RPSBLAST alignment of GI: 254780973 and MMDB domain: 2cnq_A_113-252

>2cnq_A (A:113-252) Phosphoribosylaminoimidazole-succinocarboxamide synthase; ligase, phosphoribosylaminoimidazolesuccinocarboxamide (saicar) SYN ligase; HET: ADP AMZ AMP; 1.00A {Saccharomyces cerevisiae}Length = 140
 Score =  114 bits (287), Expect = 1e-26
 Identities = 24/141 (17%), Positives = 45/141 (31%), Gaps = 17/141 (12%)

Query: 86  MIPLLITVRNTAAGSLAKRLN-------------IPEGLSLPRSLVEFYYLPDSSEKTLV 132
           +IPL + VR    GS  K                + E    P  +       +  E    
Sbjct: 1   LIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKAEQGEH-DE 59

Query: 133 SEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLLDDDILRIV 192
           +     A     +     +  L++++            I + D + + G     +   I+
Sbjct: 60  NISPAQAAELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTN--EII 117

Query: 193 LADEIF-PDCCRLWDLSKKEE 212
           L DE+  PD  R W+ +  + 
Sbjct: 118 LVDEVLTPDSSRFWNGASYKV 138