILADEISPDTCRLWDKDTNEKLDKDRFRRDLGSVMEAYEEVLRRLE 231


>gi|312135251|ref|YP_004002589.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caldicellulosiruptor owensensis OL]
 gi|311775302|gb|ADQ04789.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caldicellulosiruptor owensensis OL]
          Length = 250

 Score =  236 bits (601), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 91/237 (38%), Positives = 137/237 (57%), Gaps = 4/237 (1%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K K +YE      ++  +KDD    +  +   +N KG++NN +S Y F  L   
Sbjct: 7   KLLYEGKAKKVYETNCQDVVVIEYKDDATAFDGTKRGIINNKGIVNNLVSNYFFKILESN 66

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
            IP +FI +I+ R+  V+ V++IP+ + VRN AAGSL KRL + EG  L R ++EF Y  
Sbjct: 67  KIPTHFIEQIDERKTAVKKVQIIPVEVIVRNIAAGSLCKRLGLEEGAILKRPILEFCYKN 126

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D+     V++ HI A   A + E++++   S +IND +      +NI L+DF+++ GR  
Sbjct: 127 DALRDPQVNQYHILALELATEDEIKKIEEYSFKINDVLRNYLKQVNIDLIDFKLEFGRY- 185

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKK 241
                 I+LADEI PD CR WD++ KE+ DK RF +    + E Y E+ RRLG+ KK
Sbjct: 186 ---KGEIILADEISPDTCRFWDVATKEKLDKDRFRRDLGNVEEAYMEILRRLGLDKK 239


>gi|292488997|ref|YP_003531884.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Erwinia
           amylovora CFBP1430]
 gi|292900132|ref|YP_003539501.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Erwinia
           amylovora ATCC 49946]
 gi|291199980|emb|CBJ47104.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Erwinia
           amylovora ATCC 49946]
 gi|291554431|emb|CBA21907.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Erwinia
           amylovora CFBP1430]
 gi|312173161|emb|CBX81416.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Erwinia
           amylovora ATCC BAA-2158]
          Length = 237

 Score =  236 bits (601), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 77/238 (32%), Positives = 129/238 (54%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKKAELYRGKAKTVYSTENPDLLVLEFRNDTSALDGERIEQFDRKGMINNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP      ++  E LV++++M+P+   +RN AAGSL KRL + EG+ L   L + 
Sbjct: 61  LQEAGIPTQMEALLSDNEALVKNLDMVPVECVIRNRAAGSLVKRLGVEEGMILNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W +++ +  M  L+ + ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKDDAKHDPMVNESYCETFGWVSKANLARMQELTFQANDVLSKLFADAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK R+ +S   L+E Y EVA RLG+
Sbjct: 181 GLF----KGEVVLGDEFSPDGARLWDKDTLNKMDKDRYRQSLGGLIEAYEEVANRLGV 234


>gi|257887626|ref|ZP_05667279.1| saicar synthetase [Enterococcus faecium 1,141,733]
 gi|257823680|gb|EEV50612.1| saicar synthetase [Enterococcus faecium 1,141,733]
          Length = 242

 Score =  235 bits (600), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 88/243 (36%), Positives = 134/243 (55%), Gaps = 4/243 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K +Y   +   +   + D     N  R   ++GKG LNN+I+  +F  
Sbjct: 1   MEKKELLYEGKAKKLYLTSDENLIWVEYLDQATALNGARKDQISGKGELNNKITSTIFRY 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI ++FI +++  EQLV+ V++IPL + +RN AAGS +KRL +PEG  L + +VEF
Sbjct: 61  LTQRGIKNHFIEQLSKTEQLVKKVQIIPLEVVIRNIAAGSFSKRLGVPEGKKLIKPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D  +   V+EEHI     A   E+ E+   ++ IN  +  LF  + + LVDF+++ 
Sbjct: 121 YYKDDQLDDPFVNEEHIYYLQLAKPEEISELKTQALAINKILIELFAKVGLVLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GR       +I+LADE+ PD CRLWD    E  DK  + +    L+  Y EV  RL    
Sbjct: 181 GR----SNEKILLADEVTPDTCRLWDEHTNEHMDKDVYRRGLGNLIPVYQEVYNRLSELT 236

Query: 241 KNE 243
           + +
Sbjct: 237 EEK 239


>gi|57239427|ref|YP_180563.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58579399|ref|YP_197611.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ehrlichia
           ruminantium str. Welgevonden]
 gi|57161506|emb|CAH58432.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58418025|emb|CAI27229.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Ehrlichia
           ruminantium str. Welgevonden]
          Length = 250

 Score =  235 bits (600), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 94/238 (39%), Positives = 146/238 (61%), Gaps = 1/238 (0%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K KII+   +   +IQ FKD+    NN +   +  KGV+NN IS ++  +L   
Sbjct: 13  QKIYEGKAKIIFSTSKSTEVIQHFKDNITAFNNKKADIIPEKGVVNNYISAFIMKKLTST 72

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
           GI  +FI  +N REQL++ V +IP+ + VRNT+AG+ +KR N+ +G++    ++EFYY  
Sbjct: 73  GIKTHFISLLNDREQLIKHVTIIPIEVVVRNTSAGNFSKRFNMKDGITFRLPILEFYYKD 132

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D     ++SE HI +F      E++ +  LS+ IND ++ LFL +NI+LVDF+++ GRL 
Sbjct: 133 DELHDPMISESHILSFQLLTSYELDMIKKLSLHINDVLSKLFLDVNIKLVDFKLEFGRLY 192

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKKN 242
           ++    ++LADEI PD CRLWD+S  E+ DK  +      ++E Y EVA+RL     +
Sbjct: 193 NNQT-ELLLADEISPDTCRLWDISTNEKLDKDCYRLDLGNVIERYKEVAQRLHAIPSS 249


>gi|81299736|ref|YP_399944.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Synechococcus elongatus PCC 7942]
 gi|81168617|gb|ABB56957.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Synechococcus elongatus PCC 7942]
          Length = 241

 Score =  235 bits (600), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 83/233 (35%), Positives = 129/233 (55%), Gaps = 7/233 (3%)

Query: 6   PVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIG 65
           P+YE K KI+Y   +P     +FKDD    N  +   ++GKG +N  +S Y+F  L + G
Sbjct: 4   PLYEGKAKIVYATDDPQVYRTYFKDDATAFNAQKRGQISGKGAINCAVSSYLFRVLAQAG 63

Query: 66  IPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPD 125
           + ++FI +I+ RE  V+ VE++PL + VRN AAGSL K+  I EG ++   LVEFY   D
Sbjct: 64  VTNHFIEQISEREMRVQAVEIVPLEVVVRNLAAGSLCKQTGIAEGTAIAPPLVEFYLKDD 123

Query: 126 SSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLLD 185
           +    L++ + +     A ++EV+ +   ++++N  +   F    I LVDF+++ GR   
Sbjct: 124 ALGDPLLTPDRLRLLQVATEAEVQHLQGAALQVNTLLQAFFNRCGITLVDFKLEFGRD-- 181

Query: 186 DDILRIVLADEIFPDCCRLWDLS----KKEECDKKRFSKSNDQLLEGYSEVAR 234
               +I+LADEI PD CRLWD      +K   DK RF +    +   Y+ V  
Sbjct: 182 -RQGQILLADEISPDTCRLWDQQETDPEKRILDKDRFRRDLGNVEAAYARVLE 233


>gi|56750624|ref|YP_171325.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Synechococcus elongatus PCC 6301]
 gi|56685583|dbj|BAD78805.1| phosphoribosyl aminoidazole succinocarboxamide synthetase
           [Synechococcus elongatus PCC 6301]
          Length = 241

 Score =  235 bits (600), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 83/233 (35%), Positives = 129/233 (55%), Gaps = 7/233 (3%)

Query: 6   PVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIG 65
           P+YE K KI+Y   +P     +FKDD    N  +   ++GKG +N  +S Y+F  L + G
Sbjct: 4   PLYEGKAKIVYATDDPQVYRTYFKDDATAFNAQKRGQISGKGAINCAVSSYLFRVLAQAG 63

Query: 66  IPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPD 125
           + ++FI +I+ RE  V+ VE++PL + VRN AAGSL K+  I EG ++   LVEFY   D
Sbjct: 64  VTNHFIEQISEREMRVQAVEIVPLEVVVRNLAAGSLCKQTGIAEGTAIAPPLVEFYLKDD 123

Query: 126 SSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLLD 185
           +    L++ + +     A ++EV+ +   ++++N  +   F    I LVDF+++ GR   
Sbjct: 124 ALGDPLLTPDRLRLLQVATEAEVQHLQGAALQVNTLLQAFFNRCGITLVDFKLEFGRD-- 181

Query: 186 DDILRIVLADEIFPDCCRLWDLS----KKEECDKKRFSKSNDQLLEGYSEVAR 234
               +I+LADEI PD CRLWD      +K   DK RF +    +   Y+ V  
Sbjct: 182 -RQGQILLADEISPDTCRLWDQQEIDPEKRILDKDRFRRDLGNVEAAYARVLE 233


>gi|282898744|ref|ZP_06306731.1| SAICAR synthetase [Cylindrospermopsis raciborskii CS-505]
 gi|281196271|gb|EFA71181.1| SAICAR synthetase [Cylindrospermopsis raciborskii CS-505]
          Length = 244

 Score =  235 bits (600), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 85/239 (35%), Positives = 133/239 (55%), Gaps = 7/239 (2%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
              N +YE K KIIY   +P  L+  FKDD    N  +  ++ GKG +N  IS  +F ++
Sbjct: 4   NTNNKLYEGKAKIIYTTEDPQVLLAEFKDDATAFNAKKRGSIQGKGSINCTISSKLFLRM 63

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            + GI ++FI      +  V+ ++++PL + VRN AAGSL ++  I  G  L R LVEFY
Sbjct: 64  AQEGIENHFIDSPGAGQMRVKALKILPLEVVVRNIAAGSLCQQTGIELGTVLERPLVEFY 123

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     L++ E ++    A + +V ++  L+++IN F+  L+   +I LVDF+++ G
Sbjct: 124 YKDDKLGDPLLTRERLSLLKLATEEQVGQIIRLALQINTFLQDLWQQCSITLVDFKLEFG 183

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSK----KEECDKKRFSKSNDQLLEGYSEVARRL 236
                   +++LADEI PD CRLWD+S+        DK RF +   ++ + Y EV  RL
Sbjct: 184 LD---QQHKLLLADEISPDTCRLWDMSEVDPIHRVLDKDRFRRDLGKVEDAYQEVLTRL 239


>gi|304414225|ref|ZP_07395593.1| Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [Candidatus Regiella insecticola LSR1]
 gi|304283439|gb|EFL91835.1| Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [Candidatus Regiella insecticola LSR1]
          Length = 249

 Score =  235 bits (599), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 82/245 (33%), Positives = 130/245 (53%), Gaps = 4/245 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+    +Y  K K +Y   +P  L+  F++D    +  R    + KG++NN+ + ++  +
Sbjct: 1   MQKLAELYRGKAKTVYTTEDPNYLVLEFRNDTSAMDGQRIQAFDRKGMINNKFNHFIMNR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GIP    R ++  E LV+ +EMIP+   +RN  AGSL KRL I E   L   L E 
Sbjct: 61  LEAAGIPTQMERLLSDNEALVKRLEMIPIECVIRNRTAGSLVKRLGITENQVLNHPLFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D     +VSE +  AF WA+++ + +M  LS ++ND ++ LF    + LVDF+++ 
Sbjct: 121 FLKNDQLHDPIVSEAYCKAFGWASEAHLAQMKKLSYQVNDVLSKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           G   +    +I L DE  PD CRLWD    E+ DK RF  +   ++E Y +VA+R+G+  
Sbjct: 181 GLFEN----KITLGDEFSPDGCRLWDKKTLEKMDKDRFRGNLGGVIEAYEQVAKRIGVPL 236

Query: 241 KNEPA 245
                
Sbjct: 237 APFSD 241


>gi|307721548|ref|YP_003892688.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sulfurimonas autotrophica DSM 16294]
 gi|306979641|gb|ADN09676.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sulfurimonas autotrophica DSM 16294]
          Length = 237

 Score =  235 bits (599), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 79/237 (33%), Positives = 128/237 (54%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K +Y   +   +I  FKDD    N  + ++  GKG LNN+IS  +F  
Sbjct: 1   MEKKGLLYEGKAKKLYLTEDENLVISEFKDDLTAFNGEKKSSEEGKGALNNKISTELFKL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP +F++ ++    L + V++I + + VRN A GSL + L I +G  LP +LVEF
Sbjct: 61  LEQNGIPTHFVKMLDDNHMLHKKVDVILIEVIVRNIATGSLTRNLGIEDGTVLPFTLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWAN-QSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIK 179
            Y  D      ++++H       + Q E++++  ++ ++ND +   F    + LVDF+++
Sbjct: 121 DYKNDELGDPKLNDQHALILGLVDFQDELDKLRRMARQVNDILKPYFAEKGLNLVDFKLE 180

Query: 180 CGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
            G+  D     I+L DEI PD CR WD+   E+ DK RF +    L   Y +V  R+
Sbjct: 181 FGKDKD---GNIILVDEISPDNCRFWDMKSGEKMDKDRFRQGLGGLTVAYEQVLNRI 234


>gi|320335358|ref|YP_004172069.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Deinococcus maricopensis DSM 21211]
 gi|319756647|gb|ADV68404.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Deinococcus maricopensis DSM 21211]
          Length = 242

 Score =  234 bits (598), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 88/235 (37%), Positives = 134/235 (57%), Gaps = 3/235 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
                 YE K K +Y   +P   +  +KDD    N  +   + GKG +NN I+  ++  L
Sbjct: 6   ERGELRYEGKAKRVYATPDPQQYVVEYKDDATAFNGQKRDQILGKGSVNNAITSALYPHL 65

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            + G+P +FI +++ REQLVR VE+IP+ + VRN AAGS +KRL I EG  L R +VE+Y
Sbjct: 66  ERAGVPTHFIAQLSEREQLVRAVEIIPVEVVVRNVAAGSFSKRLGITEGTLLARPIVEYY 125

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     L++ +   +  WA   ++  + AL++++N F+T  FL  +I+L+DF+++ G
Sbjct: 126 YKSDVLGDPLINTDTAISMGWATDEDLSTIKALALKVNAFLTPYFLARDIRLIDFKLEFG 185

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
           +  D    +IVLADEI PD CR WD    E  DK RF +    +   Y E+  R+
Sbjct: 186 KTHD---GQIVLADEISPDTCRFWDAVSGERLDKDRFRRDLGNVEGAYQEMLARV 237


>gi|320451235|ref|YP_004203331.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Thermus
           scotoductus SA-01]
 gi|320151404|gb|ADW22782.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Thermus
           scotoductus SA-01]
          Length = 231

 Score =  234 bits (598), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 81/232 (34%), Positives = 122/232 (52%), Gaps = 5/232 (2%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K KI+Y      TL  +FKD+    N  +   + GKGV+NN++S  +F  L   
Sbjct: 2   EKLYEGKAKILYP-EGTDTLRVYFKDEATAFNAQKRGLIPGKGVVNNKVSATLFRYLEAH 60

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
           G+  +F+  ++ RE  V  VE++PL + +R  AAG+ AKR  + EG  L   LVE+    
Sbjct: 61  GVRTHFLEELSDREMRVLRVEILPLEVILRFKAAGNFAKRYGVKEGTPLRGPLVEYSLKS 120

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D     L+  E I A   A + E+ ++ A ++++ + +   F    + LVDF+++ G+  
Sbjct: 121 DPLGDPLICPEAILALGLATEEELSQVKATTLKVGELLRNFFAQRGLDLVDFKLEFGK-- 178

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
                 I+LADEI PD  RLWD    E  DK RF K    + E Y EV RR+
Sbjct: 179 --RNGEILLADEISPDTMRLWDQKTGEPMDKDRFRKDLGGVEEAYQEVLRRV 228


>gi|300717911|ref|YP_003742714.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Erwinia
           billingiae Eb661]
 gi|299063747|emb|CAX60867.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Erwinia
           billingiae Eb661]
          Length = 237

 Score =  234 bits (598), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 77/238 (32%), Positives = 127/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ T+
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSALDGERIEQFDRKGMINNKFNHFIMTK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP      ++  E LV+ ++M+P+   +RN AAGSL KRL + EG+ L   L + 
Sbjct: 61  LQEAGIPTQMEALLSDNEALVKKLDMVPVECVMRNRAAGSLVKRLGVEEGMILNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W N+  +  M  L+ + N+ ++ LF    + LVDF+++ 
Sbjct: 121 FLKDDAKHDPMVNESYCETFGWVNKENLARMRELTYKANEVLSKLFSDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD     + DK R+ +S   L+E Y EVA RLG+
Sbjct: 181 GLF----KGEVVLGDEFSPDGARLWDKDTLNKMDKDRYRQSLGGLIEAYEEVATRLGV 234


>gi|289166970|ref|YP_003445237.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Streptococcus mitis B6]
 gi|288906535|emb|CBJ21367.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Streptococcus mitis B6]
          Length = 292

 Score =  234 bits (598), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 79/240 (32%), Positives = 129/240 (53%), Gaps = 5/240 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +Y  K K IY   +   +I  +KD     N  +   + GKGVLNN+IS ++F +
Sbjct: 58  MSK-QLIYSGKAKDIYTTEDENLIISTYKDQATAFNGVKKEQIAGKGVLNNQISSFIFEK 116

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+  +F+ +++  EQL + VE+IPL + +RN  AGS +KR  + EG++   S+VEF
Sbjct: 117 LNAAGVATHFVEKLSDTEQLNKKVEIIPLEVVLRNYTAGSFSKRFGVDEGIAFETSIVEF 176

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D  +   +++EH+     A+  ++  +   + RIN+ +   F  I ++L+DF+++ 
Sbjct: 177 YYKNDDLDDPFINDEHVKFLQIADDQQISYLKEETRRINELLKAWFAEIGLKLIDFKLEF 236

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           G   D    +I+LADE  PD CRLWD       DK  F +   +L + Y  V  +L   +
Sbjct: 237 GFDKD---GKIILADEFSPDNCRLWDA-DGNHMDKDVFRRGLGELTDVYEIVWEKLQGLR 292


>gi|58617454|ref|YP_196653.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ehrlichia
           ruminantium str. Gardel]
 gi|58417066|emb|CAI28179.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Ehrlichia
           ruminantium str. Gardel]
          Length = 250

 Score =  234 bits (598), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 91/238 (38%), Positives = 144/238 (60%), Gaps = 1/238 (0%)

Query: 5   NPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKI 64
             +YE K K+I+   +   +IQ FKD+    NN +   +  KGV+NN IS ++  +L   
Sbjct: 13  QKIYEGKAKVIFSTSKSTEVIQHFKDNITAFNNKKADIIPEKGVVNNYISAFIMKKLTST 72

Query: 65  GIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLP 124
           GI  +FI  +N REQL++ V +IP+ + VRN +AG+ +KR N+ +G++    ++EFYY  
Sbjct: 73  GIKTHFISLLNDREQLIKHVTIIPIEVVVRNASAGNFSKRFNMKDGITFRLPILEFYYKD 132

Query: 125 DSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLL 184
           D     ++SE HI +F      E++ +  LS+ IND ++ LF  +NI+LVDF+++ GRL 
Sbjct: 133 DELHDPMISESHILSFQLLTSYELDMIKKLSLHINDVLSKLFFDVNIKLVDFKLEFGRLY 192

Query: 185 DDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKKN 242
           ++    ++LADEI PD CRLWD+S  E+ DK  +      ++E Y EVA+RL     +
Sbjct: 193 NNQT-ELLLADEISPDTCRLWDISTNEKLDKDCYRLDLGNVIERYKEVAQRLHAIPSS 249


>gi|57505856|ref|ZP_00371781.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Campylobacter upsaliensis RM3195]
 gi|57015886|gb|EAL52675.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Campylobacter upsaliensis RM3195]
          Length = 236

 Score =  234 bits (598), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 85/237 (35%), Positives = 132/237 (55%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K K +Y+  +   LI  FKDD    N  +     GKG LN +IS  +F  
Sbjct: 1   MEKKELLYEGKGKKMYKTDDEFLLITEFKDDLTAFNAEKKGNEAGKGALNCKISTELFHL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  + ++ ++  EQLV+  +++P+ + VRN A GSL KRL I +G  LP +LVEF
Sbjct: 61  LERGGIATHLVQILSENEQLVKKCKIVPIEVIVRNVATGSLTKRLGIKDGTKLPFALVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWA-NQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIK 179
               D+     +++EH    N   NQ +++E+  ++ +IN  +   F   N++L+DF+I+
Sbjct: 121 CLKDDALGDPFINDEHCLLLNLVKNQEQIKEIKTIARKINAILLDFFDKKNLRLIDFKIE 180

Query: 180 CGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
            G   DD   +++LADEI PD CR WD    E+ DK RF +    +   Y EV +R+
Sbjct: 181 LGLDKDD---KLILADEISPDSCRFWDKETNEKLDKDRFRQDLGNVKMAYEEVLKRI 234


>gi|262377126|ref|ZP_06070351.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter lwoffii SH145]
 gi|262307864|gb|EEY89002.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter lwoffii SH145]
          Length = 239

 Score =  234 bits (598), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 87/242 (35%), Positives = 130/242 (53%), Gaps = 4/242 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +Y  K K +Y       LI  F+DD    N  +   L+ KG +NNR + ++  +
Sbjct: 1   MLKQTLLYTGKAKSVYTTDSSDHLILVFRDDASAFNGEKIEQLDRKGKVNNRFNAFIMEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GI  +F + +   E LV+ ++MIP+   +RN AAGSL +RL + EG  L     E 
Sbjct: 61  LAEAGIETHFEKLLTPNEVLVKKLDMIPVECVIRNYAAGSLCRRLGVEEGKELTPPTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           ++  D+    +V+E    A  WA   ++ +M  L+ ++ND +  LF   N+ LVDF+++ 
Sbjct: 121 FFKDDALGDPMVNESQAIALGWATAEQLAKMKELTYQVNDVLKALFDAGNMILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           G   D    RIVL DE  PD CRLWD   K++ DK RF +    ++E Y EVA RLGI  
Sbjct: 181 GVFHD----RIVLGDEFSPDGCRLWDKDTKKKLDKDRFRQGLGGVVEAYEEVAGRLGINL 236

Query: 241 KN 242
            N
Sbjct: 237 DN 238


>gi|302339612|ref|YP_003804818.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Spirochaeta smaragdinae DSM 11293]
 gi|301636797|gb|ADK82224.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Spirochaeta smaragdinae DSM 11293]
          Length = 237

 Score =  234 bits (598), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 85/239 (35%), Positives = 135/239 (56%), Gaps = 3/239 (1%)

Query: 3   PRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLG 62
               +YE K K +Y   +   ++  +KDD    N  +  T+ GKG +NN I+  +FT L 
Sbjct: 2   KGKLLYEGKAKKLYATDDAEVVLVEYKDDATAFNGEKKGTITGKGEMNNAITTLLFTLLA 61

Query: 63  KIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYY 122
           K G+ ++FI +IN REQL R VE++P+ + VRN AAGS+AKRL + EG  L  ++ E  Y
Sbjct: 62  KEGVENHFIEKINPREQLCRKVEIVPVEVIVRNKAAGSMAKRLGLEEGTELKTTVFEISY 121

Query: 123 LPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGR 182
             D     L+++ H  A       E++ +  ++ ++N+ ++  FL I I L+DF+++ GR
Sbjct: 122 KNDDLGDPLINDHHAVAIGLTTFEELKAIYNMAAKVNEVLSAFFLKIGITLIDFKLEFGR 181

Query: 183 LLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKK 241
             D    R++LADEI PD CR WD +  ++ DK RF +    + + Y EV  R+    +
Sbjct: 182 ASD---GRLLLADEISPDTCRFWDAATGKKLDKDRFRRDLGSVEDAYHEVLSRMENAGE 237


>gi|237752669|ref|ZP_04583149.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Helicobacter winghamensis ATCC BAA-430]
 gi|229376158|gb|EEO26249.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Helicobacter winghamensis ATCC BAA-430]
          Length = 236

 Score =  234 bits (597), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 84/237 (35%), Positives = 130/237 (54%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +YE K K +Y+  +   +I  FKDD    N  +  +  GKG+LN +IS  +F  
Sbjct: 1   MQQKEMLYEGKGKKLYKTDDENLVISEFKDDLTAFNAEKRGSEQGKGILNCKISSEIFKL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K GI  +++  +     L + V++IP+ + VRN A GSL+KRL I EG +LP +LVEF
Sbjct: 61  LEKNGIKTHYVETLADNLMLCKFVKIIPIEVVVRNIATGSLSKRLGIKEGEALPFTLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWA-NQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIK 179
           YY  D+    L+++EH    N   +   ++ +  +   +N  +   F   N+ LVDF+++
Sbjct: 121 YYKDDALGDPLINDEHALILNCVKSVESLDVLRKIGREVNSVLREFFDKKNLILVDFKLE 180

Query: 180 CGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
            G   D     I+LADEI PD CR WD   KE+ DK RF +    +   Y E+ +R+
Sbjct: 181 FGVDKD---GNILLADEITPDSCRFWDKDTKEKLDKDRFRQDLGNVKMAYEEILKRI 234


>gi|313623340|gb|EFR93569.1| phosphoribosylaminoimidazolesuccinocarboxamidesynthase [Listeria
           innocua FSL J1-023]
          Length = 237

 Score =  234 bits (597), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 92/233 (39%), Positives = 137/233 (58%), Gaps = 3/233 (1%)

Query: 4   RNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGK 63
              +YE K K +++  E G L   +KDD    N  R  +  GKG LNN+I+  +F+ L K
Sbjct: 3   NELLYEGKAKRLFKTDEAGVLRVAYKDDATALNGVRKESFAGKGELNNQITSLIFSYLAK 62

Query: 64  IGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYL 123
            GI  +FI+ I+  EQLV++V +IPL + VRN  AGSLAKRL   EG  +P ++VEFYY 
Sbjct: 63  EGISSHFIQAISETEQLVKEVSIIPLEVVVRNVMAGSLAKRLGKEEGEEIPNAIVEFYYK 122

Query: 124 PDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRL 183
            D+ +   ++++H+     A  +E+E +   +  IN+ +  LF  +NI L+DF+++ GR 
Sbjct: 123 DDALDDPFINDDHVLYLGIATMAEMETIRKAARTINEVLQTLFNQMNITLIDFKLEFGRD 182

Query: 184 LDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
                  I+LADEI PD CRLWD    ++ DK  F ++   L + Y+EV  RL
Sbjct: 183 ---AAGNILLADEISPDTCRLWDKETNQKLDKDVFRRNIGNLTDVYTEVLNRL 232


>gi|108803834|ref|YP_643771.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rubrobacter xylanophilus DSM 9941]
 gi|108765077|gb|ABG03959.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rubrobacter xylanophilus DSM 9941]
          Length = 237

 Score =  234 bits (597), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 81/234 (34%), Positives = 117/234 (50%), Gaps = 4/234 (1%)

Query: 3   PRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLG 62
            R  +YE K K ++E  E G L+  +KD+    N  +  +  GKG  N  IS  +F  L 
Sbjct: 2   KRTLLYEGKAKQVFETGEEGVLLHRYKDEATAFNARKRGSWAGKGRANASISAAVFAYLE 61

Query: 63  KIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYY 122
           + GIP +FI +++      R + M+P+ I VRN AAGSLA+ L   EG  L   +VE  Y
Sbjct: 62  RRGIPTHFIEQVDEVTLKTRRLRMLPVEIIVRNLAAGSLARLLGYEEGRPLKAPVVELCY 121

Query: 123 LPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGR 182
             D+    +++  H          E+       +R+N+ +   F    + LVDF+I+ GR
Sbjct: 122 KNDALGDPMLNWYHFRELGL-TDEELRACEEFGLRVNEALRPFFEERGMVLVDFKIEVGR 180

Query: 183 LLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
                   +VLADEI PD CRLWD    +  DK RF +    + E Y EV RR+
Sbjct: 181 D---AGGSLVLADEISPDTCRLWDKETGQRLDKDRFRRDLGGVEEAYEEVLRRV 231


>gi|315303654|ref|ZP_07874184.1| phosphoribosylaminoimidazolesuccinocarboxamidesynthase [Listeria
           ivanovii FSL F6-596]
 gi|313627975|gb|EFR96578.1| phosphoribosylaminoimidazolesuccinocarboxamidesynthase [Listeria
           ivanovii FSL F6-596]
          Length = 237

 Score =  234 bits (597), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 92/233 (39%), Positives = 136/233 (58%), Gaps = 3/233 (1%)

Query: 4   RNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGK 63
              VYE K K ++   E G L   +KDD    N  R  +  GKG LNN+I+  +F+ L K
Sbjct: 3   NELVYEGKAKQLFRTEESGVLRVAYKDDATALNGVRKESFAGKGELNNQITSLIFSYLAK 62

Query: 64  IGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYL 123
            G+  +F+  I+  EQLV++V +IPL + VRN  AGSLAKRL   EG  +P ++VEFYY 
Sbjct: 63  EGVTSHFVSAISKTEQLVKEVSIIPLEVVVRNVMAGSLAKRLGKEEGEPIPNAIVEFYYK 122

Query: 124 PDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRL 183
            D+ +   +++EH      A ++E+EE+   +  IN  +  LF  ++I L+DF+++ GR 
Sbjct: 123 DDALDDPFINDEHALYLEIATRNEMEEIRQAARAINVALQALFTKMSITLIDFKLEFGRD 182

Query: 184 LDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
            +     I+LADEI PD CRLWD    ++ DK  F ++   L + Y+EV  RL
Sbjct: 183 EN---GNILLADEISPDTCRLWDKETNQKLDKDVFRRNIGNLTDVYTEVLNRL 232


>gi|325570625|ref|ZP_08146351.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Enterococcus casseliflavus ATCC 12755]
 gi|325156471|gb|EGC68651.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Enterococcus casseliflavus ATCC 12755]
          Length = 241

 Score =  234 bits (597), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 85/237 (35%), Positives = 135/237 (56%), Gaps = 3/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +++  E   L   + D     N  +   + GKG LNN+I+ ++F +
Sbjct: 1   MESEVLLYEGKAKKLFKTNEEDVLRVLYLDQATALNGLKKDAVAGKGALNNQITAHLFQR 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L    +P +F++ ++  EQL+R V MIPL + VRNTAAGS +KRL I EG  LP+ +VEF
Sbjct: 61  LADKNVPSHFLQLVSKHEQLIRAVTMIPLEVVVRNTAAGSFSKRLGIEEGTKLPKPIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D  +   ++++H+     A + E++ +  L++++N  +  +F  I IQL+DF+I+ 
Sbjct: 121 YYKEDRLDDPFINDDHVFYLGLATKEELDLIKKLALQVNAALLEIFASIQIQLIDFKIEI 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           G+        ++LADEI PD CRLWD+   E  DK  + +    ++  Y EV  RL 
Sbjct: 181 GKT---KKGELLLADEISPDTCRLWDMGTNEHLDKDVYRRDLGDIVPVYEEVLNRLE 234


>gi|254458648|ref|ZP_05072072.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Campylobacterales bacterium GD 1]
 gi|207084414|gb|EDZ61702.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Campylobacterales bacterium GD 1]
          Length = 237

 Score =  234 bits (597), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 78/237 (32%), Positives = 126/237 (53%), Gaps = 4/237 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +YE K K ++   +   +I  FKDD    N  + ++  GKG LNN+IS  +F  
Sbjct: 1   MEKRALLYEGKAKKLFLTDDENLVISEFKDDLTAFNGEKKSSEAGKGALNNKISTELFKL 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +F+  ++    L + V++I + + VRN A GSL++ L I +G  LP +LVEF
Sbjct: 61  LEANGIQTHFVEMLDDNHMLHKKVDVILIEVIVRNIATGSLSRNLGIEDGKVLPFTLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWAN-QSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIK 179
            Y  D+     ++++H       + Q E++++  ++ +IND +   F    + LVDF+++
Sbjct: 121 DYKDDALGDPKLNDQHALILGLVDYQDELDKLRRMARQINDILRPYFFEKGLNLVDFKLE 180

Query: 180 CGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
            G+        I+L DEI PD CR WD+   E+ DK RF +    L   Y +V  R+
Sbjct: 181 FGKD---SSGNIILIDEISPDNCRFWDVESGEKMDKDRFRQGLGGLTVAYEQVLNRI 234


>gi|330968861|gb|EGH68927.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 226

 Score =  234 bits (597), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 81/230 (35%), Positives = 123/230 (53%), Gaps = 4/230 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  R  +Y  K K +Y+  +   LI  F++D    +  R   L+ KG++NN+ + ++  +
Sbjct: 1   MEKREELYRGKAKSVYKTDDADRLILLFRNDTSAFDGKRIEQLDRKGMVNNKFNAFIMQK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP  F + +   E LV+ ++MIP+   VRN AAGSL KRL I EG  L     E 
Sbjct: 61  LEEAGIPTQFDKLLGDNECLVKKLDMIPVECVVRNYAAGSLVKRLGIEEGTKLNPYTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+     ++E H+ AF W    ++  M  LSI++ND +T LF    + LVDF+++ 
Sbjct: 121 FLKDDAKGDPFINESHVVAFGWGTAEQLARMKELSIKVNDVLTKLFDDAGLLLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYS 230
           G         IVL DE  PD CRLWD   +++ DK RF +    ++E Y 
Sbjct: 181 GVFH----GEIVLGDEFSPDGCRLWDKDTRKKMDKDRFRQGLGDVIEAYE 226


>gi|224499509|ref|ZP_03667858.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Listeria
           monocytogenes Finland 1988]
 gi|254829475|ref|ZP_05234162.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Listeria
           monocytogenes FSL N3-165]
 gi|254832517|ref|ZP_05237172.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Listeria
           monocytogenes 10403S]
 gi|258601890|gb|EEW15215.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Listeria
           monocytogenes FSL N3-165]
          Length = 237

 Score =  234 bits (597), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 93/233 (39%), Positives = 136/233 (58%), Gaps = 3/233 (1%)

Query: 4   RNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGK 63
              VYE K K +++  E G L   +KDD    N  R  +  GKG LNN+I+  +F+ L +
Sbjct: 3   NELVYEGKAKRLFKTEEAGVLRVAYKDDATALNGVRKESFAGKGELNNQITSLIFSHLAE 62

Query: 64  IGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYL 123
            GI  +FIR I+  EQLV++V +IPL + VRN  AGSLAKRL   EG  +P ++VEFYY 
Sbjct: 63  AGIESHFIRAISETEQLVKEVSIIPLEVVVRNVMAGSLAKRLGKEEGEPIPNAIVEFYYK 122

Query: 124 PDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRL 183
            D+ +   ++++H+     A  SE++ +   +  IN  +  LF  +NI L+DF+++ GR 
Sbjct: 123 DDALDDPFINDDHVLYLEVATTSEMDTIRQAARSINKVLQELFNQMNITLIDFKLEFGRD 182

Query: 184 LDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
                  I+LADEI PD CRLWD    ++ DK  F ++   L + Y+EV  RL
Sbjct: 183 ---AAGEILLADEISPDTCRLWDKETNQKLDKDVFRRNIGNLTDVYTEVLNRL 232


>gi|16803812|ref|NP_465297.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Listeria
           monocytogenes EGD-e]
 gi|224503302|ref|ZP_03671609.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Listeria
           monocytogenes FSL R2-561]
 gi|22001854|sp|Q8Y6B9|PUR7_LISMO RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|16411226|emb|CAC99850.1| phosphoribosylaminoimidazole succinocarboxamide synthetase
           [Listeria monocytogenes EGD-e]
          Length = 237

 Score =  234 bits (597), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 93/233 (39%), Positives = 136/233 (58%), Gaps = 3/233 (1%)

Query: 4   RNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGK 63
              VYE K K +++  E G L   +KDD    N  R  +  GKG LNN+I+  +F+ L +
Sbjct: 3   NELVYEGKAKRLFKTEEAGVLRVAYKDDATALNGVRKESFAGKGELNNQITSLIFSHLAE 62

Query: 64  IGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYL 123
            GI  +FIR I+  EQLV++V +IPL + VRN  AGSLAKRL   EG  +P ++VEFYY 
Sbjct: 63  AGIESHFIRAISETEQLVKEVSIIPLEVVVRNVMAGSLAKRLGKEEGEQIPNAIVEFYYK 122

Query: 124 PDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRL 183
            D+ +   ++++H+     A  SE++ +   +  IN  +  LF  +NI L+DF+++ GR 
Sbjct: 123 DDALDDPFINDDHVLYLEVATTSEMDTIRQAARSINKVLQELFNQMNITLIDFKLEFGRD 182

Query: 184 LDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
                  I+LADEI PD CRLWD    ++ DK  F ++   L + Y+EV  RL
Sbjct: 183 ---AAGEILLADEISPDTCRLWDKETNQKLDKDVFRRNIGNLTDVYTEVLNRL 232


>gi|284802216|ref|YP_003414081.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Listeria
           monocytogenes 08-5578]
 gi|284995358|ref|YP_003417126.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Listeria
           monocytogenes 08-5923]
 gi|284057778|gb|ADB68719.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Listeria
           monocytogenes 08-5578]
 gi|284060825|gb|ADB71764.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Listeria
           monocytogenes 08-5923]
          Length = 237

 Score =  234 bits (597), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 91/233 (39%), Positives = 136/233 (58%), Gaps = 3/233 (1%)

Query: 4   RNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGK 63
              VYE K K +++  E G L   +KDD    N  R  +  GKG LNN+I+  +F+ L +
Sbjct: 3   NELVYEGKAKRLFKTEESGVLRVAYKDDATALNGVRKESFAGKGELNNQITSLIFSHLAE 62

Query: 64  IGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYL 123
            GI  +FIR I+  EQLV++V +IPL + VRN  AGSLAKRL   EG  +P ++VEFY+ 
Sbjct: 63  AGIESHFIRAISETEQLVKEVSIIPLEVVVRNVMAGSLAKRLGKEEGEPIPNAIVEFYFK 122

Query: 124 PDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRL 183
            D+ +   ++++H+     A  +E++ +   +  IN  +  LF  +NI L+DF+++ GR 
Sbjct: 123 EDALDDPFINDDHVLYLEIATTNEMDAIRQAARSINKVLQELFNQMNITLIDFKLEFGRD 182

Query: 184 LDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
                  I+LADEI PD CRLWD    ++ DK  F ++   L + Y+EV  RL
Sbjct: 183 ---ATGNILLADEISPDTCRLWDKGTNQKLDKDVFRRNIGNLTDVYTEVLNRL 232


>gi|306828484|ref|ZP_07461679.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Streptococcus mitis ATCC 6249]
 gi|304429283|gb|EFM32368.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Streptococcus mitis ATCC 6249]
          Length = 249

 Score =  234 bits (597), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 80/240 (33%), Positives = 128/240 (53%), Gaps = 5/240 (2%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +Y  K K IY   +   +I  +KD     N  +   + GKGVLNN+IS ++F +
Sbjct: 15  MSK-KLIYSGKAKDIYTTEDENLIISTYKDQATAFNGVKKEQIAGKGVLNNQISSFIFEK 73

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   G+  +F+ +++  EQL + VE+IPL + +RN  AGS +KR  + EG++    +VEF
Sbjct: 74  LNAAGVATHFVDKLSDTEQLNKKVEIIPLEVVLRNYTAGSFSKRFGVEEGIAFETPIVEF 133

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D  +   +++EH+     A+  +V  +   + RIN+ +   F  I ++L+DF+++ 
Sbjct: 134 YYKNDDLDDPFINDEHVKFLKIADDQQVAYLKEETRRINELLKAWFAEIGLKLIDFKLEF 193

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           G   D    +I+LADE  PD CRLWD       DK  F +   +L + Y  V  +L   K
Sbjct: 194 GFDKD---GKIILADEFSPDNCRLWDA-DGNHMDKDVFRRGLGELTDVYEIVWEKLQALK 249


>gi|255318067|ref|ZP_05359312.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Acinetobacter radioresistens SK82]
 gi|262380588|ref|ZP_06073742.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter radioresistens SH164]
 gi|255304890|gb|EET84062.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Acinetobacter radioresistens SK82]
 gi|262298034|gb|EEY85949.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acinetobacter radioresistens SH164]
          Length = 239

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 88/238 (36%), Positives = 131/238 (55%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +Y  K K +YE      LI  F+DD    N  +   L+ KG +NNR + ++  +
Sbjct: 1   MLKQTLLYTGKAKSVYETDSADHLILVFRDDASAFNGEKIEQLDRKGKVNNRFNAFIMEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +F + ++  E LV+ ++MIP+   +RN AAGSL +RL I EG  L     E 
Sbjct: 61  LAAAGIETHFEKLLSPTEVLVKKLKMIPVECVIRNYAAGSLCRRLGIEEGKELNPPTFEL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           ++  D     +V+E    A +WA   ++E+M  L+ ++N+ +  LF   N+ LVDF+++ 
Sbjct: 121 FFKDDGLGDPMVNESQAIALSWATAEQLEQMKVLTYKVNEVLKDLFAQGNMLLVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G   D    RIVL DE  PD CRLWD   K++ DK RF +    ++E Y EVA RLGI
Sbjct: 181 GVFHD----RIVLGDEFSPDGCRLWDKDTKKKLDKDRFRQGLGGVVEAYEEVAARLGI 234


>gi|23098197|ref|NP_691663.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oceanobacillus iheyensis HTE831]
 gi|39931977|sp|Q8ES99|PUR7_OCEIH RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|22776422|dbj|BAC12698.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Oceanobacillus iheyensis HTE831]
          Length = 237

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 80/237 (33%), Positives = 130/237 (54%), Gaps = 4/237 (1%)

Query: 3   PRNPVYEEKTKIIY-EGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
               +YE K K +Y    +   L+  +K+D    N  + +   GKG LNN IS  +F +L
Sbjct: 2   KAALLYEGKAKKVYQSSEDEHQLVLSYKNDATAFNGEKKSQFEGKGRLNNEISSLIFQRL 61

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            + GI  +FI+R++  +Q+V+   +IPL + +RN A GS+ KRL I E +S    L+E +
Sbjct: 62  HEAGISTHFIKRLDSTQQIVQKTSIIPLEVVIRNLATGSITKRLGIKEKVSFTPPLLELF 121

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D+    L+++EH        ++E+ E+   +  +N  +  +F  I I+LVDF+++ G
Sbjct: 122 YKDDALGDPLINDEHALLLTDITETELAEIKDKAREVNAALQEIFQSIGIKLVDFKLEFG 181

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           R  D     I+L+DE+ PD CRLWD+   E+ DK  F +    L+  Y E+  RL +
Sbjct: 182 RNKD---GEILLSDEVSPDTCRLWDIETNEKLDKDVFRQGTGDLITVYQEILNRLEV 235


>gi|223932384|ref|ZP_03624387.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptococcus suis 89/1591]
 gi|330831876|ref|YP_004400701.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptococcus suis ST3]
 gi|223899065|gb|EEF65423.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptococcus suis 89/1591]
 gi|329306099|gb|AEB80515.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptococcus suis ST3]
          Length = 235

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 85/234 (36%), Positives = 130/234 (55%), Gaps = 4/234 (1%)

Query: 3   PRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLG 62
             + +Y  K K IY   +   ++  +KD     N  +   + GKG LNN IS  +F +L 
Sbjct: 2   KTDLLYSGKAKDIYATADSDQIVAVYKDQATAFNGGKKEQIVGKGRLNNLISSLIFEKLN 61

Query: 63  KIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYY 122
           + G+P +FI+R++  EQL + VE+IPL + +RN  AGS +KR  + EG++LP  +VEFYY
Sbjct: 62  EAGVPTHFIKRLSDSEQLNKKVEIIPLEVVLRNVTAGSFSKRFGVEEGITLPTPIVEFYY 121

Query: 123 LPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGR 182
             D  +   +++EHI     A+Q ++  +   + RIN+F+  LF  I + LVDF+++ G 
Sbjct: 122 KKDELDDPFINDEHIAFLELASQDQIAYIKEETRRINEFLKDLFAQIGLTLVDFKLEFGV 181

Query: 183 LLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRL 236
                  +I+LADE  PD CRLWD       DK  F +   +L E Y  V  +L
Sbjct: 182 D---SSGQILLADEFSPDNCRLWDA-DGNHLDKDVFRRGLGELTEVYEVVLAKL 231


>gi|78213635|ref|YP_382414.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Synechococcus sp. CC9605]
 gi|123577639|sp|Q3AHS3|PUR7_SYNSC RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|78198094|gb|ABB35859.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Synechococcus sp. CC9605]
          Length = 250

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 79/237 (33%), Positives = 127/237 (53%), Gaps = 7/237 (2%)

Query: 4   RNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGK 63
              +YE K K ++   +P  ++  FK+D    N  + A L+GKG LN +IS  +F  L +
Sbjct: 6   GELLYEGKAKRVFASTDPDRVLVEFKNDATAFNAQKKAQLDGKGRLNCQISARLFDLLER 65

Query: 64  IGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYL 123
            G+P ++         LVR V +IPL + +RN A GSL ++  I EG ++  +L++ YY 
Sbjct: 66  EGVPTHYCGLAGETWMLVRRVRIIPLEVVLRNIATGSLCRQTPIAEGTAIEPALLDLYYK 125

Query: 124 PDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRL 183
            DS    L++E  +     A+ +++  +  L+ R+N  +   F  +++QLVDF+++ G  
Sbjct: 126 DDSLGDPLLTEARVQLLGVADTAQLSAIEQLARRVNAVLLPFFDELDLQLVDFKLELGLA 185

Query: 184 LDDDILRIVLADEIFPDCCRLWDLSKK----EECDKKRFSKSNDQLLEGYSEVARRL 236
            D     ++LADEI PD CRLWD           DK RF K    ++E Y EV +R+
Sbjct: 186 SD---GTLLLADEISPDTCRLWDRRNSNAEDRILDKDRFRKDLGGVMEAYGEVLKRV 239


>gi|254853682|ref|ZP_05243030.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Listeria
           monocytogenes FSL R2-503]
 gi|300765968|ref|ZP_07075940.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Listeria
           monocytogenes FSL N1-017]
 gi|258607061|gb|EEW19669.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Listeria
           monocytogenes FSL R2-503]
 gi|300513354|gb|EFK40429.1| phosphoribosyl