RPSBLAST alignment for GI: 254780973 and conserved domain: cd01415

>gnl|CDD|133470 cd01415, SAICAR_synt_PurC, bacterial and archaeal 5-aminoimidazole-4-(N-succinylcarboxamide) ribonucleotide (SAICAR) synthase. A subfamily of SAICAR synthetases represented by the Thermotoga maritima (Tm) enzyme and E. coli PurC. SAICAR synthetase catalyzes the seventh step of the de novo biosynthesis of purine nucleotides (also reported as eighth step). It converts 5-aminoimidazole-4-carboxyribonucleotide (CAIR), ATP, and L-aspartate into 5-aminoimidazole-4-(N-succinylcarboxamide) ribonucleotide (SAICAR), ADP, and phosphate. Length = 230
 Score =  264 bits (678), Expect = 1e-71
 Identities = 108/232 (46%), Positives = 144/232 (62%), Gaps = 3/232 (1%)

Query: 7   VYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIGI 66
           +YE K KI+Y   +P  LI  FKDD    N  +  T+ GKGVLNN IS  +F  L + GI
Sbjct: 2   LYEGKAKIVYATDDPDVLIVEFKDDATAFNGKKKDTIEGKGVLNNEISALIFKYLEENGI 61

Query: 67  PHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPDS 126
             +FI +++ REQLV+ VE+IPL + VRN AAGSL KRL I EG  L   +VEFYY  D 
Sbjct: 62  KTHFIEKLSDREQLVKKVEIIPLEVVVRNIAAGSLVKRLGIEEGTVLDPPIVEFYYKNDE 121

Query: 127 SEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLLDD 186
               L++E+HI A   A + E++E+  L+++IN+ ++  F  I I LVDF+++ GR  D 
Sbjct: 122 LGDPLINEDHILALGLATEEELKEIKELALKINEVLSEFFAEIGIILVDFKLEFGRDKDG 181

Query: 187 DILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
               IVLADEI PD CRLWD    E+ DK RF +    ++E Y EV +RLG 
Sbjct: 182 ---EIVLADEISPDTCRLWDKETGEKLDKDRFRRDLGDVIEAYEEVLKRLGE 230