RPSBLAST alignment for GI: 254780973 and conserved domain: COG0152

>gnl|CDD|30501 COG0152, PurC, Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase [Nucleotide transport and metabolism]. Length = 247
 Score =  222 bits (567), Expect = 7e-59
 Identities = 101/245 (41%), Positives = 138/245 (56%), Gaps = 4/245 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M     +YE K K +YE  +P  LI  F D     +  +   + GKG LNN+IS ++F +
Sbjct: 1   MEKLRLLYEGKAKDLYETDDPDLLIMEFSDRASAFDGEKKDQIPGKGALNNQISAFIFEK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP +FI  ++ REQLV+ +E+IPL + VRN AAGSL KR  I EG  L   LVEF
Sbjct: 61  LEEAGIPTHFIELLSDREQLVKKLEIIPLEVVVRNYAAGSLLKRYGIEEGTVLGIPLVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
            Y  D     +V++EHI+A   A   E+EE+  L+++IN+ +  LF    I LVDF+++ 
Sbjct: 121 LYKNDELPDPIVTDEHISALGIATPEEIEEIKELALKINEVLKDLFAKRGIILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDL-SKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
           G   D     IVLADEI PD CRLWD  + ++  DK  F +    L E Y EV  RL   
Sbjct: 181 GLDEDG---EIVLADEISPDSCRLWDAETYEKSLDKDFFRRDLGDLPELYEEVLERLSDL 237

Query: 240 KKNEP 244
            +   
Sbjct: 238 YEEAY 242