RPSBLAST alignment of GI: 254780973 and protein with PDBid: 1kut

>1kut_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; structural genomics, saicar synthetase, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: d.143.1.1 Length = 230
 Score =  186 bits (473), Expect = 4e-48
 Identities = 67/233 (28%), Positives = 99/233 (42%), Gaps = 7/233 (3%)

Query: 8   YEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIGIP 67
           YE KTKI+         +  FKDD    +  +   L GKG +    +  +   L + GI 
Sbjct: 3   YEGKTKIVKVT--GDYALLEFKDDITAGDGLKHDVLTGKGSICAETTAILMKYLSEKGIK 60

Query: 68  HYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPDSS 127
            + +  I  R   V  ++M PL + VR   AGS  +R    EG  LP  LVEF+   D  
Sbjct: 61  THLVEYIPPRTLKVIPLKMFPLEVVVRLKKAGSFVRRYGGAEGEDLPVPLVEFFIKDDER 120

Query: 128 EKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLLDDD 187
              +V  +H+     A + + E+M   +++I   +   F   N +L D + + G   D  
Sbjct: 121 HDPMVCVDHLEILGIATKKQAEKMKEAAVKITLALKEFFERANFELWDIKYEFGLDKDG- 179

Query: 188 ILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
              +VL DEI PD  RL    K E  DK  + +     L+ Y EV        
Sbjct: 180 --NVVLGDEISPDTFRLRK--KGEIFDKDVYRRDLGDPLKKYREVLELCRSLN 228